Summary

Q96BQ5

Homolog: Q6PEB9.
Function: Coiled-coil domain-containing protein 127.

Statistics

Total GO Annotation: 26
Unique PROST Go: 26
Unique BLAST Go: 0

Total Homologs: 121
Unique PROST Homologs: 117
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q6PEB9 (Coiled-coil domain-containing protein 127) with a FATCAT P-Value: 0.0 and RMSD of 2.97 angstrom. The sequence alignment identity is 80.8%.
Structural alignment shown in left. Query protein Q96BQ5 colored as red in alignment, homolog Q6PEB9 colored as blue. Query protein Q96BQ5 is also shown in right top, homolog Q6PEB9 showed in right bottom. They are colored based on secondary structures. 

  Q96BQ5 MNNLNDPPNWNIRPNSRADGGDGSRWNYALLVPMLGLAAFRWIWSRESQKEVEKEREAYRRRTAAFQQDLEAKYHAMISENRRAVAQLSLELEKEQNRTA 100
  Q6PEB9 MNNLNDPPNWNIQPNPRADGGDGSKWNYALLVPMLGLAAFRWIWSRESQKEIEKARRAYHQQTAAFQQDLDAKYHAVISEHRRAVAQLSLELEKEQNRTT 100

  Q96BQ5 SYREALISQGRKLVEEKKLLEQERAQVMQEKRQVQPLRSAYLSCLQREENWQRRARLLLKEF-EAVLTERQNIYCSLFLPRSKRLEIEKSLLVRASVDPV 199
  Q6PEB9 SFREALISQGRKLAEEKKLLEQERAQIIQEKSQRQPLRRAYLSCLEEEDEWQRRAQLVLKEVGEA-LEERQNIYCSLILPRSARQQLEKSLLVRTSADPV 199

  Q96BQ5 AADLEMAAGLTDIFQHDTYCGDVWNTNKRQNGRLMWLYLKYWELVVELKKFKRVEEAILEK 260
  Q6PEB9 AADLEMATGLSDIFKHDKHCGDVWNTNKRQNGKLMWMYLKYWELLVELKKFKKIEKVILGK 260

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0061617 MICOS complex
2. P GO:0046933 proton-transporting ATP synthase activity, rotational mechanism
2. P GO:1990429 peroxisomal importomer complex
2. P GO:0110146 magnetosome membrane
2. P GO:0044659 viral release from host cell by cytolysis
2. P GO:0019076 viral release from host cell
2. P GO:0016560 protein import into peroxisome matrix, docking
2. P GO:0000779 condensed chromosome, centromeric region
2. P GO:0033644 host cell membrane
2. P GO:1990415
2. P GO:0031511 Mis6-Sim4 complex
2. P GO:0045263 proton-transporting ATP synthase complex, coupling factor F(o)
2. P GO:0140275 MIB complex
2. P GO:0008053 mitochondrial fusion
2. P GO:0051382 kinetochore assembly
2. P GO:0007007 inner mitochondrial membrane organization
2. P GO:0090680 disruption by virus of host outer membrane
2. P GO:0000939 inner kinetochore
2. P GO:0019835 cytolysis
2. P GO:0042407 cristae formation
2. P GO:0016021 integral component of membrane
2. P GO:0009535 chloroplast thylakoid membrane
2. P GO:0009536 plastid
2. P GO:0140221 pathogen-containing vacuole membrane
2. P GO:0020002 host cell plasma membrane
2. P GO:0001401 SAM complex

