Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
P0C913
(Overexpressed in colon carcinoma 1 protein homolog) with a FATCAT P-Value: 1.82e-10 and RMSD of 1.73 angstrom. The sequence alignment identity is 85.7%.
Structural alignment shown in left. Query protein Q8TAD7 colored as red in alignment, homolog P0C913 colored as blue.
Query protein Q8TAD7 is also shown in right top, homolog P0C913 showed in right bottom. They are colored based on secondary structures.
Q8TAD7 MGCGNSTATSAGAGQGPAGAAKDVTEESVTEDDKRRNYGGVYVGLPSEAVNMVSSQTKTVRKN 63 P0C913 MGCGNSTATSAAAGRGPTGAVKDTTEDSITEDDKRRNYGGVYVGLPSEAVNMASSQTKTVQKN 63
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 2. P | GO:0042600 | egg chorion |
| 2. P | GO:0007202 | activation of phospholipase C activity |
| 2. P | GO:0034237 | protein kinase A regulatory subunit binding |
| 2. P | GO:0007267 | cell-cell signaling |
| 2. P | GO:0044178 | host cell Golgi membrane |
| 2. P | GO:0005886 | plasma membrane |
| 2. P | GO:0071864 | positive regulation of cell proliferation in bone marrow |
| 2. P | GO:0016020 | membrane |
| 2. P | GO:0048873 | homeostasis of number of cells within a tissue |
| 2. P | GO:0047485 | protein N-terminus binding |
| 2. P | GO:0031857 | type 1 parathyroid hormone receptor binding |
| 2. P | GO:0009653 | anatomical structure morphogenesis |
| 2. P | GO:0055062 | phosphate ion homeostasis |
| 2. P | GO:0006874 | cellular calcium ion homeostasis |
| 2. P | GO:0009967 | positive regulation of signal transduction |
| 2. P | GO:0060732 | positive regulation of inositol phosphate biosynthetic process |
| 2. P | GO:0019033 | viral tegument |
| 2. P | GO:0030501 | positive regulation of bone mineralization |
| 2. P | GO:0007189 | adenylate cyclase-activating G protein-coupled receptor signaling pathway |
| 2. P | GO:0010960 | magnesium ion homeostasis |
| 2. P | GO:0071866 | negative regulation of apoptotic process in bone marrow cell |
| 2. P | GO:0090290 | positive regulation of osteoclast proliferation |
| 2. P | GO:0051428 | peptide hormone receptor binding |
| 2. P | GO:0031856 | parathyroid hormone receptor binding |
| 2. P | GO:0034645 | cellular macromolecule biosynthetic process |
| 2. P | GO:0046760 | viral budding from Golgi membrane |
| 2. P | GO:0046326 | positive regulation of glucose import |
| 2. P | GO:0055036 | virion membrane |
| 2. P | GO:0045725 | positive regulation of glycogen biosynthetic process |
| 2. P | GO:0030317 | flagellated sperm motility |
| 2. P | GO:0020002 | host cell plasma membrane |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | P0C915 | Overexpressed in colon carcinoma 1 protein homolog | 2.11e-06 | 3.87e-22 | 6.04e-17 |
| 1. PB | Q8TAD7 | Overexpressed in colon carcinoma 1 protein | 0 | 7.71e-147 | 7.55e-40 |
| 1. PB | P0C913 | Overexpressed in colon carcinoma 1 protein homolog | 1.82e-10 | 1.97e-45 | 2.95e-34 |
| 1. PB | B3DGJ2 | Overexpressed in colon carcinoma 1 protein homolog | 2.15e-02 | 4.34e-32 | 7.60e-16 |
| 1. PB | P0C914 | Overexpressed in colon carcinoma 1 protein homolog | 3.67e-06 | 6.17e-92 | 8.50e-27 |
| 1. PB | P0CD96 | Overexpressed in colon carcinoma 1 protein homolog | 3.98e-04 | 1.28e-48 | 1.36e-30 |
| 2. P | Q9BSF0 | Small membrane A-kinase anchor protein | 1.37e-01 | 8.35e-08 | NA |
| 2. P | P0DQF3 | U-scoloptoxin(21)-Sm2a | 1.39e-01 | 1.14e-03 | NA |
| 2. P | Q27IM2 | Parathyroid hormone | 2.29e-01 | 2.20e-02 | NA |
| 2. P | A0A023PZB3 | Protein FMP49, mitochondrial | 1.86e-01 | 2.83e-02 | NA |
| 2. P | P24448 | Cytoplasmic envelopment protein 3 | NA | 3.22e-05 | NA |
| 2. P | F5HHY1 | Cytoplasmic envelopment protein 3 | NA | 1.18e-03 | NA |
| 2. P | P13294 | Cytoplasmic envelopment protein 3 | NA | 1.24e-02 | NA |
| 2. P | Q9H246 | Uncharacterized protein C1orf21 | 2.10e-01 | 3.62e-02 | NA |
| 2. P | Q9NNZ6 | Protamine-3 | 2.97e-01 | 2.14e-02 | NA |
| 2. P | P0C8Y6 | Small membrane A-kinase anchor protein | 1.80e-01 | 3.83e-02 | NA |
| 2. P | Q77MS5 | Cytoplasmic envelopment protein 3 | NA | 2.85e-02 | NA |
| 2. P | Q9CPS8 | Small membrane A-kinase anchor protein | 1.27e-01 | 3.86e-06 | NA |
| 2. P | P0C2W9 | Protein AC4 | NA | 1.19e-02 | NA |
| 2. P | Q3SZY8 | Small membrane A-kinase anchor protein | 1.31e-01 | 6.87e-04 | NA |
| 2. P | A0A1B0GU33 | Testis-expressed protein 53 | 4.20e-01 | 1.45e-02 | NA |
| 2. P | P27271 | Protein C4 | NA | 3.13e-02 | NA |
| 2. P | P0C8S0 | Small membrane A-kinase anchor protein | 1.22e-01 | 1.48e-06 | NA |
| 2. P | P29886 | Protein F7 | NA | 5.72e-05 | NA |
| 2. P | Q4RTJ5 | Small membrane A-kinase anchor protein | 3.09e-01 | 3.32e-06 | NA |
| 2. P | Q8K207 | Uncharacterized protein C1orf21 homolog | 2.89e-01 | 1.19e-02 | NA |
| 2. P | P52368 | Cytoplasmic envelopment protein 3 | NA | 3.49e-02 | NA |
| 2. P | Q66642 | Cytoplasmic envelopment protein 3 | NA | 4.68e-03 | NA |
| 2. P | P24511 | Chorion protein S16 | 5.76e-01 | 5.63e-03 | NA |
| 2. P | B8NI18 | Imizoquin biosynthesis cluster protein A | 4.43e-02 | 1.07e-02 | NA |
| 2. P | P38612 | Protein C4 | NA | 9.04e-03 | NA |
| 2. P | P24359 | Protein F7 | NA | 2.47e-04 | NA |
| 2. P | Q23971 | Antennal-specific protein OS-C | 4.47e-01 | 1.20e-02 | NA |
| 2. P | G2TRK9 | Uncharacterized protein new13 | 2.15e-01 | 2.20e-04 | NA |
| 2. P | P0C8Y7 | Small membrane A-kinase anchor protein | 2.37e-01 | 2.42e-04 | NA |
| 2. P | Q67621 | Protein C4 | NA | 5.01e-03 | NA |
| 2. P | P52358 | Cytoplasmic envelopment protein 3 | NA | 7.02e-04 | NA |