Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
Q32NT4
(Leucine-rich repeat-containing protein 58) with a FATCAT P-Value: 0.0 and RMSD of 3.22 angstrom. The sequence alignment identity is 66.8%.
Structural alignment shown in left. Query protein Q96CX6 colored as red in alignment, homolog Q32NT4 colored as blue.
Query protein Q96CX6 is also shown in right top, homolog Q32NT4 showed in right bottom. They are colored based on secondary structures.
Q96CX6 MEEAGAAVVTAGEAELNWSRLSVSTETLESELEARGEERRGAREALLRLLLPHNRLVSLPRALGSGFPHLQLLDVSGNALTALGPELLALRGLRTLLAKN 100 Q32NT4 ME--GPE-VTDGDNVLNLTHLGL--ENL--NLELVSENKR--KD-VQQILLPHNRLVVLPPLVAS-FIHLHLLDISNNNMVYIGEEILGLTKLKTLLAKN 89 Q96CX6 NRLGGPSALPK---GLAQSPLCRSLQVLNLSGNCFQEVPASLLELRALQTLSLGGNQLQSIPAEIENLQSLECLYLGGNFIKEIPPELGNLPSLNYLVLC 197 Q32NT4 NRL-DEFSFPKEMGGM------R-LEVLNLSGNRFEEIPDQFLQIPTLKSLSLGGNRLKSIPAEIENLISLEFLYLGGNFISSIPSELANLPYLSYLVLC 181 Q96CX6 DNKIQSIPPQLSQLHSLRSLSLHNNLLTYLPREILNLIHLEELSLRGNPLVVRFVRDLTYDPPTLLELAARTIKIRNISYTPYDLPGNLLRYLGSASNCP 297 Q32NT4 DNRIQSIPPQLAQVHSLRSLSLHNNLLTYLPREILSLVHLHELSLRGNPLVVRFVRDLTYTPPTLLELAGRTIKSHGIPYCPWELPENLLRYLDLASKCP 281 Q96CX6 NPKCGGVYFDCCVRQIKFVDFCGKYRLPLMHYLCSPECSSPCSSASHSSTSQSESDSEDEASVAARRMQKVLLG 371 Q32NT4 NPKCSGVYFDCCVRQIKFVDFCGKYRLPLMHYLCSPECSSPCGSTSH-----SESDSEDEVNVAARRMQKVLLG 350
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0010555 | response to mannitol |
| 1. PB | GO:0046007 | negative regulation of activated T cell proliferation |
| 1. PB | GO:0050729 | positive regulation of inflammatory response |
| 1. PB | GO:0032491 | detection of molecule of fungal origin |
| 1. PB | GO:0032755 | positive regulation of interleukin-6 production |
| 1. PB | GO:0002237 | response to molecule of bacterial origin |
| 1. PB | GO:0002718 | regulation of cytokine production involved in immune response |
| 1. PB | GO:0034123 | positive regulation of toll-like receptor signaling pathway |
| 1. PB | GO:0042043 | neurexin family protein binding |
| 1. PB | GO:0002225 | positive regulation of antimicrobial peptide production |
| 1. PB | GO:0002091 | negative regulation of receptor internalization |
| 1. PB | GO:0031430 | M band |
| 1. PB | GO:0030426 | growth cone |
| 1. PB | GO:0140059 | dendrite arborization |
| 1. PB | GO:0042567 | insulin-like growth factor ternary complex |
| 1. PB | GO:0032729 | positive regulation of interferon-gamma production |
| 1. PB | GO:0010376 | stomatal complex formation |
| 1. PB | GO:0061809 | NAD+ nucleotidase, cyclic ADP-ribose generating |
| 1. PB | GO:0099054 | presynapse assembly |
| 1. PB | GO:0090497 | mesenchymal cell migration |
| 1. PB | GO:0016201 | synaptic target inhibition |
| 1. PB | GO:0099060 | integral component of postsynaptic specialization membrane |
| 1. PB | GO:0048495 | Roundabout binding |
| 1. PB | GO:0005615 | extracellular space |
| 1. PB | GO:0060076 | excitatory synapse |
| 1. PB | GO:0009986 | cell surface |
| 1. PB | GO:0005030 | neurotrophin receptor activity |
| 1. PB | GO:0007165 | signal transduction |
| 1. PB | GO:0099061 | integral component of postsynaptic density membrane |
| 1. PB | GO:0004722 | protein serine/threonine phosphatase activity |
| 1. PB | GO:0050919 | negative chemotaxis |
| 1. PB | GO:0006954 | inflammatory response |
| 1. PB | GO:0098978 | glutamatergic synapse |
| 1. PB | GO:0050808 | synapse organization |
| 1. PB | GO:0043331 | response to dsRNA |
| 1. PB | GO:0055013 | cardiac muscle cell development |
| 1. PB | GO:0002756 | MyD88-independent toll-like receptor signaling pathway |
| 1. PB | GO:0052083 | suppression by symbiont of host cell-mediated immune response |
| 1. PB | GO:0010977 | negative regulation of neuron projection development |
| 1. PB | GO:0070062 | extracellular exosome |
| 1. PB | GO:0046813 | receptor-mediated virion attachment to host cell |
| 1. PB | GO:0097113 | AMPA glutamate receptor clustering |
| 1. PB | GO:0050431 | transforming growth factor beta binding |
| 1. PB | GO:0010073 | meristem maintenance |
| 1. PB | GO:0043231 | intracellular membrane-bounded organelle |
| 1. PB | GO:0034055 | effector-mediated induction of programmed cell death in host |
| 1. PB | GO:0038023 | signaling receptor activity |
| 1. PB | GO:0051770 | positive regulation of nitric-oxide synthase biosynthetic process |
| 1. PB | GO:0045671 | negative regulation of osteoclast differentiation |
| 1. PB | GO:1902875 | regulation of embryonic pattern specification |
| 1. PB | GO:0002730 | regulation of dendritic cell cytokine production |
| 1. PB | GO:0032728 | positive regulation of interferon-beta production |
| 1. PB | GO:1905034 | regulation of antifungal innate immune response |
| 1. PB | GO:1905606 | regulation of presynapse assembly |
| 1. PB | GO:0045087 | innate immune response |
| 1. PB | GO:0051897 | positive regulation of protein kinase B signaling |
| 1. PB | GO:0032722 | positive regulation of chemokine production |
| 1. PB | GO:0046790 | virion binding |
| 1. PB | GO:0022038 | corpus callosum development |
| 1. PB | GO:0044074 | negative regulation by symbiont of host translation |
| 1. PB | GO:0099104 | potassium channel activator activity |
| 1. PB | GO:0007411 | axon guidance |
| 1. PB | GO:0060291 | long-term synaptic potentiation |
| 1. PB | GO:0030500 | regulation of bone mineralization |
| 1. PB | GO:0010544 | negative regulation of platelet activation |
| 1. PB | GO:0032760 | positive regulation of tumor necrosis factor production |
| 1. PB | GO:1902004 | positive regulation of amyloid-beta formation |
| 1. PB | GO:1900155 | negative regulation of bone trabecula formation |
| 1. PB | GO:0035197 | siRNA binding |
| 1. PB | GO:1901398 | regulation of transforming growth factor beta3 activation |
| 1. PB | GO:0043236 | laminin binding |
| 1. PB | GO:0038187 | pattern recognition receptor activity |
| 1. PB | GO:0090696 | post-embryonic plant organ development |
| 1. PB | GO:0032727 | positive regulation of interferon-alpha production |
| 1. PB | GO:0008063 | Toll signaling pathway |
| 1. PB | GO:0007249 | I-kappaB kinase/NF-kappaB signaling |
| 1. PB | GO:1903818 | positive regulation of voltage-gated potassium channel activity |
| 1. PB | GO:0002224 | toll-like receptor signaling pathway |
| 1. PB | GO:0031012 | extracellular matrix |
| 1. PB | GO:0005518 | collagen binding |
| 1. PB | GO:0008201 | heparin binding |
| 1. PB | GO:0050135 | NAD(P)+ nucleosidase activity |
| 1. PB | GO:0072578 | neurotransmitter-gated ion channel clustering |
| 1. PB | GO:0001968 | fibronectin binding |
| 1. PB | GO:0032757 | positive regulation of interleukin-8 production |
| 1. PB | GO:0003401 | axis elongation |
| 1. PB | GO:0005789 | endoplasmic reticulum membrane |
| 1. PB | GO:0043395 | heparan sulfate proteoglycan binding |
| 1. PB | GO:0043204 | perikaryon |
| 1. PB | GO:0034158 | toll-like receptor 8 signaling pathway |
| 1. PB | GO:0007155 | cell adhesion |
| 1. PB | GO:0009597 | detection of virus |
| 1. PB | GO:0036020 | endolysosome membrane |
| 1. PB | GO:0051607 | defense response to virus |
| 1. PB | GO:0003677 | DNA binding |
| 1. PB | GO:0034346 | positive regulation of type III interferon production |
| 1. PB | GO:0043679 | axon terminus |
| 1. PB | GO:0051963 | regulation of synapse assembly |
| 1. PB | GO:0034138 | toll-like receptor 3 signaling pathway |
| 1. PB | GO:0043330 | response to exogenous dsRNA |
| 1. PB | GO:0098982 | GABA-ergic synapse |
| 1. PB | GO:0001932 | regulation of protein phosphorylation |
| 1. PB | GO:0032009 | early phagosome |
| 1. PB | GO:0048681 | negative regulation of axon regeneration |
| 1. PB | GO:1901388 | regulation of transforming growth factor beta activation |
| 1. PB | GO:0007252 | I-kappaB phosphorylation |
| 1. PB | GO:0051393 | alpha-actinin binding |
| 1. PB | GO:0002755 | MyD88-dependent toll-like receptor signaling pathway |
| 1. PB | GO:0030254 | protein secretion by the type III secretion system |
| 1. PB | GO:0051965 | positive regulation of synapse assembly |
| 1. PB | GO:1901629 | regulation of presynaptic membrane organization |
| 1. PB | GO:0031102 | neuron projection regeneration |
| 1. PB | GO:0002177 | manchette |
| 1. PB | GO:1903077 | negative regulation of protein localization to plasma membrane |
| 1. PB | GO:0062009 | secondary palate development |
| 1. PB | GO:0046872 | metal ion binding |
| 1. PB | GO:0099151 | regulation of postsynaptic density assembly |
| 1. PB | GO:0002240 | response to molecule of oomycetes origin |
| 1. PB | GO:0062023 | collagen-containing extracellular matrix |
| 1. PB | GO:0001818 | negative regulation of cytokine production |
| 1. PB | GO:0004888 | transmembrane signaling receptor activity |
| 1. PB | GO:0010811 | positive regulation of cell-substrate adhesion |
| 1. PB | GO:0042060 | wound healing |
| 1. PB | GO:0030512 | negative regulation of transforming growth factor beta receptor signaling pathway |
| 1. PB | GO:0048683 | regulation of collateral sprouting of intact axon in response to injury |
| 1. PB | GO:0046658 | anchored component of plasma membrane |
| 1. PB | GO:0007596 | blood coagulation |
| 1. PB | GO:0035374 | chondroitin sulfate binding |
| 1. PB | GO:0035640 | exploration behavior |
| 1. PB | GO:0030017 | sarcomere |
| 2. P | GO:0021540 | corpus callosum morphogenesis |
| 2. P | GO:0021766 | hippocampus development |
| 2. P | GO:0005768 | endosome |
| 2. P | GO:0005874 | microtubule |
| 2. P | GO:0006404 | RNA import into nucleus |
| 2. P | GO:0051932 | synaptic transmission, GABAergic |
| 2. P | GO:0005686 | U2 snRNP |
| 2. P | GO:0010375 | stomatal complex patterning |
| 2. P | GO:0002347 | response to tumor cell |