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB P0C267 Coiled-coil domain-containing protein 127 0.00e+00 2.76e-63 1.61e-164
1. PB Q3TC33 Coiled-coil domain-containing protein 127 0.00e+00 1.91e-54 2.44e-163
1. PB Q96BQ5 Coiled-coil domain-containing protein 127 0 6.11e-132 0.0
1. PB Q6PEB9 Coiled-coil domain-containing protein 127 0.00e+00 1.74e-49 5.48e-158
2. P Q09X31 ATP synthase subunit b, chloroplastic 9.13e-07 3.92e-03 NA
2. P A0ZZ21 ATP synthase subunit b, chloroplastic 5.97e-07 1.10e-02 NA
2. P P10305 Spanin, inner membrane subunit NA 3.79e-05 NA
2. P A5FVI7 ATP synthase subunit b 1 4.50e-08 1.30e-02 NA
2. P A8KB59 Coiled-coil domain-containing protein 153 9.46e-09 1.98e-02 NA
2. P Q0RDB0 ATP synthase subunit b 3.32e-07 3.05e-02 NA
2. P Q09FX5 ATP synthase subunit b, chloroplastic 3.35e-07 9.33e-03 NA
2. P A4QJI5 ATP synthase subunit b, chloroplastic 1.63e-07 1.65e-02 NA
2. P P03803 Spanin, inner membrane subunit NA 6.58e-05 NA
2. P B2XWN5 ATP synthase subunit b, chloroplastic 4.21e-08 1.13e-02 NA
2. P O62939 ATP synthase subunit b, chloroplastic 1.81e-08 2.53e-03 NA
2. P Q2MIB4 ATP synthase subunit b, chloroplastic 1.27e-07 3.32e-03 NA
2. P Q3BAQ6 ATP synthase subunit b, chloroplastic 1.58e-07 2.25e-02 NA
2. P Q4A8W3 ATP synthase subunit b 5.78e-09 1.98e-02 NA
2. P Q601Z9 ATP synthase subunit b 8.81e-08 2.99e-02 NA
2. P P27358 Spanin, inner membrane subunit NA 6.45e-03 NA
2. P Q2YMC4 ATP synthase subunit b 2 2.69e-07 4.57e-02 NA
2. P Q1KXW6 ATP synthase subunit b, chloroplastic 2.82e-06 1.01e-03 NA
2. P Q5EAJ6 Inhibitor of nuclear factor kappa-B kinase-interacting protein 9.78e-05 1.52e-02 NA
2. P B1A921 ATP synthase subunit b, chloroplastic 7.21e-07 3.59e-03 NA
2. P P0C2Z0 ATP synthase subunit b, chloroplastic 1.30e-08 3.96e-03 NA
2. P A1E9S0 ATP synthase subunit b, chloroplastic 1.67e-08 5.61e-04 NA
2. P A4QK04 ATP synthase subunit b, chloroplastic 7.48e-07 2.40e-02 NA
2. P Q2L8Z3 ATP synthase subunit b, chloroplastic 5.54e-07 1.10e-02 NA
2. P P38477 ATP synthase protein MI25 1.14e-07 1.88e-05 NA
2. P Q06GS4 ATP synthase subunit b, chloroplastic 7.16e-09 3.79e-02 NA
2. P Q06J69 ATP synthase subunit b, chloroplastic 6.52e-08 1.16e-04 NA
2. P Q27S64 ATP synthase subunit b, chloroplastic 1.50e-07 3.32e-03 NA
2. P P30393 ATP synthase subunit b, chloroplastic 8.57e-08 4.70e-02 NA
2. P P0C2Y9 ATP synthase subunit b, chloroplastic 1.49e-08 3.96e-03 NA
2. P O64363 Protein gp55 NA 5.28e-07 NA
2. P Q6ENW7 ATP synthase subunit b, chloroplastic 2.48e-08 5.11e-04 NA
2. P Q2PMS9 ATP synthase subunit b, chloroplastic 1.31e-08 3.85e-02 NA
2. P Q12234 GRIP domain-containing protein RUD3 6.13e-06 2.66e-02 NA
2. P B3TN47 ATP synthase subunit b, chloroplastic 2.16e-08 9.87e-03 NA
