Summary

Q8TEV8

Homolog: Q9BE57.
Function: Smith-Magenis syndrome chromosomal region candidate gene 5 protein homolog.

Statistics

Total GO Annotation: 6
Unique PROST Go: 6
Unique BLAST Go: 0

Total Homologs: 25
Unique PROST Homologs: 23
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q9BE57 (Smith-Magenis syndrome chromosomal region candidate gene 5 protein homolog) with a FATCAT P-Value: 0.00701 and RMSD of 3.09 angstrom. The sequence alignment identity is 86.8%.
Structural alignment shown in left. Query protein Q8TEV8 colored as red in alignment, homolog Q9BE57 colored as blue. Query protein Q8TEV8 is also shown in right top, homolog Q9BE57 showed in right bottom. They are colored based on secondary structures. 

  Q8TEV8 MRRCLRVKTRRGQLGLASSCFEQHSCFSPRVNRILSAVQNTLCTGPSSQAPPQPPQASPPAAADHSRTPSLLASSHSASGGESLFQLYIASLAWPQNCCV 100
  Q9BE57 MRRCLRVKTRRGQLGLASGCFEQHSCFSPRVNRILSAVQNTPCAGPSSQAPPQPPQASPPAAPDHSRTPSLLASSHSASGGESLFQLYMASLAWPQNCCV 100

  Q8TEV8 LESCRRIPLGGLSSMENRRPLLRKGRLLRGQIHHSQTNEL------------ 140
  Q9BE57 LESCRRIPLGGLSSMENRRPLLRKGRLLRGQIHHGQDNQLWGLTGAGALLSG 152

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0007266 Rho protein signal transduction
2. P GO:0031267 small GTPase binding
2. P GO:0030838 positive regulation of actin filament polymerization
2. P GO:0012505 endomembrane system
2. P GO:0031274 positive regulation of pseudopodium assembly
2. P GO:0007254 JNK cascade

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q8TEV8 Smith-Magenis syndrome chromosomal region candidate gene 5 protein 0 5.69e-147 7.78e-98
1. PB Q9BE57 Smith-Magenis syndrome chromosomal region candidate gene 5 protein homolog 7.01e-03 1.17e-46 1.34e-69
2. P Q6XXX2 Putative uncharacterized protein encoded by LINC00114 2.60e-01 1.22e-02 NA
2. P Q8TGM9 Putative uncharacterized protein YKR075W-A 1.19e-01 1.09e-02 NA
2. P P53087 Putative uncharacterized protein YGL214W 2.51e-01 1.61e-03 NA
2. P Q2M3A8 Putative uncharacterized protein MRGPRG-AS1 1.11e-01 2.43e-02 NA
2. P Q8N9T2 Putative uncharacterized protein CXorf42 2.85e-01 2.80e-05 NA
2. P P59023 Down syndrome critical region protein 10 5.81e-01 1.26e-04 NA
2. P Q8N2B8 Putative uncharacterized protein FLJ33534 4.38e-01 1.59e-04 NA
2. P Q5TC04 Putative uncharacterized protein ATP1A1-AS1 2.12e-01 7.70e-05 NA
2. P Q9JMS2 Uncharacterized protein YuaS 2.97e-01 1.73e-02 NA
2. P P16825 Uncharacterized protein UL81 NA 3.74e-02 NA
2. P O13913 Uncharacterized protein C23C11.07 3.10e-01 7.33e-04 NA
2. P Q54KS5 Putative uncharacterized protein DDB_G0287145 3.80e-01 1.82e-02 NA
2. P Q6ZTC4 Putative uncharacterized protein FLJ44790 1.99e-01 2.68e-06 NA
2. P Q8N9X3 Putative uncharacterized protein encoded by LINC01356 4.38e-01 6.73e-04 NA
2. P A0A023PXE5 Putative uncharacterized protein YHL006W-A 9.20e-01 2.88e-03 NA
2. P Q6NZY7 Cdc42 effector protein 5 1.54e-01 2.95e-02 NA
2. P A0A023PYG5 Putative uncharacterized protein YHL046W-A 5.10e-01 3.09e-02 NA
2. P O29555 Uncharacterized protein AF_0703 4.95e-01 1.68e-04 NA
2. P Q6ZR54 Putative uncharacterized protein FLJ46641 1.19e-01 1.94e-03 NA
2. P Q3E751 Uncharacterized protein YPL119C-A 4.65e-01 1.05e-03 NA
2. P O13565 Uncharacterized protein YLR358C 6.25e-01 5.40e-03 NA
2. P A0A1B0GUV1 Uncharacterized protein C17orf114 1.33e-01 1.81e-07 NA
2. P O13570 Putative uncharacterized protein YPR142C 7.50e-01 4.87e-02 NA