| 2. P | GO:0045121 | membrane raft |
| 2. P | GO:0090090 | negative regulation of canonical Wnt signaling pathway |
| 2. P | GO:0030424 | axon |
| 2. P | GO:0032733 | positive regulation of interleukin-10 production |
| 2. P | GO:0015459 | potassium channel regulator activity |
| 2. P | GO:0007021 | tubulin complex assembly |
| 2. P | GO:1902350 | cellular response to chloroquine |
| 2. P | GO:0003431 | growth plate cartilage chondrocyte development |
| 2. P | GO:0030620 | U2 snRNA binding |
| 2. P | GO:0045504 | dynein heavy chain binding |
| 2. P | GO:0009897 | external side of plasma membrane |
| 2. P | GO:0016200 | synaptic target attraction |
| 2. P | GO:0014005 | microglia development |
| 2. P | GO:0050871 | positive regulation of B cell activation |
| 2. P | GO:0035583 | sequestering of TGFbeta in extracellular matrix |
| 2. P | GO:1901895 | negative regulation of ATPase-coupled calcium transmembrane transporter activity |
| 2. P | GO:0033344 | cholesterol efflux |
| 2. P | GO:0005154 | epidermal growth factor receptor binding |
| 2. P | GO:0005815 | microtubule organizing center |
| 2. P | GO:0005524 | ATP binding |
| 2. P | GO:0006801 | superoxide metabolic process |
| 2. P | GO:0008076 | voltage-gated potassium channel complex |
| 2. P | GO:1990723 | cytoplasmic periphery of the nuclear pore complex |
| 2. P | GO:0030277 | maintenance of gastrointestinal epithelium |
| 2. P | GO:0036157 | outer dynein arm |
| 2. P | GO:0042995 | cell projection |
| 2. P | GO:0002804 | positive regulation of antifungal peptide production |
| 2. P | GO:0006955 | immune response |
| 2. P | GO:0010921 | regulation of phosphatase activity |
| 2. P | GO:0071805 | potassium ion transmembrane transport |
| 2. P | GO:0008203 | cholesterol metabolic process |
| 2. P | GO:0021670 | lateral ventricle development |
| 2. P | GO:0042635 | positive regulation of hair cycle |
| 2. P | GO:0070840 | dynein complex binding |
| 2. P | GO:0005783 | endoplasmic reticulum |
| 2. P | GO:0035418 | protein localization to synapse |
| 2. P | GO:0042622 | photoreceptor outer segment membrane |
| 2. P | GO:0030890 | positive regulation of B cell proliferation |
| 2. P | GO:0061073 | ciliary body morphogenesis |
| 2. P | GO:0051092 | positive regulation of NF-kappaB transcription factor activity |
| 2. P | GO:0006913 | nucleocytoplasmic transport |
| 2. P | GO:0050921 | positive regulation of chemotaxis |
| 2. P | GO:0034162 | toll-like receptor 9 signaling pathway |
| 2. P | GO:0040022 | feminization of hermaphroditic germ-line |
| 2. P | GO:0032911 | negative regulation of transforming growth factor beta1 production |
| 2. P | GO:0005856 | cytoskeleton |
| 2. P | GO:0045596 | negative regulation of cell differentiation |
| 2. P | GO:0060326 | cell chemotaxis |
| 2. P | GO:0051729 | germline cell cycle switching, mitotic to meiotic cell cycle |
| 2. P | GO:0048839 | inner ear development |
| 2. P | GO:0021960 | anterior commissure morphogenesis |
| 2. P | GO:0001944 | vasculature development |
| 2. P | GO:0036364 | transforming growth factor beta1 activation |
| 2. P | GO:0060122 | inner ear receptor cell stereocilium organization |
| 2. P | GO:0060760 | positive regulation of response to cytokine stimulus |
| 2. P | GO:0007179 | transforming growth factor beta receptor signaling pathway |
| 2. P | GO:0007023 | post-chaperonin tubulin folding pathway |
| 2. P | GO:0070983 | dendrite guidance |
| 2. P | GO:0036158 | outer dynein arm assembly |
| 2. P | GO:0016363 | nuclear matrix |
| 2. P | GO:0005764 | lysosome |
| 2. P | GO:0019834 | phospholipase A2 inhibitor activity |
| 2. P | GO:0043486 | histone exchange |
| 2. P | GO:0071014 | post-mRNA release spliceosomal complex |
| 2. P | GO:0032281 | AMPA glutamate receptor complex |
| 2. P | GO:1904761 | negative regulation of myofibroblast differentiation |
| 2. P | GO:1903124 | negative regulation of thioredoxin peroxidase activity |
| 2. P | GO:0032735 | positive regulation of interleukin-12 production |
| 2. P | GO:0036019 | endolysosome |
| 2. P | GO:0044325 | transmembrane transporter binding |
| 2. P | GO:0032715 | negative regulation of interleukin-6 production |
| 2. P | GO:0030425 | dendrite |
| 2. P | GO:0002218 | activation of innate immune response |
| 2. P | GO:0031103 | axon regeneration |
| 2. P | GO:0007166 | cell surface receptor signaling pathway |
| 2. P | GO:0046827 | positive regulation of protein export from nucleus |
| 2. P | GO:0045322 | unmethylated CpG binding |
| 2. P | GO:0098685 | Schaffer collateral - CA1 synapse |
| 2. P | GO:0043010 | camera-type eye development |
| 2. P | GO:0019212 | phosphatase inhibitor activity |
| 2. P | GO:0009277 | fungal-type cell wall |
| 2. P | GO:0005681 | spliceosomal complex |
| 2. P | GO:0071004 | U2-type prespliceosome |
| 2. P | GO:0022414 | reproductive process |
| 2. P | GO:0042393 | histone binding |
| 2. P | GO:0043014 | alpha-tubulin binding |
| 2. P | GO:0030286 | dynein complex |
| 2. P | GO:0032741 | positive regulation of interleukin-18 production |
| 2. P | GO:0048471 | perinuclear region of cytoplasm |
| 2. P | GO:0070373 | negative regulation of ERK1 and ERK2 cascade |
| 2. P | GO:0042632 | cholesterol homeostasis |
| 2. P | GO:0000398 | mRNA splicing, via spliceosome |
| 2. P | GO:0030178 | negative regulation of Wnt signaling pathway |
| 2. P | GO:0043410 | positive regulation of MAPK cascade |
| 2. P | GO:0097009 | energy homeostasis |
| 2. P | GO:0052170 | suppression by symbiont of host innate immune response |
| 2. P | GO:0002639 | positive regulation of immunoglobulin production |
| 2. P | GO:0031225 | anchored component of membrane |
| 2. P | GO:0042981 | regulation of apoptotic process |
| 2. P | GO:0021591 | ventricular system development |
| 2. P | GO:0030532 | small nuclear ribonucleoprotein complex |
| 2. P | GO:0071007 | U2-type catalytic step 2 spliceosome |
| 2. P | GO:0098868 | bone growth |
| 2. P | GO:0000812 | Swr1 complex |
| 2. P | GO:0034165 | positive regulation of toll-like receptor 9 signaling pathway |
| 2. P | GO:0015630 | microtubule cytoskeleton |
| 2. P | GO:0031505 | fungal-type cell wall organization |
| 2. P | GO:0003779 | actin binding |
| 2. P | GO:0015631 | tubulin binding |
| 2. P | GO:0045577 | regulation of B cell differentiation |
| 2. P | GO:0098686 | hippocampal mossy fiber to CA3 synapse |
| 2. P | GO:0035208 | positive regulation of hemocyte proliferation |
| 2. P | GO:0019838 | growth factor binding |
| 2. P | GO:0005249 | voltage-gated potassium channel activity |
| 2. P | GO:0008355 | olfactory learning |
| 2. P | GO:1904117 | cellular response to vasopressin |
| 2. P | GO:0034163 | regulation of toll-like receptor 9 signaling pathway |
| 2. P | GO:0002752 | cell surface pattern recognition receptor signaling pathway |
| 3. B | GO:0003345 | proepicardium cell migration involved in pericardium morphogenesis |
| 3. B | GO:0030198 | extracellular matrix organization |
| 3. B | GO:0030014 | CCR4-NOT complex |
| 3. B | GO:0009729 | detection of brassinosteroid stimulus |
| 3. B | GO:0016080 | synaptic vesicle targeting |
| 3. B | GO:0090141 | positive regulation of mitochondrial fission |
| 3. B | GO:0044300 | cerebellar mossy fiber |
| 3. B | GO:0090037 | positive regulation of protein kinase C signaling |
| 3. B | GO:2001013 | epithelial cell proliferation involved in renal tubule morphogenesis |
| 3. B | GO:0007089 | traversing start control point of mitotic cell cycle |
| 3. B | GO:1903217 | negative regulation of protein processing involved in protein targeting to mitochondrion |
| 3. B | GO:0010640 | regulation of platelet-derived growth factor receptor signaling pathway |
| 3. B | GO:0061161 | positive regulation of establishment of bipolar cell polarity regulating cell shape |
| 3. B | GO:0005095 | GTPase inhibitor activity |
| 3. B | GO:0030539 | male genitalia development |
| 3. B | GO:0010069 | zygote asymmetric cytokinesis in embryo sac |
| 3. B | GO:0060412 | ventricular septum morphogenesis |
| 3. B | GO:0015734 | taurine transport |
| 3. B | GO:0090406 | pollen tube |
| 3. B | GO:0030021 | extracellular matrix structural constituent conferring compression resistance |
| 3. B | GO:0045663 | positive regulation of myoblast differentiation |
| 3. B | GO:0019903 | protein phosphatase binding |
| 3. B | GO:0106310 | protein serine kinase activity |
| 3. B | GO:0009553 | embryo sac development |
| 3. B | GO:0035025 | positive regulation of Rho protein signal transduction |
| 3. B | GO:0120103 | centriolar subdistal appendage |
| 3. B | GO:0008330 | protein tyrosine/threonine phosphatase activity |
| 3. B | GO:0050840 | extracellular matrix binding |
| 3. B | GO:0060581 | cell fate commitment involved in pattern specification |
| 3. B | GO:0072282 | metanephric nephron tubule morphogenesis |
| 3. B | GO:0016239 | positive regulation of macroautophagy |
| 3. B | GO:0003725 | double-stranded RNA binding |
| 3. B | GO:0007157 | heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules |
| 3. B | GO:1904027 | negative regulation of collagen fibril organization |
| 3. B | GO:0106307 | |
| 3. B | GO:0030054 | cell junction |
| 3. B | GO:0045930 | negative regulation of mitotic cell cycle |
| 3. B | GO:0098887 | neurotransmitter receptor transport, endosome to postsynaptic membrane |
| 3. B | GO:0000076 | DNA replication checkpoint signaling |
| 3. B | GO:0030534 | adult behavior |
| 3. B | GO:0061975 | articular cartilage development |
| 3. B | GO:2001222 | regulation of neuron migration |
| 3. B | GO:0060348 | bone development |
| 3. B | GO:0001768 | establishment of T cell polarity |
