Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
Q8WTP9
(X antigen family member 3) with a FATCAT P-Value: 1.8e-05 and RMSD of 2.70 angstrom. The sequence alignment identity is 73.0%.
Structural alignment shown in left. Query protein Q8WWM1 colored as red in alignment, homolog Q8WTP9 colored as blue.
Query protein Q8WWM1 is also shown in right top, homolog Q8WTP9 showed in right bottom. They are colored based on secondary structures.
Q8WWM1 MSWRGRR-Y--RPRRCLRLAQLVGPMLEPSVPEPQQEEPPTESQDHTPGQKREDDQGAAEIQVPNLEADLQELSQSKTGDECGDSPDVQGKILPKSEQFK 97 Q8WTP9 MIWRGRSTYRPRPRRSVPPPELIGPMLEPGDEEPQQEEPPTESRDPAPGQEREEDQGAAETQVPDLEADLQELSQSKTGGECGNGPDDQGKILPKSEQFK 100 Q8WWM1 MPEGGEGKPQL 108 Q8WTP9 MPEGGDRQPQV 111
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0003713 | transcription coactivator activity |
| 1. PB | GO:1903202 | negative regulation of oxidative stress-induced cell death |
| 1. PB | GO:0042594 | response to starvation |
| 1. PB | GO:0032872 | regulation of stress-activated MAPK cascade |
| 1. PB | GO:1903427 | negative regulation of reactive oxygen species biosynthetic process |
| 2. P | GO:0048096 | |
| 2. P | GO:0070979 | protein K11-linked ubiquitination |
| 2. P | GO:0045944 | positive regulation of transcription by RNA polymerase II |
| 2. P | GO:0045893 | positive regulation of transcription, DNA-templated |
| 2. P | GO:0000079 | regulation of cyclin-dependent protein serine/threonine kinase activity |
| 2. P | GO:0005634 | nucleus |
| 2. P | GO:0005680 | anaphase-promoting complex |
| 2. P | GO:0030071 | regulation of mitotic metaphase/anaphase transition |
| 2. P | GO:0006355 | regulation of transcription, DNA-templated |
| 2. P | GO:0031145 | anaphase-promoting complex-dependent catabolic process |
| 2. P | GO:0030308 | negative regulation of cell growth |
| 3. B | GO:0006979 | response to oxidative stress |
| 3. B | GO:0043066 | negative regulation of apoptotic process |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q8WWM1 | X antigen family member 5 | 0 | 1.84e-166 | 1.26e-73 |
| 1. PB | Q5JRK9 | Putative G antigen family E member 3 | 2.25e-02 | 8.94e-04 | 6.29e-09 |
| 1. PB | A6NGK3 | G antigen 10 | 1.84e-03 | 1.93e-11 | 1.17e-16 |
| 1. PB | A6NDE8 | G antigen 12H | 6.46e-03 | 4.75e-10 | 6.58e-14 |
| 1. PB | P0CL82 | G antigen 12I | 2.76e-03 | 6.96e-10 | 3.95e-13 |
| 1. PB | Q13069 | G antigen 5 | 3.41e-03 | 3.65e-10 | 5.54e-14 |
| 1. PB | Q96GT9 | X antigen family member 2 | 9.22e-04 | 1.27e-14 | 3.09e-44 |
| 1. PB | Q4V326 | G antigen 2E | 4.16e-03 | 3.37e-06 | 3.65e-12 |
| 1. PB | Q8WTP9 | X antigen family member 3 | 1.80e-05 | 3.20e-34 | 3.16e-43 |
| 1. PB | Q13070 | G antigen 6 | 6.70e-03 | 2.15e-11 | 6.37e-14 |
| 1. PB | P0CL80 | G antigen 12F | 1.57e-03 | 6.96e-10 | 3.95e-13 |
| 1. PB | O76087 | G antigen 7 | 2.87e-03 | 6.96e-10 | 3.95e-13 |
| 1. PB | A6NER3 | G antigen 12J | 2.43e-03 | 1.22e-07 | 2.55e-12 |
| 1. PB | P0DSO3 | G antigen 4 | 5.47e-03 | 1.05e-09 | 4.37e-14 |
| 1. PB | Q6NT46 | G antigen 2A | 4.46e-03 | 4.65e-09 | 2.79e-13 |
| 1. PB | P0DTW1 | G antigen 1 | 6.83e-03 | 8.58e-11 | 3.40e-15 |
| 1. PB | Q4V321 | G antigen 13 | 2.03e-03 | 9.45e-10 | 6.58e-14 |
| 1. PB | P0CL81 | G antigen 12G | 1.53e-02 | 6.96e-10 | 3.95e-13 |
| 1. PB | Q9UEU5 | G antigen 2D | 1.22e-02 | 3.08e-09 | 9.48e-15 |
| 1. PB | A1L429 | G antigen 12B/C/D/E | 2.81e-03 | 5.88e-11 | 2.83e-13 |
| 1. PB | O60829 | P antigen family member 4 | 1.60e-02 | 7.38e-12 | 4.76e-09 |
| 1. PB | Q13066 | G antigen 2B/2C | 2.97e-03 | 2.14e-10 | 8.51e-14 |
| 2. P | Q9JL10 | SERTA domain-containing protein 1 | 2.43e-01 | 1.04e-02 | NA |
| 2. P | Q9UJW9 | SERTA domain-containing protein 3 | 1.98e-01 | 1.42e-02 | NA |
| 2. P | Q01030 | Uncharacterized gene 45 protein | NA | 1.07e-02 | NA |
| 2. P | Q9UHV2 | SERTA domain-containing protein 1 | 2.66e-01 | 2.26e-04 | NA |
| 2. P | Q9ERC3 | SERTA domain-containing protein 3 | 2.32e-01 | 3.33e-04 | NA |
| 2. P | A0A1B0GUA9 | Uncharacterized protein C13orf46 | 1.62e-01 | 6.41e-03 | NA |
| 2. P | Q5RAQ7 | Anaphase-promoting complex subunit CDC26 | 5.51e-01 | 3.06e-02 | NA |
| 3. B | O75459 | P antigen family member 1 | 1.59e-02 | NA | 6.92e-10 |
| 3. B | Q7Z2X7 | P antigen family member 2 | 3.64e-02 | NA | 6.76e-08 |
| 3. B | Q5JUK9 | P antigen family member 3 | 7.82e-03 | NA | 3.04e-21 |
| 3. B | Q96GU1 | P antigen family member 5 | 1.19e-01 | NA | 7.94e-07 |