Summary

Q96CB5

Homolog: Q7Z5D8.
Function: NANOG neighbor homeobox.

Statistics

Total GO Annotation: 11
Unique PROST Go: 6
Unique BLAST Go: 5

Total Homologs: 12
Unique PROST Homologs: 6
Unique BLAST Homologs: 5

Structures and Sequence Alignment

The best structural homolog that predicted by 3. B was Q7Z5D8 (NANOG neighbor homeobox) with a FATCAT P-Value: 0.0004 and RMSD of 3.16 angstrom. The sequence alignment identity is 20.3%.
Structural alignment shown in left. Query protein Q96CB5 colored as red in alignment, homolog Q7Z5D8 colored as blue. Query protein Q96CB5 is also shown in right top, homolog Q7Z5D8 showed in right bottom. They are colored based on secondary structures. 

  Q96CB5 MRKNESYLNQPAPPIPIPTLSLMGGCREHFENHWKGRARWLMPVIPALWEAKAGRS--PEVRS---SK--PAWPTW-RNPIFTKNTKISQVLELFLNYQS 92
  Q7Z5D8 -------------------------------MH---RARWLTPVIPALWEAEAGRSRGQEIETILANKKQSAMP-WDQDP--EQSTG---------NYS- 53

  Q96CB5 LICALEKQKRQKGSLAIFCWSFQG--GCVSKRPDVPSLKSQKP-------KRKRITGR------KRL-SKGFWSLLFSNL-GRF---------------- 159
  Q7Z5D8 ---EDEQNGKQK-------WREEGEAG--RKREREKEEKNEKELQDEQENKRKRENEKQKQYPEKRLVSK---SLMHT-LWAKFKLNRCPTIQESLSLSF 137

  Q96CB5 --------------------------------------------------- 159
  Q7Z5D8 EFDMTHKQISQWFCKTRKKYNKEMSKRKHKKKHMRWRSLCCQGWSRTPALK 188

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0019062 virion attachment to host cell
2. P GO:0075513 caveolin-mediated endocytosis of virus by host cell
2. P GO:0016021 integral component of membrane
2. P GO:0055036 virion membrane
2. P GO:0039654 fusion of virus membrane with host endosome membrane
2. P GO:0033644 host cell membrane
3. B GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
3. B GO:0005634 nucleus
3. B GO:0000785 chromatin
3. B GO:0043066 negative regulation of apoptotic process
3. B GO:0008284 positive regulation of cell population proliferation

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q96CB5 Putative uncharacterized protein C8orf44 0 2.65e-164 1.20e-114
2. P O13587 Uncharacterized protein YPR096C 8.02e-01 3.85e-02 NA
2. P P03139 Large envelope protein NA 1.18e-02 NA
2. P P15481 Protein VP5 NA 7.34e-03 NA
2. P P16820 Uncharacterized protein UL63 NA 1.41e-02 NA
2. P P25221 Protein VP5 NA 4.51e-02 NA
2. P P0C751 Protein VP5 NA 4.77e-03 NA
3. B Q9P1C3 Putative uncharacterized protein PRO2829 2.25e-03 NA 7.26e-09
3. B K7EIQ3 Uncharacterized protein ZNF561-AS1 1.08e-01 NA 0.009
3. B Q9NRJ1 Protein MOST-1 9.61e-02 NA 4.56e-09
3. B A0A2R8Y7D0 Ubiquitin domain-containing protein TINCR 1.07e-01 NA 0.024
3. B Q7Z5D8 NANOG neighbor homeobox 4.00e-04 NA 5.33e-04