| 3. B | GO:0044753 | amphisome |
| 3. B | GO:0140360 | cyclic-GMP-AMP transmembrane transporter activity |
| 3. B | GO:0032588 | trans-Golgi network membrane |
| 3. B | GO:0071485 | cellular response to absence of light |
| 3. B | GO:0070086 | ubiquitin-dependent endocytosis |
| 3. B | GO:0016336 | establishment or maintenance of polarity of larval imaginal disc epithelium |
| 3. B | GO:0042734 | presynaptic membrane |
| 3. B | GO:0042551 | neuron maturation |
| 3. B | GO:0050929 | induction of negative chemotaxis |
| 3. B | GO:0009934 | regulation of meristem structural organization |
| 3. B | GO:0017046 | peptide hormone binding |
| 3. B | GO:0090548 | response to nitrate starvation |
| 3. B | GO:0034142 | toll-like receptor 4 signaling pathway |
| 3. B | GO:0034750 | Scrib-APC-beta-catenin complex |
| 3. B | GO:0099560 | synaptic membrane adhesion |
| 3. B | GO:0007601 | visual perception |
| 3. B | GO:0099400 | caveola neck |
| 3. B | GO:0030239 | myofibril assembly |
| 3. B | GO:0005887 | integral component of plasma membrane |
| 3. B | GO:0009742 | brassinosteroid mediated signaling pathway |
| 3. B | GO:0071215 | cellular response to abscisic acid stimulus |
| 3. B | GO:0030056 | hemidesmosome |
| 3. B | GO:0098968 | neurotransmitter receptor transport postsynaptic membrane to endosome |
| 3. B | GO:0017017 | MAP kinase tyrosine/serine/threonine phosphatase activity |
| 3. B | GO:0004532 | exoribonuclease activity |
| 3. B | GO:0035385 | Roundabout signaling pathway |
| 3. B | GO:0060561 | apoptotic process involved in morphogenesis |
| 3. B | GO:0048437 | floral organ development |
| 3. B | GO:0006952 | defense response |
| 3. B | GO:0002758 | innate immune response-activating signal transduction |
| 3. B | GO:0010088 | phloem development |
| 3. B | GO:0040036 | regulation of fibroblast growth factor receptor signaling pathway |
| 3. B | GO:0004672 | protein kinase activity |
| 3. B | GO:0019800 | peptide cross-linking via chondroitin 4-sulfate glycosaminoglycan |
| 3. B | GO:0008528 | G protein-coupled peptide receptor activity |
| 3. B | GO:0010067 | procambium histogenesis |
| 3. B | GO:0010359 | regulation of anion channel activity |
| 3. B | GO:0005104 | fibroblast growth factor receptor binding |
| 3. B | GO:1903980 | positive regulation of microglial cell activation |
| 3. B | GO:0042730 | fibrinolysis |
| 3. B | GO:0070997 | neuron death |
| 3. B | GO:0010078 | maintenance of root meristem identity |
| 3. B | GO:0048481 | plant ovule development |
| 3. B | GO:0043928 | exonucleolytic catabolism of deadenylated mRNA |
| 3. B | GO:0061290 | canonical Wnt signaling pathway involved in metanephric kidney development |
| 3. B | GO:0010063 | positive regulation of trichoblast fate specification |
| 3. B | GO:0106311 | |
| 3. B | GO:0048833 | specification of floral organ number |
| 3. B | GO:0010227 | floral organ abscission |
| 3. B | GO:0005496 | steroid binding |
| 3. B | GO:0036335 | intestinal stem cell homeostasis |
| 3. B | GO:0034137 | positive regulation of toll-like receptor 2 signaling pathway |
| 3. B | GO:0050772 | positive regulation of axonogenesis |
| 3. B | GO:0080092 | regulation of pollen tube growth |
| 3. B | GO:0071666 | Slit-Robo signaling complex |
| 3. B | GO:0071287 | cellular response to manganese ion |
| 3. B | GO:0030374 | nuclear receptor coactivator activity |
| 3. B | GO:0090288 | negative regulation of cellular response to growth factor stimulus |
| 3. B | GO:1902499 | positive regulation of protein autoubiquitination |
| 3. B | GO:0031223 | auditory behavior |
| 3. B | GO:0051646 | mitochondrion localization |
| 3. B | GO:0032914 | positive regulation of transforming growth factor beta1 production |
| 3. B | GO:0006281 | DNA repair |
| 3. B | GO:0007409 | axonogenesis |
| 3. B | GO:0043069 | negative regulation of programmed cell death |
| 3. B | GO:1900744 | regulation of p38MAPK cascade |
| 3. B | GO:0022028 | tangential migration from the subventricular zone to the olfactory bulb |
| 3. B | GO:1905279 | regulation of retrograde transport, endosome to Golgi |
| 3. B | GO:0005911 | cell-cell junction |
| 3. B | GO:1901333 | positive regulation of lateral root development |
| 3. B | GO:0008543 | fibroblast growth factor receptor signaling pathway |
| 3. B | GO:0048831 | regulation of shoot system development |
| 3. B | GO:0042562 | hormone binding |
| 3. B | GO:1902018 | negative regulation of cilium assembly |
| 3. B | GO:0030859 | polarized epithelial cell differentiation |
| 3. B | GO:0005737 | cytoplasm |
| 3. B | GO:0048226 | Casparian strip |
| 3. B | GO:0097120 | receptor localization to synapse |
| 3. B | GO:1990523 | bone regeneration |
| 3. B | GO:0004535 | poly(A)-specific ribonuclease activity |
| 3. B | GO:0014009 | glial cell proliferation |
| 3. B | GO:2000405 | negative regulation of T cell migration |
| 3. B | GO:1902288 | regulation of defense response to oomycetes |
| 3. B | GO:0009755 | hormone-mediated signaling pathway |
| 3. B | GO:0070831 | basement membrane assembly |
| 3. B | GO:0090619 | meiotic spindle pole |
| 3. B | GO:0000932 | P-body |
| 3. B | GO:0001649 | osteoblast differentiation |
| 3. B | GO:0048565 | digestive tract development |
| 3. B | GO:0010102 | lateral root morphogenesis |
| 3. B | GO:0035335 | peptidyl-tyrosine dephosphorylation |
| 3. B | GO:0010955 | negative regulation of protein processing |
| 3. B | GO:0120163 | negative regulation of cold-induced thermogenesis |
| 3. B | GO:0031047 | gene silencing by RNA |
| 3. B | GO:0034154 | toll-like receptor 7 signaling pathway |
| 3. B | GO:0030015 | CCR4-NOT core complex |
| 3. B | GO:0099072 | regulation of postsynaptic membrane neurotransmitter receptor levels |
| 3. B | GO:0004675 | transmembrane receptor protein serine/threonine kinase activity |
| 3. B | GO:0019806 | bromide peroxidase activity |
| 3. B | GO:0005614 | interstitial matrix |
| 3. B | GO:0098633 | collagen fibril binding |
| 3. B | GO:0034122 | negative regulation of toll-like receptor signaling pathway |
| 3. B | GO:1902533 | positive regulation of intracellular signal transduction |
| 3. B | GO:0050918 | positive chemotaxis |
| 3. B | GO:0010080 | regulation of floral meristem growth |
| 3. B | GO:0051901 | positive regulation of mitochondrial depolarization |
| 3. B | GO:0048598 | embryonic morphogenesis |
| 3. B | GO:0005225 | volume-sensitive anion channel activity |
| 3. B | GO:0036289 | peptidyl-serine autophosphorylation |
| 3. B | GO:0000175 | 3'-5'-exoribonuclease activity |
| 3. B | GO:0008285 | negative regulation of cell population proliferation |
| 3. B | GO:0045197 | establishment or maintenance of epithelial cell apical/basal polarity |
| 3. B | GO:0004016 | adenylate cyclase activity |
| 3. B | GO:0035996 | rhabdomere microvillus |
| 3. B | GO:0032497 | detection of lipopolysaccharide |
| 3. B | GO:0010305 | leaf vascular tissue pattern formation |
| 3. B | GO:0032185 | septin cytoskeleton organization |
| 3. B | GO:0000287 | magnesium ion binding |
| 3. B | GO:0061364 | apoptotic process involved in luteolysis |
| 3. B | GO:0034136 | negative regulation of toll-like receptor 2 signaling pathway |
| 3. B | GO:0090190 | positive regulation of branching involved in ureteric bud morphogenesis |
| 3. B | GO:2000067 | regulation of root morphogenesis |
| 3. B | GO:0007567 | parturition |
| 3. B | GO:1902692 | regulation of neuroblast proliferation |
| 3. B | GO:0005539 | glycosaminoglycan binding |
| 3. B | GO:0032584 | growth cone membrane |
| 3. B | GO:0090024 | negative regulation of neutrophil chemotaxis |
| 3. B | GO:0072224 | metanephric glomerulus development |
| 3. B | GO:0031362 | anchored component of external side of plasma membrane |
| 3. B | GO:0009994 | oocyte differentiation |
| 3. B | GO:0032473 | cytoplasmic side of mitochondrial outer membrane |
| 3. B | GO:0016593 | Cdc73/Paf1 complex |
| 3. B | GO:0060007 | linear vestibuloocular reflex |
| 3. B | GO:0010593 | negative regulation of lamellipodium assembly |
| 3. B | GO:0030154 | cell differentiation |
| 3. B | GO:0060027 | convergent extension involved in gastrulation |
| 3. B | GO:0010082 | regulation of root meristem growth |
| 3. B | GO:0002093 | auditory receptor cell morphogenesis |
| 3. B | GO:0016021 | integral component of membrane |
| 3. B | GO:0046579 | positive regulation of Ras protein signal transduction |
| 3. B | GO:1901727 | positive regulation of histone deacetylase activity |
| 3. B | GO:0001653 | peptide receptor activity |
| 3. B | GO:0031175 | neuron projection development |
| 3. B | GO:0045499 | chemorepellent activity |
| 3. B | GO:0034260 | negative regulation of GTPase activity |
| 3. B | GO:1903224 | regulation of endodermal cell differentiation |
| 3. B | GO:0060161 | positive regulation of dopamine receptor signaling pathway |
| 3. B | GO:0004714 | transmembrane receptor protein tyrosine kinase activity |
| 3. B | GO:0002238 | response to molecule of fungal origin |
| 3. B | GO:0042802 | identical protein binding |
| 3. B | GO:0032474 | otolith morphogenesis |
| 3. B | GO:0034211 | GTP-dependent protein kinase activity |
| 3. B | GO:0071711 | basement membrane organization |
| 3. B | GO:0010449 | root meristem growth |
| 3. B | GO:0042277 | peptide binding |
| 3. B | GO:0009556 | microsporogenesis |
| 3. B | GO:0043198 | dendritic shaft |
| 3. B | GO:0038131 | neuregulin receptor activity |
| 3. B | GO:0005589 | collagen type VI trimer |
| 3. B | GO:0055046 | microgametogenesis |
| 3. B | GO:0004706 | JUN kinase kinase kinase activity |
| 3. B | GO:0005201 | extracellular matrix structural constituent |
| 3. B | GO:0005796 | Golgi lumen |
