Summary

Q8NEL0

Homolog: Q4R363.
Function: Coiled-coil domain-containing protein 54.

Statistics

Total GO Annotation: 70
Unique PROST Go: 70
Unique BLAST Go: 0

Total Homologs: 51
Unique PROST Homologs: 47
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q4R363 (Coiled-coil domain-containing protein 54) with a FATCAT P-Value: 2.01e-12 and RMSD of 3.34 angstrom. The sequence alignment identity is 92.7%.
Structural alignment shown in left. Query protein Q8NEL0 colored as red in alignment, homolog Q4R363 colored as blue. Query protein Q8NEL0 is also shown in right top, homolog Q4R363 showed in right bottom. They are colored based on secondary structures. 

  Q8NEL0 MYTLHTKRVKAAARQMWTSNLSKVRQSLKNVYHKCKIRHQDSTGYPTVTSDDCNQDDDSYDGKMNLPVVLQDVKTAQVELFSQMTDIVHMIPKVQEKTDL 100
  Q4R363 MYTLHTKRVKAAAREMWTSNVSKVRQSFKNVYHKCKIRHQDSTRYPTVTSDDCNQDDVSYDGKMNLTVVLQDVKTAQVELFSQMTDIVHAIPKVHEKTDL 100

  Q8NEL0 YQKQMEVLETRMNVNEDKQCTTTKDILSMKEDIKALKKKVTELEIQNSCSTIHCLEILEGERGKEITELLYKLIQPATLKNTLASTDMEISSAEPEKVPS 200
  Q4R363 YQKQMEVLETRMNVNEDKQGTTTKDILSMKEDIKALKKKVTELEKQNSYSRIHCLEIPEGERGEEITELLYKLIQPATLKNTLASTDREMSSAEPEKVPS 200

  Q8NEL0 YPKSTDHLEKKTISPQMKTLKKRNHQNASRSFEKAKPNIYIYPDFSTWIKLTFVHGGKWTFFLSATKLEEFIQWLLSRPTILPEEPQVITQRYCPFTGPI 300
  Q4R363 YPKSTDHLEKITISPQIKTLKKRNHQNASRNFKIAKPNIYIYPDFSTWIKLTFVHGGKWTFFLSATKLEEFIQWLLSRPTILPEEPQVITQRYCPFTGLI 300

