Summary

Q8TAY7

Homolog: Q80X91.
Function: Protein FAM110D.

Statistics

Total GO Annotation: 44
Unique PROST Go: 34
Unique BLAST Go: 0

Total Homologs: 32
Unique PROST Homologs: 17
Unique BLAST Homologs: 1

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q80X91 (Protein FAM110D) with a FATCAT P-Value: 1.33e-06 and RMSD of 3.84 angstrom. The sequence alignment identity is 87.1%.
Structural alignment shown in left. Query protein Q8TAY7 colored as red in alignment, homolog Q80X91 colored as blue. Query protein Q8TAY7 is also shown in right top, homolog Q80X91 showed in right bottom. They are colored based on secondary structures. 

  Q8TAY7 MLLAPPSTPSRGRTPSAVERLEADKAKYVKTHQVIARRQEPALRGSPGPLTPHPCNELGPPASPRTPRPVRRGSGRRLPRPDSLIFYRQKRDCKASVNKE 100
  Q80X91 MLLSSPTTPSRGRTPSAVERLEADKAKYVKTHQVIVRRQEPALRGGPGPLTPHPCNELGASASPRTPGPARRGSGRRQPRPDSLIFYRQKRDCKASVNKE 100

  Q8TAY7 NAKGQGLVRRLFLGAPRDAAPSSPASTERPAASGGWA-APQDAPEAAGKRALCPTCSLPLSEKERFFNYCGLERALVEVLGAERFSPQSWGADASPQAGT 199
  Q80X91 NAKGQGLVRRLFLGATRDAAPSSPAPTERPGAPAGWAGSP-DTPEATGKRAVCPTCSLPLSEKERFFNYCGLERALVEVLGAERFSPQSWGAEHGPQVAT 199

  Q8TAY7 SPPPGSGDASDWTSSDRGVDSPGGAGGGGGSEAAGSARDRRPPVSVVERNARVIQWLYGCQRARGPPRESEV 271
  Q80X91 SPPPGSGDTSDWTSSDRDAGSPDCAGGGGGSEAAGSARDGRPTVSVVERNARVIQWLYGCQRARAPPRESEV 271

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0043014 alpha-tubulin binding
1. PB GO:0005815 microtubule organizing center
1. PB GO:0000922 spindle pole
1. PB GO:0005739 mitochondrion
1. PB GO:0005829 cytosol
1. PB GO:0030335 positive regulation of cell migration
1. PB GO:0005874 microtubule
1. PB GO:0005938 cell cortex
1. PB GO:0051897 positive regulation of protein kinase B signaling
1. PB GO:0060491 regulation of cell projection assembly
2. P GO:0005778 peroxisomal membrane
2. P GO:0000775 chromosome, centromeric region
2. P GO:0007080 mitotic metaphase plate congression
2. P GO:0071922 regulation of cohesin loading
2. P GO:0030430 host cell cytoplasm
2. P GO:0006368 transcription elongation from RNA polymerase II promoter
2. P GO:0010847 regulation of chromatin assembly
2. P GO:0000166 nucleotide binding
2. P GO:0007254 JNK cascade
2. P GO:0019079 viral genome replication
2. P GO:0007076 mitotic chromosome condensation
2. P GO:0070301 cellular response to hydrogen peroxide
2. P GO:0000278 mitotic cell cycle
2. P GO:0043486 histone exchange
2. P GO:0031175 neuron projection development
2. P GO:0006302 double-strand break repair
2. P GO:0010311 lateral root formation
2. P GO:0031274 positive regulation of pseudopodium assembly
2. P GO:0048367 shoot system development
2. P GO:0044877 protein-containing complex binding
2. P GO:0004861 cyclin-dependent protein serine/threonine kinase inhibitor activity
2. P GO:0043631 RNA polyadenylation
2. P GO:0005634 nucleus
2. P GO:0007064 mitotic sister chromatid cohesion
2. P GO:0031536 positive regulation of exit from mitosis
2. P GO:0048527 lateral root development
2. P GO:0045736 negative regulation of cyclin-dependent protein serine/threonine kinase activity
2. P GO:0000217 DNA secondary structure binding
2. P GO:0030838 positive regulation of actin filament polymerization
2. P GO:0048366 leaf development
2. P GO:0016558 protein import into peroxisome matrix
2. P GO:0007266 Rho protein signal transduction
2. P GO:0000785 chromatin
2. P GO:0045740 positive regulation of DNA replication

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q1W6H9 Protein FAM110C 1.33e-02 2.17e-22 5.57e-12
1. PB Q58DG5 Protein FAM110A 1.74e-02 6.25e-23 4.95e-16
1. PB Q8TC76 Protein FAM110B 4.66e-02 1.68e-13 1.68e-08
1. PB Q2KJ38 Protein FAM110B 4.87e-02 1.12e-14 3.18e-08
1. PB Q80X91 Protein FAM110D 1.33e-06 5.28e-104 1.66e-154
1. PB Q9BQ89 Protein FAM110A 4.50e-02 4.09e-23 3.66e-17
1. PB Q8TAY7 Protein FAM110D 0 3.88e-162 0.0
1. PB Q5RKJ0 Protein FAM110C 7.24e-02 1.07e-18 2.27e-07
1. PB A6H7I7 Protein FAM110D 3.50e-06 5.04e-109 4.87e-152
1. PB Q5BJX5 Protein FAM110B 8.45e-03 7.61e-15 1.75e-08
1. PB Q5R5R3 Protein FAM110B 2.55e-02 1.05e-14 1.63e-08
1. PB Q8R184 Protein FAM110A 8.37e-03 1.25e-20 2.82e-16
1. PB Q4QRD7 Protein FAM110B 9.44e-02 9.43e-13 5.38e-07
1. PB Q8C739 Protein FAM110B 9.19e-03 4.98e-15 1.64e-08
2. P Q7XPT0 Putative protein Brevis radix-like 3 2.33e-01 2.14e-04 NA
2. P B2BRG5 Non-structural protein 5 NA 2.51e-02 NA
2. P Q9D722 Oxidative stress-responsive serine-rich protein 1 3.89e-01 4.13e-03 NA
2. P Q5RD08 Oxidative stress-responsive serine-rich protein 1 2.29e-01 1.35e-02 NA
2. P Q9E8F2 Non-structural protein 5 NA 1.51e-02 NA
2. P Q993T4 Non-structural protein 5 NA 2.09e-02 NA
2. P Q6NZY7 Cdc42 effector protein 5 2.66e-01 3.25e-02 NA
2. P Q9CPY3 Sororin 1.33e-01 8.00e-03 NA
2. P Q703I1 Oxidative stress-responsive serine-rich protein 1 6.76e-01 1.07e-02 NA
2. P P0DOD1 Protein E8^E2C NA 1.62e-02 NA
2. P Q67Y93 Cyclin-dependent kinase inhibitor 1 2.96e-01 1.42e-02 NA
2. P Q9NX31 Oxidative stress-responsive serine-rich protein 1 4.73e-01 5.67e-03 NA
2. P Q96FF9 Sororin 1.29e-01 5.97e-03 NA
2. P Q9PWA3 GRIN2-like protein 4.47e-01 4.82e-02 NA
2. P O60269 G protein-regulated inducer of neurite outgrowth 2 5.57e-01 3.34e-04 NA
2. P P38855 Peroxisomal membrane protein PEX18 4.31e-01 1.39e-02 NA
2. P P06843 Protein SPT2 1.23e-01 2.45e-03 NA
3. B Q8VE94 Protein FAM110C 2.25e-01 NA 2.55e-08