| 3. B | GO:0070052 | collagen V binding |
| 3. B | GO:0099147 | extrinsic component of postsynaptic density membrane |
| 3. B | GO:0006884 | cell volume homeostasis |
| 3. B | GO:0043615 | astrocyte cell migration |
| 3. B | GO:0070430 | positive regulation of nucleotide-binding oligomerization domain containing 1 signaling pathway |
| 3. B | GO:0048281 | inflorescence morphogenesis |
| 3. B | GO:0060026 | convergent extension |
| 3. B | GO:0071470 | cellular response to osmotic stress |
| 3. B | GO:0006468 | protein phosphorylation |
| 3. B | GO:1904417 | positive regulation of xenophagy |
| 3. B | GO:0071672 | negative regulation of smooth muscle cell chemotaxis |
| 3. B | GO:0010103 | stomatal complex morphogenesis |
| 3. B | GO:0099179 | regulation of synaptic membrane adhesion |
| 3. B | GO:0016500 | protein-hormone receptor activity |
| 3. B | GO:0060628 | regulation of ER to Golgi vesicle-mediated transport |
| 3. B | GO:0050732 | negative regulation of peptidyl-tyrosine phosphorylation |
| 3. B | GO:1900150 | regulation of defense response to fungus |
| 3. B | GO:0050896 | response to stimulus |
| 3. B | GO:0007416 | synapse assembly |
| 3. B | GO:1904887 | Wnt signalosome assembly |
| 3. B | GO:0048508 | embryonic meristem development |
| 3. B | GO:0071260 | cellular response to mechanical stimulus |
| 3. B | GO:0031349 | positive regulation of defense response |
| 3. B | GO:0002667 | regulation of T cell anergy |
| 3. B | GO:0007188 | adenylate cyclase-modulating G protein-coupled receptor signaling pathway |
| 3. B | GO:0002329 | pre-B cell differentiation |
| 3. B | GO:1902803 | regulation of synaptic vesicle transport |
| 3. B | GO:0010075 | regulation of meristem growth |
| 3. B | GO:0010606 | positive regulation of cytoplasmic mRNA processing body assembly |
| 3. B | GO:0014041 | regulation of neuron maturation |
| 3. B | GO:0097060 | synaptic membrane |
| 3. B | GO:1905573 | ganglioside GM1 binding |
| 3. B | GO:0045108 | regulation of intermediate filament polymerization or depolymerization |
| 3. B | GO:0070100 | negative regulation of chemokine-mediated signaling pathway |
| 3. B | GO:0005886 | plasma membrane |
| 3. B | GO:1903351 | cellular response to dopamine |
| 3. B | GO:0010054 | trichoblast differentiation |
| 3. B | GO:0070966 | nuclear-transcribed mRNA catabolic process, no-go decay |
| 3. B | GO:0030714 | anterior/posterior axis specification, follicular epithelium |
| 3. B | GO:0014068 | positive regulation of phosphatidylinositol 3-kinase signaling |
| 3. B | GO:0061343 | cell adhesion involved in heart morphogenesis |
| 3. B | GO:0019199 | transmembrane receptor protein kinase activity |
| 3. B | GO:0010596 | negative regulation of endothelial cell migration |
| 3. B | GO:0030282 | bone mineralization |
| 3. B | GO:0005176 | ErbB-2 class receptor binding |
| 3. B | GO:2000280 | regulation of root development |
| 3. B | GO:0009826 | unidimensional cell growth |
| 3. B | GO:0042659 | regulation of cell fate specification |
| 3. B | GO:1905103 | integral component of lysosomal membrane |
| 3. B | GO:0044295 | axonal growth cone |
| 3. B | GO:0021972 | corticospinal neuron axon guidance through spinal cord |
| 3. B | GO:0003181 | atrioventricular valve morphogenesis |
| 3. B | GO:0045175 | basal protein localization |
| 3. B | GO:0090038 | negative regulation of protein kinase C signaling |
| 3. B | GO:0071676 | negative regulation of mononuclear cell migration |
| 3. B | GO:0002689 | negative regulation of leukocyte chemotaxis |
| 3. B | GO:0051014 | actin filament severing |
| 3. B | GO:0072202 | cell differentiation involved in metanephros development |
| 3. B | GO:0008157 | protein phosphatase 1 binding |
| 3. B | GO:0023041 | neuronal signal transduction |
| 3. B | GO:0005199 | structural constituent of cell wall |
| 3. B | GO:0006171 | cAMP biosynthetic process |
| 3. B | GO:0001974 | blood vessel remodeling |
| 3. B | GO:0032731 | positive regulation of interleukin-1 beta production |
| 3. B | GO:0051900 | regulation of mitochondrial depolarization |
| 3. B | GO:0060322 | head development |
| 3. B | GO:0003184 | pulmonary valve morphogenesis |
| 3. B | GO:0043531 | ADP binding |
| 3. B | GO:0060862 | negative regulation of floral organ abscission |
| 3. B | GO:0043030 | regulation of macrophage activation |
| 3. B | GO:0010071 | root meristem specification |
| 3. B | GO:0060427 | lung connective tissue development |
| 3. B | GO:0000188 | obsolete inactivation of MAPK activity |
| 3. B | GO:1990268 | response to gold nanoparticle |
| 3. B | GO:0048229 | gametophyte development |
| 3. B | GO:0009649 | entrainment of circadian clock |
| 3. B | GO:0005583 | fibrillar collagen trimer |
| 3. B | GO:0021836 | chemorepulsion involved in postnatal olfactory bulb interneuron migration |
| 3. B | GO:0010183 | pollen tube guidance |
| 3. B | GO:0140058 | neuron projection arborization |
| 3. B | GO:0032495 | response to muramyl dipeptide |
| 3. B | GO:0032809 | neuronal cell body membrane |
| 3. B | GO:0098609 | cell-cell adhesion |
| 3. B | GO:0014069 | postsynaptic density |
| 3. B | GO:0060658 | nipple morphogenesis |
| 3. B | GO:0033612 | receptor serine/threonine kinase binding |
| 3. B | GO:0050673 | epithelial cell proliferation |
| 3. B | GO:0014912 | negative regulation of smooth muscle cell migration |
| 3. B | GO:0010152 | pollen maturation |
| 3. B | GO:0016045 | detection of bacterium |
| 3. B | GO:0106306 | |
| 3. B | GO:1900747 | negative regulation of vascular endothelial growth factor signaling pathway |
| 3. B | GO:1903206 | negative regulation of hydrogen peroxide-induced cell death |
| 3. B | GO:0007639 | homeostasis of number of meristem cells |
| 3. B | GO:0035970 | peptidyl-threonine dephosphorylation |
| 3. B | GO:0051414 | response to cortisol |
| 3. B | GO:0010508 | positive regulation of autophagy |
| 3. B | GO:0070973 | protein localization to endoplasmic reticulum exit site |
| 3. B | GO:0048653 | anther development |
| 3. B | GO:0035089 | establishment of apical/basal cell polarity |
| 3. B | GO:0043202 | lysosomal lumen |
| 3. B | GO:0032968 | positive regulation of transcription elongation from RNA polymerase II promoter |
| 3. B | GO:0007156 | homophilic cell adhesion via plasma membrane adhesion molecules |
| 3. B | GO:0140361 | cyclic-GMP-AMP transmembrane import across plasma membrane |
| 3. B | GO:0010008 | endosome membrane |
| 3. B | GO:0070171 | negative regulation of tooth mineralization |
| 3. B | GO:0009506 | plasmodesma |
| 3. B | GO:1905289 | regulation of CAMKK-AMPK signaling cascade |
| 3. B | GO:0060603 | mammary gland duct morphogenesis |
| 3. B | GO:0090263 | positive regulation of canonical Wnt signaling pathway |
| 3. B | GO:0051058 | negative regulation of small GTPase mediated signal transduction |
| 3. B | GO:0030517 | negative regulation of axon extension |
| 3. B | GO:0071504 | cellular response to heparin |
| 3. B | GO:0140426 | PAMP-triggered immunity signalling pathway |
| 3. B | GO:0043237 | laminin-1 binding |
| 3. B | GO:0035308 | negative regulation of protein dephosphorylation |
| 3. B | GO:0007190 | activation of adenylate cyclase activity |
| 3. B | GO:0090260 | negative regulation of retinal ganglion cell axon guidance |
| 3. B | GO:1900244 | positive regulation of synaptic vesicle endocytosis |
| 3. B | GO:0035751 | regulation of lysosomal lumen pH |
| 3. B | GO:0043194 | axon initial segment |
| 3. B | GO:0046849 | bone remodeling |
| 3. B | GO:0071896 | protein localization to adherens junction |
| 3. B | GO:0046777 | protein autophosphorylation |
| 3. B | GO:0001942 | hair follicle development |
| 3. B | GO:0048846 | axon extension involved in axon guidance |
| 3. B | GO:0034702 | ion channel complex |
| 3. B | GO:0034144 | negative regulation of toll-like receptor 4 signaling pathway |
| 3. B | GO:0009626 | plant-type hypersensitive response |
| 3. B | GO:0060866 | leaf abscission |
| 3. B | GO:0016020 | membrane |
| 3. B | GO:0006977 | DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest |
| 3. B | GO:0016323 | basolateral plasma membrane |
| 3. B | GO:0097487 | multivesicular body, internal vesicle |
| 3. B | GO:0070433 | negative regulation of nucleotide-binding oligomerization domain containing 2 signaling pathway |
| 3. B | GO:0010234 | anther wall tapetum cell fate specification |
| 3. B | GO:0060384 | innervation |
| 3. B | GO:0035564 | regulation of kidney size |
| 3. B | GO:0004674 | protein serine/threonine kinase activity |
| 3. B | GO:0099059 | integral component of presynaptic active zone membrane |
| 3. B | GO:0048657 | anther wall tapetum cell differentiation |
| 3. B | GO:0005520 | insulin-like growth factor binding |
| 3. B | GO:1904713 | beta-catenin destruction complex binding |
| 3. B | GO:0021772 | olfactory bulb development |
| 3. B | GO:0045089 | positive regulation of innate immune response |
| 3. B | GO:0098742 | cell-cell adhesion via plasma-membrane adhesion molecules |
| 3. B | GO:0061303 | cornea development in camera-type eye |
| 3. B | GO:1902025 | nitrate import |
| 3. B | GO:0021747 | cochlear nucleus development |
| 3. B | GO:1905576 | ganglioside GT1b binding |
| 3. B | GO:0071638 | negative regulation of monocyte chemotactic protein-1 production |
| 3. B | GO:0010059 | positive regulation of atrichoblast fate specification |
| 3. B | GO:0032870 | cellular response to hormone stimulus |
| 3. B | GO:0034166 | toll-like receptor 10 signaling pathway |
| 3. B | GO:0046755 | viral budding |
| 3. B | GO:0090394 | negative regulation of excitatory postsynaptic potential |
