Summary

Q8TD35

Homolog: Q8BIG2.
Function: Protein LKAAEAR1.

Statistics

Total GO Annotation: 9
Unique PROST Go: 9
Unique BLAST Go: 0

Total Homologs: 16
Unique PROST Homologs: 14
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q8BIG2 (Protein LKAAEAR1) with a FATCAT P-Value: 2.04e-07 and RMSD of 3.25 angstrom. The sequence alignment identity is 66.7%.
Structural alignment shown in left. Query protein Q8TD35 colored as red in alignment, homolog Q8BIG2 colored as blue. Query protein Q8TD35 is also shown in right top, homolog Q8BIG2 showed in right bottom. They are colored based on secondary structures. 

  Q8TD35 MPPPAKEGGRKGPRER-----SGKSA---PGTAQGEERAKGAP-ATEPPKPGWALTPQGLAAMLPAQRHRHLLFGDLLEDVGAAASTFPCGSVE-PGYRM 90
  Q8BIG2 MPTL----GVKGARERDKNSASGAGAGAGAGAGAGEKHRKG-PRTTDPPKTGWALTKQRLVALSPTLRQRHLLFGDFLDDIGKVASMFPRESVELP-YDM 94

  Q8TD35 PDPRPWTQSLELPAERQNRLLGVLKAAEARGRVRALRLRYTRMRAEEIALLIQRQKSARAAIRLELFLPPQLKPARIPDPLDRQERRRVETILEENVDGT 190
  Q8BIG2 PDPRTWSQALNLPSEHQNRFLGLIKAAEARGRVHTLRLRYTRMRAEEISLLIQKQSSARAAIRLELFLPPQLKPTKIPDPLDRHERRRVETILEEEVDGN 194

  Q8TD35 IFPR 194
  Q8BIG2 IFPR 198

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0039502 suppression by virus of host type I interferon-mediated signaling pathway
2. P GO:0016592 mediator complex
2. P GO:0039563 suppression by virus of host JAK-STAT cascade via inhibition of STAT1 activity
2. P GO:0039564 suppression by virus of host JAK-STAT cascade via inhibition of STAT2 activity
2. P GO:0050215 propanediol dehydratase activity
2. P GO:0003712 transcription coregulator activity
2. P GO:0031419 cobalamin binding
2. P GO:0000785 chromatin
2. P GO:0051144 propanediol catabolic process

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q8TD35 Protein LKAAEAR1 0 2.98e-141 1.72e-135
1. PB Q8BIG2 Protein LKAAEAR1 2.04e-07 6.62e-14 8.11e-82
2. P P06165 Protein C NA 1.48e-02 NA
2. P Q05103 Uncharacterized 15.5 kDa protein NA 3.18e-02 NA
2. P P32534 Protein C NA 4.46e-02 NA
2. P P28055 Protein C NA 4.21e-02 NA
2. P O64201 Gene 5 protein NA 3.14e-04 NA
2. P Q914L9 Uncharacterized protein 11 NA 3.01e-02 NA
2. P O67369 Uncharacterized protein aq_1356 2.81e-01 1.29e-02 NA
2. P P52534 Protein U84 NA 1.07e-04 NA
2. P P06164 Protein C NA 3.89e-04 NA
2. P Q05267 Gene 5 protein NA 9.42e-05 NA
2. P O31042 Propanediol dehydratase small subunit 1.14e-01 1.25e-04 NA
2. P Q96EN9 Required for excision 1-B domain-containing protein 8.07e-02 8.57e-03 NA
2. P P32533 Protein C NA 2.82e-02 NA
2. P Q4PDA7 Mediator of RNA polymerase II transcription subunit 10 3.92e-02 2.49e-02 NA