  Q8NEL0 LSLTTICLSIFNNIYGFICSLKEEVTRL 328
  Q4R363 LSLTTICLSMFNNIYGFIRSLKEEVTRL 328

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0034142 toll-like receptor 4 signaling pathway
2. P GO:0016580 Sin3 complex
2. P GO:0009556 microsporogenesis
2. P GO:0007015 actin filament organization
2. P GO:0044414 suppression of host defenses by symbiont
2. P GO:0039501 suppression by virus of host type I interferon production
2. P GO:0007080 mitotic metaphase plate congression
2. P GO:0032922 circadian regulation of gene expression
2. P GO:0030430 host cell cytoplasm
2. P GO:0039724 suppression by virus of host viral-induced cytoplasmic pattern recognition receptor signaling pathway via inhibition of IKBKE activity
2. P GO:0051898 negative regulation of protein kinase B signaling
2. P GO:0070056 prospore membrane leading edge
2. P GO:0005080 protein kinase C binding
2. P GO:0009554 megasporogenesis
2. P GO:0070822 Sin3-type complex
2. P GO:0001819 positive regulation of cytokine production
2. P GO:0042641 actomyosin
2. P GO:0019827 stem cell population maintenance
2. P GO:0039723 suppression by virus of host viral-induced cytoplasmic pattern recognition receptor signaling pathway via inhibition of TBK1 activity
2. P GO:0042138 meiotic DNA double-strand break formation
2. P GO:0016081 synaptic vesicle docking
2. P GO:0043065 positive regulation of apoptotic process
2. P GO:0031032 actomyosin structure organization
2. P GO:0046775 suppression by virus of host cytokine production
2. P GO:0070374 positive regulation of ERK1 and ERK2 cascade
2. P GO:0000212 meiotic spindle organization
2. P GO:1901003 negative regulation of fermentation
2. P GO:0005634 nucleus
2. P GO:0030476 ascospore wall assembly
2. P GO:0032120 ascospore-type prospore membrane formation
2. P GO:0010119 regulation of stomatal movement
2. P GO:0031593 polyubiquitin modification-dependent protein binding
2. P GO:0022008 neurogenesis
2. P GO:0009553 embryo sac development
2. P GO:0051311 meiotic metaphase plate congression
2. P GO:0017075 syntaxin-1 binding
2. P GO:0039505 suppression by virus of host antigen processing and presentation of peptide antigen via MHC class II
2. P GO:0060965 negative regulation of gene silencing by miRNA
2. P GO:0044732 mitotic spindle pole body
2. P GO:0005901 caveola
2. P GO:0060629 regulation of homologous chromosome segregation
2. P GO:0030182 neuron differentiation
2. P GO:0046966 thyroid hormone receptor binding
2. P GO:0007269 neurotransmitter secretion
2. P GO:0002756 MyD88-independent toll-like receptor signaling pathway
2. P GO:0005628 prospore membrane
2. P GO:0019013 viral nucleocapsid
2. P GO:0007283 spermatogenesis
2. P GO:0000794 condensed nuclear chromosome
2. P GO:0039722 suppression by virus of host toll-like receptor signaling pathway
2. P GO:0039613 suppression by virus of host protein phosphorylation
2. P GO:0021762 substantia nigra development
2. P GO:0007129 homologous chromosome pairing at meiosis
2. P GO:0000001 mitochondrion inheritance
2. P GO:0070192 chromosome organization involved in meiotic cell cycle
2. P GO:0031262 Ndc80 complex
2. P GO:0030866 cortical actin cytoskeleton organization
2. P GO:0006915 apoptotic process
2. P GO:0033235 positive regulation of protein sumoylation
2. P GO:0015630 microtubule cytoskeleton
2. P GO:0016575 histone deacetylation
2. P GO:0003779 actin binding
2. P GO:0039557 suppression by virus of host viral-induced cytoplasmic pattern recognition receptor signaling pathway via inhibition of IRF7 activity
2. P GO:0005816 spindle pole body
2. P GO:0005856 cytoskeleton
2. P GO:0048236 plant-type sporogenesis
2. P GO:0048477 oogenesis
2. P GO:0042734 presynaptic membrane
2. P GO:0043124 negative regulation of I-kappaB kinase/NF-kappaB signaling
2. P GO:0060261 positive regulation of transcription initiation from RNA polymerase II promoter