| 3. B | GO:1990909 | Wnt signalosome |
| 3. B | GO:0031150 | sorocarp stalk development |
| 3. B | GO:0003180 | aortic valve morphogenesis |
| 3. B | GO:0021756 | striatum development |
| 3. B | GO:0015810 | aspartate transmembrane transport |
| 3. B | GO:0008154 | actin polymerization or depolymerization |
| 3. B | GO:0042246 | tissue regeneration |
| 3. B | GO:2000172 | regulation of branching morphogenesis of a nerve |
| 3. B | GO:0035748 | myelin sheath abaxonal region |
| 3. B | GO:0060159 | regulation of dopamine receptor signaling pathway |
| 3. B | GO:0044754 | autolysosome |
| 3. B | GO:0036035 | osteoclast development |
| 3. B | GO:0048678 | response to axon injury |
| 3. B | GO:1990138 | neuron projection extension |
| 3. B | GO:0010087 | phloem or xylem histogenesis |
| 3. B | GO:0001678 | cellular glucose homeostasis |
| 3. B | GO:0005102 | signaling receptor binding |
| 3. B | GO:0045806 | negative regulation of endocytosis |
| 3. B | GO:0046330 | positive regulation of JNK cascade |
| 3. B | GO:0009505 | plant-type cell wall |
| 3. B | GO:0048478 | replication fork protection |
| 3. B | GO:0010051 | xylem and phloem pattern formation |
| 3. B | GO:0009945 | radial axis specification |
| 3. B | GO:0048539 | bone marrow development |
| 3. B | GO:0043068 | positive regulation of programmed cell death |
| 3. B | GO:0050807 | regulation of synapse organization |
| 3. B | GO:0099055 | integral component of postsynaptic membrane |
| 3. B | GO:0001530 | lipopolysaccharide binding |
| 3. B | GO:0042592 | homeostatic process |
| 3. B | GO:0051019 | mitogen-activated protein kinase binding |
| 3. B | GO:0046328 | regulation of JNK cascade |
| 3. B | GO:1905421 | regulation of plant organ morphogenesis |
| 3. B | GO:0036479 | peroxidase inhibitor activity |
| 3. B | GO:0050832 | defense response to fungus |
| 3. B | GO:0097708 | intracellular vesicle |
| 3. B | GO:0090708 | specification of plant organ axis polarity |
| 3. B | GO:0043113 | receptor clustering |
| 3. B | GO:0000289 | nuclear-transcribed mRNA poly(A) tail shortening |
| 3. B | GO:0034214 | protein hexamerization |
| 3. B | GO:0098656 | anion transmembrane transport |
| 3. B | GO:0046696 | lipopolysaccharide receptor complex |
| 3. B | GO:0005618 | cell wall |
| 3. B | GO:0001875 | lipopolysaccharide immune receptor activity |
| 3. B | GO:0090027 | negative regulation of monocyte chemotaxis |
| 3. B | GO:0021562 | vestibulocochlear nerve development |
| 3. B | GO:1903125 | negative regulation of thioredoxin peroxidase activity by peptidyl-threonine phosphorylation |
| 3. B | GO:0005925 | focal adhesion |
| 3. B | GO:0048679 | regulation of axon regeneration |
| 3. B | GO:1901528 | hydrogen peroxide mediated signaling pathway involved in stomatal movement |
| 3. B | GO:1903215 | negative regulation of protein targeting to mitochondrion |
| 3. B | GO:0006820 | anion transport |
| 3. B | GO:0030199 | collagen fibril organization |
| 3. B | GO:0016525 | negative regulation of angiogenesis |
| 3. B | GO:0051016 | barbed-end actin filament capping |
| 3. B | GO:0007189 | adenylate cyclase-activating G protein-coupled receptor signaling pathway |
| 3. B | GO:0000164 | protein phosphatase type 1 complex |
| 3. B | GO:1902823 | negative regulation of late endosome to lysosome transport |
| 3. B | GO:0010074 | maintenance of meristem identity |
| 3. B | GO:0035239 | tube morphogenesis |
| 3. B | GO:1901224 | positive regulation of NIK/NF-kappaB signaling |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | A4IHG1 | Leucine-rich repeat-containing protein 58 | 0.00e+00 | 8.63e-65 | 1.54e-151 |
| 1. PB | O08770 | Platelet glycoprotein V | 2.10e-04 | 1.70e-07 | 9.32e-07 |
| 1. PB | Q7L985 | Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 | 7.27e-04 | 1.35e-05 | 6.63e-04 |
| 1. PB | Q32NT4 | Leucine-rich repeat-containing protein 58 | 0.00e+00 | 8.63e-65 | 2.74e-153 |
| 1. PB | Q9D1G5 | Leucine-rich repeat-containing protein 57 | 1.34e-10 | 4.65e-05 | 8.67e-14 |
| 1. PB | Q8BGA3 | Leucine-rich repeat transmembrane neuronal protein 2 | 2.37e-06 | 8.83e-04 | 4.68e-10 |
| 1. PB | Q8N456 | Leucine-rich repeat-containing protein 18 | 5.37e-06 | 2.72e-18 | 6.17e-10 |
| 1. PB | Q9CQ76 | Nephrocan | 6.37e-07 | 9.96e-06 | 5.80e-06 |
| 1. PB | Q9D9Q0 | Leucine-rich repeat-containing protein 69 | 1.75e-10 | 1.13e-37 | 1.61e-15 |
| 1. PB | C0LGP4 | Probable LRR receptor-like serine/threonine-protein kinase At3g47570 | 2.26e-03 | 3.10e-02 | 9.19e-08 |
| 1. PB | O93233 | Phospholipase A2 inhibitor | 1.08e-07 | 4.36e-04 | 1.08e-06 |
| 1. PB | Q80VQ1 | Leucine-rich repeat-containing protein 1 | 6.67e-06 | 1.86e-07 | 3.59e-14 |
| 1. PB | Q5G5D8 | Plant intracellular Ras-group-related LRR protein 7 | 1.17e-07 | 3.12e-11 | 1.24e-10 |
| 1. PB | A1A4H9 | Leucine-rich repeat transmembrane neuronal protein 1 | 2.57e-05 | 8.23e-05 | 3.66e-08 |
| 1. PB | A6NM36 | Leucine-rich repeat-containing protein 30 | 5.77e-12 | 1.37e-02 | 8.69e-13 |
| 1. PB | Q86UN2 | Reticulon-4 receptor-like 1 | 2.60e-05 | 3.23e-02 | 0.001 |
| 1. PB | Q9DBB9 | Carboxypeptidase N subunit 2 | 3.23e-05 | 2.84e-06 | 4.09e-11 |
| 1. PB | Q8R2R5 | Leucine-rich repeat-containing protein 61 | 1.80e-03 | 3.66e-08 | 6.64e-04 |
| 1. PB | Q8CI70 | Leucine-rich repeat-containing protein 20 | 6.97e-06 | 1.04e-03 | 4.43e-05 |
| 1. PB | Q96L50 | Leucine-rich repeat protein 1 | 1.56e-07 | 2.16e-03 | 4.92e-17 |
| 1. PB | Q5E9C0 | Ras suppressor protein 1 | 1.34e-08 | 1.76e-12 | 2.11e-16 |
| 1. PB | Q9BV99 | Leucine-rich repeat-containing protein 61 | 8.93e-04 | 5.56e-08 | 0.003 |
| 1. PB | O43300 | Leucine-rich repeat transmembrane neuronal protein 2 | 6.42e-05 | 1.09e-04 | 1.24e-09 |
| 1. PB | Q9Z0L0 | Trophoblast glycoprotein | 5.70e-05 | 7.58e-04 | 0.025 |
| 1. PB | Q9CQ07 | Leucine-rich repeat-containing protein 18 | 9.70e-06 | 9.07e-19 | 7.81e-11 |
| 1. PB | F1R6I3 | Leucine-rich repeat-containing protein 39 | 1.58e-10 | 1.70e-04 | 5.21e-17 |
| 1. PB | Q8TF66 | Leucine-rich repeat-containing protein 15 | 3.25e-05 | 1.20e-03 | 1.67e-07 |
| 1. PB | Q6DHL5 | Leucine-rich repeat-containing protein 57 | 8.01e-11 | 1.22e-03 | 1.80e-18 |
| 1. PB | O15335 | Chondroadherin | 7.79e-07 | 7.67e-03 | 0.006 |
| 1. PB | P90920 | Leucine-rich repeat-containing protein egg-6 | 7.98e-04 | 3.33e-02 | 1.64e-06 |
| 1. PB | P70389 | Insulin-like growth factor-binding protein complex acid labile subunit | 1.63e-05 | 4.82e-02 | 2.22e-07 |
| 1. PB | Q9SVM3 | Receptor-like protein 49 | 4.81e-03 | 4.91e-02 | 3.10e-04 |
| 1. PB | Q86UE6 | Leucine-rich repeat transmembrane neuronal protein 1 | 3.29e-05 | 5.41e-05 | 4.49e-09 |
| 1. PB | Q3KQF4 | Leucine-rich repeat-containing protein 69 | 7.51e-11 | 7.56e-38 | 1.31e-16 |
| 1. PB | D3ZAL8 | Leucine-rich repeat transmembrane neuronal protein 3 | 9.28e-05 | 1.63e-02 | 2.40e-08 |
| 1. PB | Q9BTT6 | Leucine-rich repeat-containing protein 1 | 2.57e-05 | 4.40e-07 | 2.06e-14 |
| 1. PB | Q24K06 | Leucine-rich repeat-containing protein 10 | 1.43e-11 | 3.73e-13 | 3.74e-14 |
| 1. PB | Q5R6B1 | Leucine-rich repeat transmembrane neuronal protein 1 | 2.00e-05 | 5.16e-05 | 2.80e-09 |
| 1. PB | Q9NR96 | Toll-like receptor 9 | 5.82e-03 | 6.78e-03 | 0.008 |
| 1. PB | Q9LUI1 | Leucine-rich repeat extensin-like protein 6 | 1.02e-04 | 3.27e-03 | 0.005 |
| 1. PB | D4A7P2 | Leucine-rich repeat transmembrane neuronal protein 2 | 2.18e-05 | 7.49e-04 | 7.53e-11 |
| 1. PB | O70210 | Chondroadherin | 5.64e-07 | 3.39e-02 | 0.006 |
| 1. PB | P40197 | Platelet glycoprotein V | 6.98e-05 | 1.59e-07 | 1.36e-05 |
| 1. PB | O15455 | Toll-like receptor 3 | 1.01e-04 | 9.13e-03 | 8.13e-05 |
| 1. PB | Q14392 | Transforming growth factor beta activator LRRC32 | 1.11e-08 | 5.74e-03 | 0.006 |
| 1. PB | Q9C9H7 | Receptor-like protein 12 | 3.02e-07 | 6.78e-03 | 4.85e-08 |
| 1. PB | D4A6D8 | Leucine-rich repeat transmembrane neuronal protein 1 | 2.74e-05 | 1.29e-04 | 5.48e-08 |
| 1. PB | Q86VH5 | Leucine-rich repeat transmembrane neuronal protein 3 | 5.85e-05 | 4.96e-02 | 0.046 |
| 1. PB | Q8R5M3 | Leucine-rich repeat-containing protein 15 | 1.44e-04 | 2.18e-03 | 1.27e-08 |
| 1. PB | Q27972 | Chondroadherin | NA | 3.00e-03 | 0.005 |
| 1. PB | G9LZD7 | Probable inactive leucine-rich repeat receptor kinase XIAO | 5.02e-03 | 2.26e-02 | 2.00e-12 |
| 1. PB | Q9C9H6 | Receptor-like protein 11 | 2.36e-05 | 6.78e-03 | 1.23e-05 |
| 1. PB | Q15404 | Ras suppressor protein 1 | 1.24e-08 | 2.86e-14 | 2.49e-16 |
| 1. PB | Q7Z2Q7 | Leucine-rich repeat-containing protein 70 | 1.14e-04 | 1.28e-02 | 4.63e-06 |
| 1. PB | Q9Z1S7 | Osteomodulin | 1.52e-06 | 2.51e-06 | 4.59e-08 |
| 1. PB | Q149C3 | Leucine-rich repeat and immunoglobulin-like domain containing-NOGO receptor-interacting protein 4 | 3.06e-04 | 1.29e-07 | 0.045 |
| 1. PB | D3ZXS4 | Leucine-rich repeat-containing protein 39 | 1.00e-09 | 3.41e-04 | 2.78e-16 |
| 1. PB | Q505F5 | Leucine-rich repeat-containing protein 47 | 2.98e-04 | 4.73e-02 | 7.56e-17 |
| 1. PB | P18009 | Probable E3 ubiquitin-protein ligase ipaH4.5 | 2.71e-04 | 2.77e-06 | 1.09e-04 |
| 1. PB | Q63912 | Oligodendrocyte-myelin glycoprotein | 6.05e-06 | 8.41e-03 | 2.88e-12 |
| 1. PB | Q7XNY1 | Plant intracellular Ras-group-related LRR protein 1 | 6.37e-10 | 3.12e-16 | 2.58e-12 |
| 1. PB | Q3URE9 | Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 | 3.96e-04 | 1.03e-05 | 0.001 |
| 1. PB | B9F655 | Plant intracellular Ras-group-related LRR protein 7 | 1.37e-11 | 5.98e-09 | 3.31e-13 |
| 1. PB | Q01730 | Ras suppressor protein 1 | 1.26e-08 | 7.78e-14 | 1.40e-15 |
| 1. PB | Q6ZVD8 | PH domain leucine-rich repeat-containing protein phosphatase 2 | 1.20e-03 | 3.55e-05 | 8.40e-11 |
