Summary

Q8TAD7

Homolog: P0C913.
Function: Overexpressed in colon carcinoma 1 protein homolog.

Statistics

Total GO Annotation: 31
Unique PROST Go: 31
Unique BLAST Go: 0

Total Homologs: 37
Unique PROST Homologs: 31
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was P0C913 (Overexpressed in colon carcinoma 1 protein homolog) with a FATCAT P-Value: 1.82e-10 and RMSD of 1.73 angstrom. The sequence alignment identity is 85.7%.
Structural alignment shown in left. Query protein Q8TAD7 colored as red in alignment, homolog P0C913 colored as blue. Query protein Q8TAD7 is also shown in right top, homolog P0C913 showed in right bottom. They are colored based on secondary structures. 

  Q8TAD7 MGCGNSTATSAGAGQGPAGAAKDVTEESVTEDDKRRNYGGVYVGLPSEAVNMVSSQTKTVRKN 63
  P0C913 MGCGNSTATSAAAGRGPTGAVKDTTEDSITEDDKRRNYGGVYVGLPSEAVNMASSQTKTVQKN 63

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0042600 egg chorion
2. P GO:0007202 activation of phospholipase C activity
2. P GO:0034237 protein kinase A regulatory subunit binding
2. P GO:0007267 cell-cell signaling
2. P GO:0044178 host cell Golgi membrane
2. P GO:0005886 plasma membrane
2. P GO:0071864 positive regulation of cell proliferation in bone marrow
2. P GO:0016020 membrane
2. P GO:0048873 homeostasis of number of cells within a tissue
2. P GO:0047485 protein N-terminus binding
2. P GO:0031857 type 1 parathyroid hormone receptor binding
2. P GO:0009653 anatomical structure morphogenesis
2. P GO:0055062 phosphate ion homeostasis
2. P GO:0006874 cellular calcium ion homeostasis
2. P GO:0009967 positive regulation of signal transduction
2. P GO:0060732 positive regulation of inositol phosphate biosynthetic process
2. P GO:0019033 viral tegument
2. P GO:0030501 positive regulation of bone mineralization
2. P GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
2. P GO:0010960 magnesium ion homeostasis
2. P GO:0071866 negative regulation of apoptotic process in bone marrow cell
2. P GO:0090290 positive regulation of osteoclast proliferation
2. P GO:0051428 peptide hormone receptor binding
2. P GO:0031856 parathyroid hormone receptor binding
2. P GO:0034645 cellular macromolecule biosynthetic process
2. P GO:0046760 viral budding from Golgi membrane
2. P GO:0046326 positive regulation of glucose import
2. P GO:0055036 virion membrane
2. P GO:0045725 positive regulation of glycogen biosynthetic process
2. P GO:0030317 flagellated sperm motility
2. P GO:0020002 host cell plasma membrane

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB P0C915 Overexpressed in colon carcinoma 1 protein homolog 2.11e-06 3.87e-22 6.04e-17
1. PB Q8TAD7 Overexpressed in colon carcinoma 1 protein 0 7.71e-147 7.55e-40
1. PB P0C913 Overexpressed in colon carcinoma 1 protein homolog 1.82e-10 1.97e-45 2.95e-34
1. PB B3DGJ2 Overexpressed in colon carcinoma 1 protein homolog 2.15e-02 4.34e-32 7.60e-16
1. PB P0C914 Overexpressed in colon carcinoma 1 protein homolog 3.67e-06 6.17e-92 8.50e-27
1. PB P0CD96 Overexpressed in colon carcinoma 1 protein homolog 3.98e-04 1.28e-48 1.36e-30
2. P Q9BSF0 Small membrane A-kinase anchor protein 1.37e-01 8.35e-08 NA
2. P P0DQF3 U-scoloptoxin(21)-Sm2a 1.39e-01 1.14e-03 NA
2. P Q27IM2 Parathyroid hormone 2.29e-01 2.20e-02 NA
2. P A0A023PZB3 Protein FMP49, mitochondrial 1.86e-01 2.83e-02 NA
2. P P24448 Cytoplasmic envelopment protein 3 NA 3.22e-05 NA
2. P F5HHY1 Cytoplasmic envelopment protein 3 NA 1.18e-03 NA
2. P P13294 Cytoplasmic envelopment protein 3 NA 1.24e-02 NA
2. P Q9H246 Uncharacterized protein C1orf21 2.10e-01 3.62e-02 NA
2. P Q9NNZ6 Protamine-3 2.97e-01 2.14e-02 NA
2. P P0C8Y6 Small membrane A-kinase anchor protein 1.80e-01 3.83e-02 NA
2. P Q77MS5 Cytoplasmic envelopment protein 3 NA 2.85e-02 NA
2. P Q9CPS8 Small membrane A-kinase anchor protein 1.27e-01 3.86e-06 NA
2. P P0C2W9 Protein AC4 NA 1.19e-02 NA
2. P Q3SZY8 Small membrane A-kinase anchor protein 1.31e-01 6.87e-04 NA
2. P A0A1B0GU33 Testis-expressed protein 53 4.20e-01 1.45e-02 NA
2. P P27271 Protein C4 NA 3.13e-02 NA
2. P P0C8S0 Small membrane A-kinase anchor protein 1.22e-01 1.48e-06 NA
2. P P29886 Protein F7 NA 5.72e-05 NA
2. P Q4RTJ5 Small membrane A-kinase anchor protein 3.09e-01 3.32e-06 NA
2. P Q8K207 Uncharacterized protein C1orf21 homolog 2.89e-01 1.19e-02 NA
2. P P52368 Cytoplasmic envelopment protein 3 NA 3.49e-02 NA
2. P Q66642 Cytoplasmic envelopment protein 3 NA 4.68e-03 NA
2. P P24511 Chorion protein S16 5.76e-01 5.63e-03 NA
2. P B8NI18 Imizoquin biosynthesis cluster protein A 4.43e-02 1.07e-02 NA
2. P P38612 Protein C4 NA 9.04e-03 NA
2. P P24359 Protein F7 NA 2.47e-04 NA
2. P Q23971 Antennal-specific protein OS-C 4.47e-01 1.20e-02 NA
2. P G2TRK9 Uncharacterized protein new13 2.15e-01 2.20e-04 NA
2. P P0C8Y7 Small membrane A-kinase anchor protein 2.37e-01 2.42e-04 NA
2. P Q67621 Protein C4 NA 5.01e-03 NA
2. P P52358 Cytoplasmic envelopment protein 3 NA 7.02e-04 NA