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q8NEL0 Coiled-coil domain-containing protein 54 0 1.92e-157 0.0
1. PB Q4R363 Coiled-coil domain-containing protein 54 2.01e-12 8.34e-32 0.0
1. PB Q9DAL3 Coiled-coil domain-containing protein 54 2.63e-08 6.98e-23 4.68e-149
1. PB Q29RU3 Coiled-coil domain-containing protein 54 1.65e-05 3.94e-51 1.50e-175
2. P A4FV37 Caveolae-associated protein 3 1.52e-03 2.52e-02 NA
2. P Q9H1L0 Uncharacterized protein MIR1-1HG 1.89e-01 4.76e-03 NA
2. P O48791 Stomatal closure-related actin-binding protein 1 7.60e-03 1.64e-03 NA
2. P Q8GX05 Stomatal closure-related actin-binding protein 3 3.20e-03 2.16e-03 NA
2. P Q03039 Polymerase cofactor VP35 NA 1.30e-06 NA
2. P Q6PDM4 Interactor of HORMAD1 protein 1 7.55e-03 2.40e-05 NA
2. P Q75AC2 Biogenesis of lysosome-related organelles complex 1 subunit VAB2 6.10e-03 2.89e-04 NA
2. P Q3KPT0 Coiled-coil domain-containing protein 169 8.52e-05 3.53e-02 NA
2. P Q969G5 Caveolae-associated protein 3 1.51e-03 2.62e-03 NA
2. P A0A1B0GTR0 Epididymal protein 13 2.77e-02 4.64e-02 NA
2. P O74324 Uncharacterized protein C1685.04 6.45e-06 9.33e-04 NA
2. P Q75RY2 Protein PAIR1 9.98e-03 9.91e-03 NA
2. P F4IMQ0 Protein FLC EXPRESSOR 3.29e-04 4.05e-02 NA
2. P Q05127 Polymerase cofactor VP35 NA 5.89e-09 NA
2. P Q8IWF9 Coiled-coil domain-containing protein 83 1.40e-03 1.75e-03 NA
2. P Q6UY68 Polymerase cofactor VP35 NA 5.23e-05 NA
2. P Q2TA00 Coiled-coil domain-containing protein 83 1.20e-03 2.89e-04 NA
2. P Q1PD52 Polymerase cofactor VP35 NA 1.53e-03 NA
2. P Q9H7L9 Sin3 histone deacetylase corepressor complex component SDS3 2.24e-03 5.02e-03 NA
2. P A0A1L8FZ84 Vexin 5.43e-02 5.45e-03 NA
2. P Q9FHY1 Protein ABIL4 4.04e-04 1.59e-02 NA
2. P Q9D083 Kinetochore protein Spc24 5.14e-05 3.45e-04 NA
2. P Q8IYA8 Interactor of HORMAD1 protein 1 4.75e-03 6.23e-07 NA
2. P D4A8G3 Leucine rich adaptor protein 1 2.13e-02 8.07e-03 NA
2. P Q14BK3 Testis-expressed protein 35 2.86e-02 6.01e-05 NA
2. P Q6R7B4 Uncharacterized protein ORF3 NA 2.33e-06 NA
2. P B3LW62 Kinetochore protein Spc25 2.41e-04 4.31e-04 NA
2. P Q07555 Uncharacterized protein YDL129W 2.08e-02 5.34e-03 NA
2. P Q96LX7 Coiled-coil domain-containing protein 17 3.71e-02 2.63e-02 NA
2. P H2KYP0 PAC-1 interacting and coiled-coil domain-containing protein 1 1.85e-03 2.03e-03 NA
2. P Q96KP6 TNFAIP3-interacting protein 3 1.07e-03 1.11e-03 NA
2. P Q5RBB8 Sin3 histone deacetylase corepressor complex component SDS3 5.15e-03 7.67e-03 NA
2. P O15079 Syntaphilin 9.78e-04 3.78e-02 NA
2. P Q8IYJ2 Uncharacterized protein C10orf67, mitochondrial 1.46e-03 3.67e-03 NA
2. P Q2YDE5 Putative coiled-coil domain-containing protein 196 6.76e-04 2.79e-04 NA
2. P Q5T0J7 Testis-expressed protein 35 1.07e-03 1.91e-09 NA
2. P Q07732 Accumulates dyads protein 3 7.54e-03 7.58e-04 NA
2. P Q2YDF2 Mediator of RNA polymerase II transcription subunit 30 4.09e-03 5.99e-03 NA
2. P P35259 Polymerase cofactor VP35 NA 4.65e-05 NA
2. P Q1PDC9 Polymerase cofactor VP35 NA 9.61e-06 NA
2. P P70213 Friend virus susceptibility protein 1 1.04e-02 2.91e-03 NA
2. P Q95K40 Coiled-coil domain-containing protein 83 1.44e-03 1.68e-04 NA
2. P Q8BMK5 Coiled-coil domain-containing protein 184 2.13e-03 3.26e-02 NA
2. P Q75MW2 Protein ZNF767 1.57e-04 7.29e-03 NA
2. P Q4V8F1 Coiled-coil domain-containing protein 184 4.03e-03 3.97e-02 NA
2. P Q0WWX5 Putative recombination initiation defects 3 1.25e-03 5.04e-10 NA
2. P Q6V1Q9 Polymerase cofactor VP35 NA 2.55e-07 NA