| 1. PB | Q9U3A0 | P-granule-associated novel protein 1 | 3.89e-05 | 2.97e-05 | 0.005 |
| 1. PB | P18014 | Probable E3 ubiquitin-protein ligase ipaH7.8 | 2.30e-04 | 4.61e-04 | 4.24e-04 |
| 1. PB | Q5FVI3 | Leucine-rich repeat-containing protein 57 | 1.74e-10 | 2.38e-04 | 6.13e-15 |
| 1. PB | Q8BZ81 | Leucine-rich repeat transmembrane neuronal protein 3 | 7.66e-05 | 1.29e-02 | 2.17e-08 |
| 1. PB | A6NIK2 | Leucine-rich repeat-containing protein 10B | 9.57e-09 | 1.68e-11 | 3.50e-15 |
| 1. PB | Q99983 | Osteomodulin | 5.64e-07 | 8.23e-05 | 1.61e-04 |
| 1. PB | Q8N9N7 | Leucine-rich repeat-containing protein 57 | 1.60e-10 | 1.66e-04 | 3.57e-14 |
| 1. PB | Q8K377 | Leucine-rich repeat transmembrane neuronal protein 1 | 1.09e-04 | 1.02e-04 | 9.32e-08 |
| 1. PB | Q96DD0 | Leucine-rich repeat-containing protein 39 | 3.13e-08 | 3.85e-05 | 6.14e-15 |
| 1. PB | P08953 | Protein toll | 8.75e-03 | 4.42e-02 | 0.006 |
| 1. PB | O64566 | Plant intracellular Ras-group-related LRR protein 6 | 8.28e-10 | 4.08e-08 | 2.38e-14 |
| 1. PB | Q8K3W2 | Leucine-rich repeat-containing protein 10 | 8.99e-12 | 1.58e-11 | 1.10e-09 |
| 1. PB | Q9GZU5 | Nyctalopin | 1.33e-05 | 9.58e-09 | 3.32e-04 |
| 1. PB | Q80XG9 | Leucine-rich repeat transmembrane neuronal protein 4 | 8.03e-05 | 1.59e-02 | 1.50e-06 |
| 1. PB | O77742 | Osteomodulin | 5.30e-06 | 1.19e-04 | 1.47e-04 |
| 1. PB | Q66HD6 | Leucine-rich repeat-containing protein 18 | 1.64e-06 | 2.01e-17 | 5.04e-10 |
| 1. PB | Q6INV3 | Leucine-rich repeat-containing protein 57 | 7.99e-11 | 3.90e-05 | 1.09e-17 |
| 1. PB | Q8BGI7 | Leucine-rich repeat-containing protein 39 | 7.26e-09 | 2.46e-04 | 3.90e-15 |
| 1. PB | O08742 | Platelet glycoprotein V | 1.66e-04 | 2.26e-07 | 3.53e-07 |
| 1. PB | Q8TCA0 | Leucine-rich repeat-containing protein 20 | 2.48e-06 | 7.74e-04 | 1.14e-06 |
| 1. PB | Q80X72 | Leucine-rich repeat-containing protein 15 | 1.14e-04 | 8.33e-03 | 8.89e-10 |
| 1. PB | Q2I0M4 | Leucine-rich repeat-containing protein 26 | 2.76e-05 | 2.39e-07 | 0.003 |
| 1. PB | Q80WD0 | Reticulon-4 receptor-like 1 | 4.47e-05 | 5.88e-04 | 4.41e-04 |
| 1. PB | C0STK7 | Phospholipase A2 inhibitor beta | NA | 1.58e-03 | 2.23e-05 |
| 1. PB | Q91W20 | Leucine-rich repeat-containing protein 26 | 5.21e-05 | 1.70e-06 | 0.014 |
| 1. PB | P58682 | Toll-like receptor 8 | 6.83e-04 | 2.96e-02 | 0.017 |
| 1. PB | Q8RWE5 | Plant intracellular Ras-group-related LRR protein 8 | 1.19e-07 | 5.17e-14 | 3.37e-11 |
| 1. PB | Q9SSD1 | Protein TOO MANY MOUTHS | 8.40e-05 | 1.07e-02 | 8.36e-13 |
| 1. PB | Q86X40 | Leucine-rich repeat-containing protein 28 | 1.63e-10 | 2.48e-26 | 5.73e-10 |
| 1. PB | Q5BKY1 | Leucine-rich repeat-containing protein 10 | 2.88e-10 | 1.36e-11 | 1.97e-13 |
| 1. PB | Q2T9T5 | Leucine-rich repeat-containing protein 61 | 9.14e-04 | 6.32e-09 | 0.007 |
| 1. PB | Q9SVN2 | Receptor-like protein 47 | 4.51e-04 | 2.68e-02 | 6.58e-07 |
| 1. PB | Q3TX51 | Leucine-rich repeat-containing protein 28 | 2.09e-10 | 1.10e-28 | 3.92e-11 |
| 1. PB | O35103 | Osteomodulin | 1.77e-06 | 5.48e-05 | 1.03e-05 |
| 1. PB | P22792 | Carboxypeptidase N subunit 2 | 7.70e-05 | 5.28e-06 | 3.29e-09 |
| 1. PB | Q65Z91 | Tsukushi | 1.04e-05 | 6.86e-04 | 0.002 |
| 1. PB | Q8BXA7 | PH domain leucine-rich repeat-containing protein phosphatase 2 | 1.12e-03 | 3.42e-06 | 2.91e-08 |
| 1. PB | Q3UGP9 | Leucine-rich repeat-containing protein 58 | 0.00e+00 | 4.24e-126 | 0.0 |
| 1. PB | Q8K0S5 | Reticulon-4 receptor-like 1 | 5.01e-05 | 5.21e-04 | 1.38e-04 |
| 1. PB | Q5RF01 | Transforming growth factor beta activator LRRC32 | 1.08e-08 | 9.41e-03 | 0.014 |
| 1. PB | Q3ZC49 | Leucine-rich repeat-containing protein 39 | 2.15e-08 | 5.94e-05 | 3.94e-15 |
| 1. PB | Q5PQV5 | Trophoblast glycoprotein | 7.58e-05 | 3.81e-05 | 0.005 |
| 1. PB | Q6GLE8 | Leucine-rich repeat-containing protein 28 | 3.79e-10 | 6.02e-26 | 1.45e-14 |
| 1. PB | Q9CXD9 | Leucine-rich repeat-containing protein 17 | 8.08e-05 | 2.28e-03 | 8.77e-05 |
| 1. PB | Q7KIN0 | Toll-like receptor 7 | 3.74e-05 | 1.64e-02 | 8.28e-08 |
| 1. PB | Q9VUN0 | Toll-like receptor 6 | 9.88e-03 | 8.55e-04 | 2.90e-08 |
| 1. PB | Q5TJ59 | Toll-like receptor 3 | 1.06e-04 | 1.66e-02 | 8.12e-07 |
| 1. PB | B4F7C5 | Leucine-rich repeat transmembrane neuronal protein 4 | 2.24e-05 | 7.36e-03 | 1.39e-06 |
| 1. PB | Q96CX6 | Leucine-rich repeat-containing protein 58 | 0 | 1.93e-163 | 0.0 |
| 1. PB | Q6ZNQ3 | Leucine-rich repeat-containing protein 69 | 2.21e-10 | 7.36e-37 | 1.44e-08 |
| 1. PB | Q9MA83 | Receptor-like protein 30 | 3.70e-05 | 4.13e-02 | 3.32e-08 |
| 1. PB | Q9BGP6 | Leucine-rich repeat transmembrane neuronal protein 3 | 6.44e-05 | 4.96e-02 | 0.046 |
| 1. PB | Q86VH4 | Leucine-rich repeat transmembrane neuronal protein 4 | 9.61e-05 | 2.45e-02 | 1.96e-06 |
| 1. PB | Q32KX5 | Leucine-rich repeat-containing protein 28 | 2.42e-10 | 8.87e-25 | 2.64e-08 |
| 2. P | Q5RDJ4 | Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 | 5.29e-04 | 9.26e-06 | NA |
| 2. P | G3XA59 | Transforming growth factor beta activator LRRC32 | 1.29e-08 | 9.22e-03 | NA |
| 2. P | Q92688 | Acidic leucine-rich nuclear phosphoprotein 32 family member B | 2.43e-03 | 5.74e-03 | NA |
| 2. P | Q65YW8 | Tsukushi-A | 1.26e-07 | 2.76e-04 | NA |
| 2. P | Q9XHH2 | Dynein axonemal light chain 1 | 1.62e-05 | 4.77e-04 | NA |
| 2. P | Q6QMY6 | Tsukushi | 7.99e-06 | 1.89e-02 | NA |
| 2. P | P83503 | Nyctalopin | 5.55e-06 | 1.07e-09 | NA |
| 2. P | P25380 | Sporulation-specific protein 22 | 3.25e-02 | 3.30e-03 | NA |
| 2. P | Q7Z4L9 | Protein phosphatase 1 regulatory subunit 42 | 7.63e-07 | 1.35e-06 | NA |
| 2. P | Q4KLL3 | Leucine-rich repeat-containing protein 55 | 1.53e-06 | 1.39e-03 | NA |
| 2. P | Q6FV04 | U2 small nuclear ribonucleoprotein A' | 4.16e-03 | 2.24e-06 | NA |
| 2. P | O01615 | Acidic leucine-rich nuclear phosphoprotein 32-related protein 2 | 5.00e-05 | 7.44e-06 | NA |
| 2. P | Q5F4A3 | Acidic leucine-rich nuclear phosphoprotein 32 family member E | 6.73e-03 | 1.07e-02 | NA |
| 2. P | Q3SZC6 | Acidic leucine-rich nuclear phosphoprotein 32 family member B | 5.77e-04 | 3.07e-02 | NA |
| 2. P | Q28XE2 | Acidic leucine-rich nuclear phosphoprotein 32 family member A | 4.12e-04 | 1.87e-02 | NA |
| 2. P | O35381 | Acidic leucine-rich nuclear phosphoprotein 32 family member A | 2.34e-03 | 3.55e-05 | NA |
| 2. P | O43423 | Acidic leucine-rich nuclear phosphoprotein 32 family member C | 1.21e-02 | 1.66e-02 | NA |
| 2. P | Q6GQN5 | Protein phosphatase 1 regulatory subunit 42 | 3.27e-05 | 2.06e-04 | NA |
| 2. P | Q66HV9 | Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1-B | 5.13e-04 | 6.81e-07 | NA |
| 2. P | Q7ZUP0 | Acidic leucine-rich nuclear phosphoprotein 32 family member A | 3.91e-04 | 1.99e-04 | NA |
| 2. P | Q9D1T0 | Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 | 5.56e-04 | 3.55e-06 | NA |
| 2. P | Q4P5F9 | U2 small nuclear ribonucleoprotein A' | 8.61e-03 | 1.39e-07 | NA |
| 2. P | Q2EEY0 | Toll-like receptor 9 | 5.72e-03 | 7.59e-05 | NA |
| 2. P | P49911 | Acidic leucine-rich nuclear phosphoprotein 32 family member A | 2.01e-03 | 1.56e-05 | NA |
| 2. P | O62220 | Acidic leucine-rich nuclear phosphoprotein 32-related protein 1 | 6.14e-03 | 5.29e-05 | NA |
| 2. P | Q5QJ74 | Tubulin-specific chaperone cofactor E-like protein | 1.46e-04 | 1.18e-04 | NA |
| 2. P | Q587K4 | Leucine-rich repeat-containing protein 73 | 1.67e-04 | 3.38e-04 | NA |
| 2. P | Q5I2M4 | Toll-like receptor 9 | 7.90e-03 | 3.81e-05 | NA |
| 2. P | Q86UN3 | Reticulon-4 receptor-like 2 | 1.05e-05 | 1.75e-03 | NA |
| 2. P | Q9V895 | Acidic leucine-rich nuclear phosphoprotein 32 family member A | 1.11e-02 | 2.82e-04 | NA |
| 2. P | Q5I2M7 | Toll-like receptor 9 | 2.79e-03 | 1.97e-04 | NA |
| 2. P | Q13641 | Trophoblast glycoprotein | 5.62e-05 | 1.94e-04 | NA |
| 2. P | Q8ZQQ2 | E3 ubiquitin-protein ligase SlrP | 3.84e-04 | 3.89e-02 | NA |
| 2. P | Q6P7C4 | Leucine-rich repeat-containing protein 26 | 5.79e-05 | 5.87e-05 | NA |
| 2. P | Q9N008 | Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 | 2.84e-04 | 6.42e-06 | NA |
| 2. P | Q01819 | Connectin | 1.31e-04 | 2.48e-05 | NA |
| 2. P | Q7M6Z0 | Reticulon-4 receptor-like 2 | 2.23e-05 | 8.45e-04 | NA |
| 2. P | Q5ZMN0 | Acidic leucine-rich nuclear phosphoprotein 32 family member B | 2.19e-03 | 8.16e-03 | NA |
| 2. P | P59034 | Leucine-rich repeat-containing protein 3 | 7.86e-03 | 8.85e-03 | NA |
| 2. P | Q6C417 | U2 small nuclear ribonucleoprotein A' | 2.78e-03 | 3.94e-05 | NA |
| 2. P | A2VDH3 | Leucine-rich repeat-containing protein 38 | 3.35e-05 | 1.38e-03 | NA |
| 2. P | P0C6S8 | Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3 | 7.36e-05 | 4.81e-07 | NA |
| 2. P | Q8C5W3 | Tubulin-specific chaperone cofactor E-like protein | 2.20e-04 | 5.41e-05 | NA |
| 2. P | Q9D9B4 | Leucine-rich melanocyte differentiation-associated protein | 6.28e-03 | 6.22e-04 | NA |
| 2. P | Q8HY67 | Acidic leucine-rich nuclear phosphoprotein 32 family member A | NA | 7.17e-06 | NA |
| 2. P | B6CZ45 | Leucine-rich repeat-containing protein 51 | 1.46e-03 | 1.57e-03 | NA |
| 2. P | A6H759 | Leucine-rich repeat-containing protein 72 | 1.83e-03 | 4.55e-06 | NA |
| 2. P | P59035 | Leucine-rich repeat-containing protein 3 | 3.07e-03 | 1.50e-02 | NA |
| 2. P | P09661 | U2 small nuclear ribonucleoprotein A' | 1.99e-03 | 8.00e-10 | NA |
| 2. P | Q08963 | U2 small nuclear ribonucleoprotein A' | 2.88e-03 | 1.43e-08 | NA |
| 2. P | Q7ZY40 | Acidic leucine-rich nuclear phosphoprotein 32 family member E | 6.27e-03 | 3.00e-05 | NA |
| 2. P | Q8BMT4 | Transforming growth factor beta activator LRRC33 | 1.11e-03 | 3.94e-05 | NA |