2. P B4YNF1 Uncharacterized protein V11 NA 4.98e-03 NA
2. P P00726 Spanin, inner membrane subunit NA 2.17e-02 NA
2. P Q6ENH8 ATP synthase subunit b, chloroplastic 1.25e-08 3.96e-03 NA
2. P Q3C1H3 ATP synthase subunit b, chloroplastic 1.37e-07 3.63e-03 NA
2. P A1EA04 ATP synthase subunit b, chloroplastic 3.30e-09 2.84e-03 NA
2. P P0C156 ATP synthase subunit b, chloroplastic 3.22e-08 5.11e-04 NA
2. P Q5UQW6 Uncharacterized protein R387 NA 3.65e-04 NA
2. P P75719 Prophage Rz endopeptidase RzpD 7.96e-09 2.66e-03 NA
2. P Q8BMK4 Cytoskeleton-associated protein 4 3.27e-06 4.78e-02 NA
2. P A8SE63 ATP synthase subunit b, chloroplastic 7.82e-07 5.33e-03 NA
2. P A4QJA1 ATP synthase subunit b, chloroplastic 6.58e-08 1.65e-02 NA
2. P P0CI27 Inclusion membrane protein A 1.56e-05 2.23e-03 NA
2. P B2XT88 ATP synthase subunit b, chloroplastic 1.90e-08 1.07e-02 NA
2. P P76158 Uncharacterized protein RzpQ 1.29e-08 3.33e-09 NA
2. P Q2MIK1 ATP synthase subunit b, chloroplastic 1.19e-07 3.32e-03 NA
2. P Q2J6M9 ATP synthase subunit b 5.01e-07 9.16e-03 NA
2. P B0CK73 ATP synthase subunit b 2 2.69e-07 3.28e-02 NA
2. P A0A321 ATP synthase subunit b, chloroplastic 5.71e-07 4.57e-03 NA
2. P P13583 Spanin, inner membrane subunit NA 3.55e-02 NA
2. P P56759 ATP synthase subunit b, chloroplastic 1.43e-07 7.80e-03 NA
2. P A1E9I7 ATP synthase subunit b, chloroplastic 2.84e-08 8.57e-03 NA
2. P Q56P07 ATP synthase subunit b, chloroplastic 1.13e-06 3.66e-03 NA
2. P P0C7Q1 Coiled-coil domain-containing protein 153 1.26e-08 2.71e-02 NA
2. P B2XTP4 ATP synthase subunit b, chloroplastic 1.43e-08 1.07e-02 NA
2. P Q8S8Y2 ATP synthase subunit b, chloroplastic 6.50e-07 3.16e-02 NA
2. P A7Y3A6 ATP synthase subunit b, chloroplastic 7.82e-08 1.49e-03 NA
2. P P48186 ATP synthase subunit b, chloroplastic 2.17e-08 1.94e-03 NA
2. P Q4AAW1 ATP synthase subunit b 3.17e-07 4.65e-02 NA
2. P A4QLI0 ATP synthase subunit b, chloroplastic 6.58e-07 1.65e-02 NA
2. P A0A0H3MD02 Inclusion membrane protein A 3.78e-06 9.48e-04 NA
2. P A4QKH8 ATP synthase subunit b, chloroplastic 2.01e-07 2.78e-02 NA
2. P Q0G9X6 ATP synthase subunit b, chloroplastic 1.89e-07 2.02e-03 NA
2. P A4QK91 ATP synthase subunit b, chloroplastic 3.22e-07 8.57e-03 NA
2. P Q6KI77 ATP synthase subunit b 2.87e-08 3.19e-02 NA
2. P A4GGB1 ATP synthase subunit b, chloroplastic 5.48e-07 4.74e-02 NA
2. P A4QKR7 ATP synthase subunit b, chloroplastic 9.60e-08 4.95e-02 NA
2. P O34460 Sporulation membrane protein YtrI 4.50e-04 3.16e-02 NA
2. P Q7YJY3 ATP synthase subunit b, chloroplastic 8.19e-07 1.83e-02 NA
2. P Q33C52 ATP synthase subunit b, chloroplastic 6.25e-07 1.22e-03 NA
2. P Q6EW62 ATP synthase subunit b, chloroplastic 2.64e-08 2.29e-03 NA
2. P A6WW80 ATP synthase subunit b 2 3.74e-07 3.92e-02 NA
2. P Q9XJJ6 Spanin, inner membrane subunit NA 1.61e-03 NA
2. P Q4VZP7 ATP synthase subunit b, chloroplastic 1.88e-07 1.79e-03 NA
2. P A7HQY4 ATP synthase subunit b 1 4.54e-07 4.87e-02 NA
2. P A8W3B0 ATP synthase subunit b, chloroplastic 5.26e-08 8.41e-03 NA
2. P Q06H11 ATP synthase subunit b, chloroplastic 1.37e-07 4.30e-04 NA
2. P B5LMN0 ATP synthase subunit b, chloroplastic 3.98e-07 2.94e-02 NA
2. P A6H5F2 ATP synthase subunit b, chloroplastic 1.60e-08 7.99e-04 NA
2. P B2S9N1 ATP synthase subunit b 2 3.06e-07 4.57e-02 NA
2. P Q0P3K6 ATP synthase subunit b, chloroplastic 4.66e-07 3.55e-02 NA
2. P Q85WS7 ATP synthase subunit b, chloroplastic 8.52e-11 6.27e-03 NA
2. P A4QL92 ATP synthase subunit b, chloroplastic 1.51e-06 6.02e-04 NA
2. P A4QLR9 ATP synthase subunit b, chloroplastic 1.90e-07 1.52e-02 NA
2. P B2LMI6 ATP synthase subunit b, chloroplastic 4.42e-06 1.40e-02 NA
2. P P0C2Y8 ATP synthase subunit b, chloroplastic 2.05e-08 3.96e-03 NA
2. P P44773 Uncharacterized protein HI_0603 2.14e-07 1.67e-03 NA
2. P P40155 Peroxisomal membrane protein PEX17 9.10e-06 8.73e-03 NA
2. P Q06RE5 ATP synthase subunit b, chloroplastic 3.43e-06 4.23e-03 NA
2. P P0DPS5 Inclusion membrane protein A 2.59e-06 3.26e-04 NA
2. P P08214 ATP synthase subunit b, chloroplastic 1.80e-09 7.16e-03 NA
2. P Q9BBS4 ATP synthase subunit b, chloroplastic 1.80e-07 1.87e-03 NA
2. P Q5UR51 Uncharacterized protein R566 NA 7.30e-03 NA
2. P V6F5F3 Liposome tubulation protein MamY 8.98e-06 1.59e-06 NA
2. P Q9JGU0 Phosphoprotein NA 7.16e-03 NA
2. P A4QJR9 ATP synthase subunit b, chloroplastic 5.62e-07 7.95e-03 NA
2. P Q06FX5 ATP synthase subunit b, chloroplastic 4.68e-08 1.53e-03 NA
2. P A5VNW5 ATP synthase subunit b 2 2.63e-07 2.63e-02 NA
2. P Q1AVH5 ATP synthase subunit b 1.29e-08 3.10e-02 NA
2. P B2Y1W1 ATP synthase subunit b, chloroplastic 4.83e-09 1.88e-02 NA
2. P Q2W8K3 Liposome tubulation protein MamY 2.65e-06 2.38e-02 NA
2. P Q0G9N3 ATP synthase subunit b, chloroplastic 7.12e-07 7.95e-03 NA
2. P D6YXE8 Inclusion membrane protein A 4.80e-06 2.23e-03 NA
2. P P06290 ATP synthase subunit b, chloroplastic 2.61e-08 1.60e-02 NA
2. P A9L982 ATP synthase subunit b, chloroplastic 5.25e-08 2.49e-02 NA
2. P A1XGM4 ATP synthase subunit b, chloroplastic 1.06e-07 4.23e-03 NA
2. P Q70XU9 ATP synthase subunit b, chloroplastic 1.35e-09 6.03e-03 NA
2. P Q9NX63 MICOS complex subunit MIC19 3.12e-08 4.74e-02 NA
2. P O94494 Inner kinetochore subunit sim4 3.11e-06 1.06e-02 NA
2. P A8Y9G6 ATP synthase subunit b, chloroplastic 2.57e-08 8.57e-03 NA
2. P A4QL05 ATP synthase subunit b, chloroplastic 3.73e-07 1.38e-02 NA
2. P P06528 ATP synthase subunit b, chloroplastic 1.23e-08 8.57e-03 NA
2. P A6MMJ3 ATP synthase subunit b, chloroplastic 1.08e-06 3.72e-02 NA