| 2. P | Q9USX8 | U2 small nuclear ribonucleoprotein A' | 7.52e-04 | 3.09e-04 | NA |
| 2. P | P97822 | Acidic leucine-rich nuclear phosphoprotein 32 family member E | 2.38e-03 | 3.45e-04 | NA |
| 2. P | P39687 | Acidic leucine-rich nuclear phosphoprotein 32 family member A | 2.36e-03 | 2.54e-05 | NA |
| 2. P | B6CZ54 | Leucine-rich repeat-containing protein 51 | 3.88e-03 | 1.57e-03 | NA |
| 2. P | Q4R8Y9 | Trophoblast glycoprotein | 7.16e-05 | 1.53e-03 | NA |
| 2. P | Q4R803 | Protein phosphatase 1 regulatory subunit 42 | 2.43e-04 | 8.97e-10 | NA |
| 2. P | Q5PPX0 | Protein phosphatase 1 regulatory subunit 42 | 6.80e-05 | 8.30e-06 | NA |
| 2. P | Q4V8D9 | Leucine-rich repeat-containing protein 34 | 5.64e-05 | 1.14e-02 | NA |
| 2. P | Q2KID4 | Dynein axonemal light chain 1 | 1.57e-05 | 8.04e-05 | NA |
| 2. P | Q5AGC4 | Cell surface GPI-anchored protein ECM33 | 5.91e-03 | 4.91e-02 | NA |
| 2. P | Q8CBR6 | Tsukushi | 5.33e-07 | 1.19e-02 | NA |
| 2. P | Q6NUW5 | Acidic leucine-rich nuclear phosphoprotein 32 family member E | 2.42e-05 | 2.89e-04 | NA |
| 2. P | Q4LDG9 | Dynein axonemal light chain 1 | 1.69e-05 | 1.50e-05 | NA |
| 2. P | Q86YC3 | Transforming growth factor beta activator LRRC33 | 4.82e-04 | 5.69e-04 | NA |
| 2. P | P11745 | Ran GTPase-activating protein 1 | 3.62e-07 | 2.94e-03 | NA |
| 2. P | Q6GQU6 | Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3 | 2.38e-04 | 1.05e-06 | NA |
| 2. P | Q641R9 | Dynein axonemal light chain 1 | 1.32e-05 | 3.19e-04 | NA |
| 2. P | Q5BGW9 | U2 small nuclear ribonucleoprotein A' | 1.46e-02 | 4.55e-02 | NA |
| 2. P | D0ZRB2 | E3 ubiquitin-protein ligase SlrP | 5.05e-04 | 4.68e-02 | NA |
| 2. P | P43333 | U2 small nuclear ribonucleoprotein A' | 1.29e-03 | 8.47e-07 | NA |
| 2. P | Q8WUA8 | Tsukushi | 7.15e-07 | 1.71e-02 | NA |
| 2. P | Q6PAF6 | Acidic leucine-rich nuclear phosphoprotein 32 family member A | 1.89e-03 | 1.32e-06 | NA |
| 2. P | Q7S9P4 | U2 small nuclear ribonucleoprotein A' | 1.08e-03 | 4.59e-05 | NA |
| 2. P | Q8N7C0 | Leucine-rich repeat-containing protein 52 | 1.38e-05 | 5.15e-06 | NA |
| 2. P | Q9EST5 | Acidic leucine-rich nuclear phosphoprotein 32 family member B | 2.29e-05 | 2.09e-02 | NA |
| 2. P | Q9BTT0 | Acidic leucine-rich nuclear phosphoprotein 32 family member E | 1.01e-02 | 2.62e-03 | NA |
| 2. P | Q6BT60 | U2 small nuclear ribonucleoprotein A' | 6.36e-03 | 6.19e-06 | NA |
| 2. P | Q96FE5 | Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 | 1.35e-04 | 9.14e-07 | NA |
| 2. P | Q5I2M8 | Toll-like receptor 9 | 2.59e-03 | 7.17e-04 | NA |
| 2. P | Q9BLB6 | Probable U2 small nuclear ribonucleoprotein A' | 1.95e-03 | 3.09e-09 | NA |
| 2. P | Q5M8M9 | Leucine-rich repeat-containing protein 52 | 3.91e-05 | 9.43e-04 | NA |
| 2. P | P0DKB5 | Trophoblast glycoprotein-like | 1.16e-03 | 2.01e-03 | NA |
| 2. P | Q28G94 | Dynein axonemal light chain 1 | 1.47e-05 | 3.41e-04 | NA |
| 2. P | Q3ZBI5 | Transforming growth factor beta activator LRRC33 | 1.82e-03 | 1.17e-03 | NA |
| 2. P | Q4WV66 | U2 small nuclear ribonucleoprotein A' | 3.18e-03 | 8.83e-04 | NA |
| 2. P | P57784 | U2 small nuclear ribonucleoprotein A' | 3.69e-03 | 1.46e-09 | NA |
| 2. P | Q9V4Q8 | Probable U2 small nuclear ribonucleoprotein A' | 1.78e-03 | 1.45e-08 | NA |
| 2. P | Q5VT99 | Leucine-rich repeat-containing protein 38 | 1.09e-05 | 6.92e-03 | NA |
| 2. P | Q6A1I3 | Acidic leucine-rich nuclear phosphoprotein 32 family member B | 4.61e-03 | 1.24e-02 | NA |
| 2. P | Q3UY51 | Leucine-rich repeat-containing protein 55 | 1.64e-06 | 1.03e-03 | NA |
| 2. P | Q6P1U7 | Acidic leucine-rich nuclear phosphoprotein 32 family member B | 2.66e-04 | 8.64e-04 | NA |
| 2. P | Q83RJ4 | E3 ubiquitin-protein ligase ipaH3 | 1.43e-04 | 4.09e-02 | NA |
| 2. P | Q3U3V8 | X-ray radiation resistance-associated protein 1 | 2.16e-02 | 9.41e-03 | NA |
| 2. P | Q5EAD8 | Leucine-rich repeat-containing protein 51 | 1.08e-03 | 7.83e-03 | NA |
| 2. P | Q8C013 | Trophoblast glycoprotein-like | 2.65e-03 | 4.51e-04 | NA |
| 2. P | Q6AXZ2 | Leucine-rich repeat-containing protein 46 | 4.00e-03 | 2.63e-02 | NA |
| 2. P | Q5I2M3 | Toll-like receptor 9 | 1.17e-02 | 4.51e-04 | NA |
| 2. P | Q6DHB1 | Dynein axonemal light chain 1 | 1.22e-05 | 2.46e-04 | NA |
| 2. P | P71451 | Internalin C | 6.28e-05 | 2.85e-03 | NA |
| 2. P | Q8ILI6 | Acidic leucine-rich nuclear phosphoprotein 32-related protein | 2.22e-03 | 1.73e-03 | NA |
| 2. P | Q5XIE0 | Acidic leucine-rich nuclear phosphoprotein 32 family member E | 7.11e-04 | 1.55e-04 | NA |
| 2. P | Q5JTD7 | Leucine-rich repeat-containing protein 73 | 4.57e-05 | 6.57e-04 | NA |
| 2. P | P46060 | Ran GTPase-activating protein 1 | 5.48e-04 | 3.97e-02 | NA |
| 2. P | Q05A62 | Dynein axonemal light chain 1 | 1.78e-05 | 6.66e-06 | NA |
| 2. P | Q8R1Z4 | Protein phosphatase 1 regulatory subunit 42 | 1.79e-05 | 1.19e-06 | NA |
| 2. P | A0A096MJZ0 | Dynein axonemal light chain 1 | 1.76e-05 | 1.52e-05 | NA |
| 2. P | Q5M7S9 | Tsukushi | 1.50e-07 | 4.25e-02 | NA |
| 2. P | Q6UY18 | Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 4 | 3.55e-04 | 8.75e-08 | NA |
| 2. P | Q8BKR5 | Protein phosphatase 1 regulatory subunit 37 | 1.46e-03 | 2.40e-02 | NA |
| 2. P | P51122 | Acidic leucine-rich nuclear phosphoprotein 32 family member A | 2.46e-03 | 8.40e-06 | NA |
| 2. P | O13066 | Ran GTPase-activating protein 1 | 2.20e-03 | 4.37e-02 | NA |
| 2. P | Q5I2M5 | Toll-like receptor 9 | 7.64e-03 | 6.36e-04 | NA |
| 2. P | Q8T888 | Dynein axonemal light chain 1 | 1.61e-05 | 5.02e-03 | NA |
| 2. P | A6H793 | Leucine-rich repeat-containing protein 3 | 2.39e-03 | 3.33e-02 | NA |
| 2. P | B6CZ61 | Leucine-rich repeat-containing protein 51 | 9.55e-04 | 3.60e-02 | NA |
| 2. P | Q96E66 | Leucine-rich repeat-containing protein 51 | 1.40e-03 | 1.41e-04 | NA |
| 2. P | Q755D2 | U2 small nuclear ribonucleoprotein A' | 4.67e-03 | 1.49e-08 | NA |
| 2. P | Q8AVC1 | Acidic leucine-rich nuclear phosphoprotein 32 family member B | 3.39e-04 | 2.79e-03 | NA |
| 2. P | Q7Y180 | Acidic leucine-rich nuclear phosphoprotein 32-related protein 2 | 9.28e-05 | 9.13e-03 | NA |
| 2. P | A6NJI9 | Leucine-rich repeat-containing protein 72 | 2.34e-03 | 5.20e-08 | NA |
| 2. P | Q4R8Y8 | U2 small nuclear ribonucleoprotein A' | 1.43e-03 | 8.00e-10 | NA |
| 2. P | Q6AXL3 | Transforming growth factor beta activator LRRC33 | 1.64e-03 | 2.73e-04 | NA |
| 2. P | Q5UQX3 | Putative leucine-rich repeat protein R380 | NA | 1.13e-06 | NA |
| 2. P | Q5A449 | U2 small nuclear ribonucleoprotein A' | 6.43e-04 | 1.67e-07 | NA |
| 2. P | Q5PQJ7 | Tubulin-specific chaperone cofactor E-like protein | 1.59e-04 | 5.80e-05 | NA |
| 2. P | Q6ZSA7 | Leucine-rich repeat-containing protein 55 | 1.74e-06 | 4.81e-03 | NA |
| 2. P | Q80WD1 | Reticulon-4 receptor-like 2 | 9.06e-06 | 4.67e-03 | NA |
| 2. P | Q9DAM1 | Leucine-rich repeat-containing protein 34 | 7.95e-05 | 1.24e-02 | NA |
| 2. P | O13960 | Cell wall protein ecm33 | 5.54e-03 | 1.33e-03 | NA |
| 2. P | B6CZ40 | Leucine-rich repeat-containing protein 51 | 1.44e-03 | 7.00e-06 | NA |
| 2. P | Q5BK65 | Transforming growth factor beta activator LRRC33 | 2.34e-04 | 1.69e-03 | NA |
| 2. P | A4IIW9 | Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 | 4.12e-04 | 1.06e-04 | NA |
| 2. P | Q50L44 | Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 | 2.38e-04 | 4.45e-07 | NA |
| 3. B | O43155 | Leucine-rich repeat transmembrane protein FLRT2 | 7.78e-05 | NA | 0.009 |
| 3. B | Q723X5 | Internalin I | 2.91e-02 | NA | 1.60e-07 |
| 3. B | O46379 | Lumican (Fragment) | 3.82e-13 | NA | 0.003 |
| 3. B | O75094 | Slit homolog 3 protein | 1.61e-02 | NA | 2.68e-04 |
| 3. B | Q08817 | Leucine-rich repeat-containing protein SOG2 | 3.18e-02 | NA | 4.41e-06 |
| 3. B | Q9BYS8 | Leucine-rich repeat-containing protein 2 | 1.61e-07 | NA | 1.52e-12 |
| 3. B | Q8LPB4 | Phytosulfokine receptor 1 | 1.98e-03 | NA | 7.71e-09 |
| 3. B | Q8AVI4 | Leucine-rich repeat protein SHOC-2 | 1.32e-11 | NA | 4.00e-16 |
| 3. B | Q8GRU6 | Leucine-rich repeat receptor-like kinase protein HAR1 | 8.97e-07 | NA | 1.15e-07 |
| 3. B | Q9VJ07 | Protein phosphatase PHLPP-like protein | 7.40e-04 | NA | 1.41e-06 |
| 3. B | B0BNK7 | Leucine-rich repeat and fibronectin type-III domain-containing protein 3 | 4.76e-04 | NA | 0.022 |
| 3. B | Q5RFE9 | Leucine-rich repeat-containing protein 40 | 2.45e-08 | NA | 1.16e-18 |
| 3. B | C0LGU1 | Probable LRR receptor-like serine/threonine-protein kinase At5g37450 | 7.59e-03 | NA | 3.13e-05 |
| 3. B | Q5S007 | Leucine-rich repeat serine/threonine-protein kinase 2 | 1.36e-01 | NA | 1.66e-07 |
| 3. B | Q9DE68 | Decorin | 9.75e-09 | NA | 0.025 |
| 3. B | Q5VUJ6 | Leucine-rich repeat and calponin homology domain-containing protein 2 | 6.28e-07 | NA | 2.02e-12 |
| 3. B | Q96RT1 | Erbin | 1.68e-03 | NA | 1.78e-13 |
| 3. B | Q2R2D5 | Receptor kinase-like protein Xa21 | 5.17e-03 | NA | 5.88e-06 |
| 3. B | Q6FRT2 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 8.90e-02 | NA | 9.48e-11 |
| 3. B | Q8L899 | Systemin receptor SR160 | 1.64e-02 | NA | 2.54e-07 |
| 3. B | Q3V1N1 | Malignant fibrous histiocytoma-amplified sequence 1 homolog | 2.55e-04 | NA | 3.25e-22 |
| 3. B | Q3UMG5 | Leucine-rich repeat and calponin homology domain-containing protein 2 | 7.98e-05 | NA | 2.68e-12 |
| 3. B | Q80YS5 | Leucine-rich repeat-containing protein 27 | 8.54e-03 | NA | 0.005 |
| 3. B | Q9XSD9 | Decorin | 1.24e-08 | NA | 0.003 |
| 3. B | Q9SHI2 | Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 | 8.84e-03 | NA | 6.92e-11 |
| 3. B | Q9LVP0 | Probable leucine-rich repeat receptor-like protein kinase At5g63930 | 1.92e-03 | NA | 5.54e-07 |
| 3. B | Q4H4B6 | Protein scribble homolog | 6.24e-03 | NA | 1.53e-16 |
| 3. B | Q6GPJ5 | Leucine-rich repeat-containing protein 40 | 3.06e-08 | NA | 5.27e-17 |
| 3. B | P13605 | Fibromodulin | 1.39e-10 | NA | 2.99e-04 |
| 3. B | B5DX45 | Leucine-rich repeat protein soc-2 homolog | 6.83e-11 | NA | 9.19e-20 |
| 3. B | C0LGE4 | Probable LRR receptor-like serine/threonine-protein kinase At1g12460 | 2.46e-03 | NA | 1.02e-07 |
| 3. B | C0LGE0 | Probable LRR receptor-like serine/threonine-protein kinase At1g07650 | 8.50e-03 | NA | 5.63e-05 |
| 3. B | O55226 | Chondroadherin | 5.74e-07 | NA | 0.003 |
| 3. B | Q3UHC2 | Leucine-rich repeat serine/threonine-protein kinase 1 | 4.43e-02 | NA | 1.85e-05 |
| 3. B | F4KIF3 | Disease resistance-like protein CSA1 | 5.36e-03 | NA | 5.36e-05 |
| 3. B | Q7Z5L7 | Podocan | 2.47e-07 | NA | 1.55e-05 |
| 3. B | Q9SKB2 | Leucine-rich repeat receptor-like serine/threonine/tyrosine-protein kinase SOBIR1 | 1.71e-02 | NA | 0.001 |
| 3. B | F4IUU1 | Receptor like protein 27 | 7.83e-03 | NA | 0.015 |
| 3. B | Q9NZU0 | Leucine-rich repeat transmembrane protein FLRT3 | 3.65e-05 | NA | 2.17e-07 |
| 3. B | Q9ASQ6 | Probable LRR receptor-like serine/threonine-protein kinase At1g29720 | 9.27e-04 | NA | 4.16e-06 |
| 3. B | Q9N0E3 | Reticulon-4 receptor | 1.55e-05 | NA | 0.002 |
| 3. B | O04567 | Probable inactive receptor kinase At1g27190 | 1.45e-02 | NA | 0.001 |
| 3. B | Q6JN47 | Receptor-like protein EIX1 | 5.94e-06 | NA | 8.12e-06 |
| 3. B | F1MLX5 | Leucine-rich repeat-containing G-protein coupled receptor 4 | 2.72e-04 | NA | 9.68e-10 |
| 3. B | Q9ESY6 | Leucine-rich repeat neuronal protein 3 | 1.23e-04 | NA | 0.007 |
| 3. B | Q8RX63 | Receptor-like protein 31 | 4.61e-04 | NA | 1.43e-08 |
| 3. B | P93194 | Receptor-like protein kinase | 6.09e-03 | NA | 1.73e-08 |
| 3. B | Q2WF71 | Leucine-rich repeat and fibronectin type III domain-containing protein 1 | 1.29e-03 | NA | 0.013 |
| 3. B | Q96M69 | Leucine-rich repeat and guanylate kinase domain-containing protein | 1.75e-04 | NA | 0.017 |
| 3. B | Q8BGR2 | Volume-regulated anion channel subunit LRRC8D | 3.38e-06 | NA | 2.24e-14 |
| 3. B | C0LGN2 | Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840 | 9.29e-03 | NA | 5.43e-08 |
| 3. B | Q5M8G4 | Leucine-rich repeat-containing protein 40 | 3.66e-06 | NA | 1.81e-17 |
| 3. B | A8XWW4 | Leucine-rich repeat protein soc-2 | 1.60e-11 | NA | 6.82e-12 |
| 3. B | O02678 | Biglycan | 6.41e-09 | NA | 2.63e-04 |
| 3. B | Q9BXN1 | Asporin | 1.45e-11 | NA | 0.022 |
| 3. B | P47853 | Biglycan | 6.95e-09 | NA | 1.79e-04 |
| 3. B | Q8BLY3 | Leucine-rich repeat and fibronectin type-III domain-containing protein 3 | 1.29e-03 | NA | 0.023 |
| 3. B | Q6BMM5 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 5.92e-02 | NA | 7.86e-09 |
| 3. B | Q9C6A8 | Receptor-like protein 15 | 2.84e-03 | NA | 1.21e-04 |
| 3. B | Q6R6I7 | Relaxin receptor 1 | 2.26e-04 | NA | 6.64e-06 |
| 3. B | O49879 | Receptor-like protein Cf-9 homolog | 1.11e-03 | NA | 2.29e-05 |
| 3. B | Q5ZLN0 | Leucine-rich repeat-containing protein 40 | 2.36e-07 | NA | 8.24e-22 |
| 3. B | P28654 | Decorin | 4.72e-09 | NA | 0.004 |
| 3. B | Q942F3 | Brassinosteroid LRR receptor kinase BRI1 | 1.05e-02 | NA | 2.68e-05 |
| 3. B | Q810B8 | SLIT and NTRK-like protein 4 | 1.04e-02 | NA | 4.82e-04 |
| 3. B | Q93YT3 | Receptor-like protein 50 | 1.41e-04 | NA | 1.38e-04 |
| 3. B | Q9SSL9 | Leucine-rich repeat receptor-like protein kinase PEPR1 | 3.70e-03 | NA | 6.17e-08 |
| 3. B | F4HTV6 | Putative receptor-like protein 16 | 8.07e-09 | NA | 3.50e-05 |
| 3. B | Q9LJF3 | Receptor-like protein kinase BRI1-like 3 | NA | NA | 1.97e-07 |
| 3. B | Q9WTR8 | PH domain leucine-rich repeat protein phosphatase 1 | 1.90e-02 | NA | 1.89e-12 |
| 3. B | Q22875 | Leucine-rich repeat protein soc-2 | 1.31e-11 | NA | 1.75e-13 |
| 3. B | Q6NSJ5 | Volume-regulated anion channel subunit LRRC8E | 1.69e-05 | NA | 2.10e-10 |
| 3. B | Q40392 | TMV resistance protein N | 7.62e-03 | NA | 0.045 |
| 3. B | Q5F334 | Leucine-rich repeat-containing protein 59 | 2.10e-03 | NA | 0.001 |
| 3. B | Q9BXR5 | Toll-like receptor 10 | 9.22e-04 | NA | 0.006 |
| 3. B | Q6RKD8 | Leucine-rich repeat transmembrane protein FLRT1 | 7.82e-05 | NA | 5.22e-06 |
| 3. B | F4JT80 | Disease resistance protein RPP2B | 6.64e-03 | NA | 5.51e-05 |
| 3. B | F1MT22 | Leucine-rich repeat-containing G-protein coupled receptor 5 | 2.97e-04 | NA | 1.57e-07 |
| 3. B | Q9C699 | Receptor-like protein 7 | 1.14e-03 | NA | 1.86e-07 |
| 3. B | Q6Z8P4 | Plant intracellular Ras-group-related LRR protein 4 | 2.75e-07 | NA | 9.86e-14 |
| 3. B | Q9LJM4 | Receptor-like protein kinase HAIKU2 | 5.68e-03 | NA | 7.52e-09 |
| 3. B | Q8CBC6 | Leucine-rich repeat neuronal protein 3 | 1.17e-04 | NA | 0.006 |
| 3. B | Q92626 | Peroxidasin homolog | 1.92e-01 | NA | 0.002 |
| 3. B | P0C895 | LRR repeats and ubiquitin-like domain-containing protein At2g30105 | 8.94e-09 | NA | 5.94e-13 |
| 3. B | Q9LJS2 | Receptor-like protein 41 | 3.15e-03 | NA | 4.39e-05 |
| 3. B | Q9XIL9 | Pollen-specific leucine-rich repeat extensin-like protein 3 | 1.00e-03 | NA | 0.002 |
| 3. B | Q9LRR5 | Putative disease resistance protein At3g14460 | 1.01e-01 | NA | 0.004 |
| 3. B | Q9FL28 | LRR receptor-like serine/threonine-protein kinase FLS2 | 3.59e-03 | NA | 6.80e-09 |
| 3. B | Q9SH71 | Putative inactive receptor-like protein kinase At1g64210 | 7.66e-03 | NA | 0.006 |
| 3. B | Q9R1B9 | Slit homolog 2 protein | 1.61e-02 | NA | 7.09e-06 |
| 3. B | Q13045 | Protein flightless-1 homolog | 3.44e-04 | NA | 4.91e-12 |
| 3. B | Q29393 | Decorin | 1.19e-08 | NA | 0.019 |
| 3. B | Q5BJ41 | CCR4-NOT transcription complex subunit 6 | 9.16e-03 | NA | 8.01e-09 |
| 3. B | P0CP23 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 8.31e-02 | NA | 6.77e-07 |
| 3. B | Q9DBY4 | TLR4 interactor with leucine rich repeats | 6.99e-04 | NA | 0.002 |
| 3. B | P50608 | Fibromodulin | 6.40e-11 | NA | 0.007 |
| 3. B | Q9ULM6 | CCR4-NOT transcription complex subunit 6 | 6.50e-03 | NA | 3.93e-12 |
| 3. B | D4ABX8 | Leucine-rich repeat and fibronectin type-III domain-containing protein 4 | 1.05e-03 | NA | 3.62e-05 |
| 3. B | Q9V780 | Protein lap1 | 2.38e-05 | NA | 6.29e-17 |
| 3. B | Q7KRY7 | Protein lap4 | 3.76e-02 | NA | 3.48e-17 |
| 3. B | Q01631 | Adenylate cyclase | 2.51e-02 | NA | 8.20e-15 |
| 3. B | Q965M2 | Leucine-rich repeats and immunoglobulin-like domains protein sma-10 | 2.36e-03 | NA | 3.10e-04 |
| 3. B | Q84MA9 | Inactive leucine-rich repeat receptor-like serine/threonine-protein kinase At1g60630 | 2.38e-02 | NA | 0.003 |
| 3. B | Q9LS79 | Receptor-like protein 38 | 1.12e-03 | NA | 5.85e-09 |
| 3. B | Q9C9N5 | Probable inactive leucine-rich repeat receptor-like protein kinase At1g66830 | 1.51e-03 | NA | 1.64e-06 |
| 3. B | P21809 | Biglycan | 7.24e-09 | NA | 1.66e-04 |
| 3. B | Q96FV0 | Leucine-rich repeat-containing protein 46 | 2.09e-03 | NA | 0.025 |
| 3. B | Q5RAC4 | SLIT and NTRK-like protein 1 | 1.30e-03 | NA | 5.39e-05 |
| 3. B | Q9HBX8 | Leucine-rich repeat-containing G-protein coupled receptor 6 | 2.98e-03 | NA | 6.50e-08 |
| 3. B | F4I9S3 | Receptor-like protein 9a | 2.81e-03 | NA | 2.87e-05 |
| 3. B | Q99MQ4 | Asporin | 2.15e-11 | NA | 0.026 |
| 3. B | Q8VYG9 | Plant intracellular Ras-group-related LRR protein 9 | 1.36e-06 | NA | 3.52e-13 |
| 3. B | Q5RI43 | Keratocan | 8.19e-08 | NA | 1.17e-06 |
| 3. B | B4LXW1 | Leucine-rich repeat protein soc-2 homolog | 3.72e-11 | NA | 5.48e-19 |
| 3. B | Q8CHE4 | PH domain leucine-rich repeat-containing protein phosphatase 1 | 2.49e-02 | NA | 5.72e-12 |
| 3. B | P45969 | Protein phosphatase 1 regulatory subunit SDS22 homolog | 8.19e-13 | NA | 6.12e-06 |
| 3. B | Q9NR97 | Toll-like receptor 8 | 1.20e-03 | NA | 0.001 |
| 3. B | Q9NR99 | Matrix-remodeling-associated protein 5 | NA | NA | 0.006 |
| 3. B | Q9ZUK3 | Receptor-like protein 19 | 7.53e-05 | NA | 2.17e-08 |
| 3. B | Q9VEK6 | Leucine-rich repeat protein soc-2 homolog | 1.56e-09 | NA | 1.17e-19 |
| 3. B | Q6NWG1 | Leucine-rich repeat-containing protein 59 | 1.60e-03 | NA | 0.004 |
| 3. B | Q8LFN2 | Probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 | 7.34e-04 | NA | 0.025 |
| 3. B | D3ZTV3 | Leucine-rich repeat transmembrane protein FLRT2 | 1.31e-04 | NA | 0.007 |
| 3. B | A7SFP1 | Leucine-rich repeat protein soc-2 homolog | 7.59e-09 | NA | 4.80e-17 |
| 3. B | Q8VZG8 | MDIS1-interacting receptor like kinase 2 | 1.90e-04 | NA | 3.19e-10 |
| 3. B | O60346 | PH domain leucine-rich repeat-containing protein phosphatase 1 | 2.57e-02 | NA | 1.63e-11 |
| 3. B | Q0WVM4 | Probable LRR receptor-like serine/threonine-protein kinase At2g23950 | 1.82e-02 | NA | 0.010 |
| 3. B | Q8K1S1 | Leucine-rich repeat LGI family member 4 | 1.64e-02 | NA | 0.017 |
| 3. B | A2Q9L0 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 1.28e-02 | NA | 2.00e-10 |
| 3. B | Q9C7T7 | Receptor protein-tyrosine kinase CEPR2 | 9.96e-05 | NA | 5.66e-08 |
| 3. B | G7JIK2 | Leucine-rich repeat receptor-like kinase protein SUNN | 3.61e-04 | NA | 3.28e-11 |
| 3. B | Q80ZI6 | E3 ubiquitin-protein ligase LRSAM1 | 9.41e-04 | NA | 2.69e-11 |
| 3. B | O46378 | Fibromodulin (Fragment) | 1.60e-09 | NA | 0.002 |
| 3. B | Q9C6A6 | Receptor-like protein 13 | 1.46e-03 | NA | 2.03e-06 |
| 3. B | Q3ZBN5 | Asporin | 3.72e-09 | NA | 0.001 |
| 3. B | Q9FZ59 | Leucine-rich repeat receptor-like protein kinase PEPR2 | 3.71e-03 | NA | 2.44e-10 |
| 3. B | Q80U72 | Protein scribble homolog | 2.81e-03 | NA | 5.88e-14 |
| 3. B | Q8S7M7 | Plant intracellular Ras-group-related LRR protein 5 | 5.09e-07 | NA | 3.34e-13 |
| 3. B | B3DH20 | Dynein axonemal assembly factor 11 | 4.14e-03 | NA | 0.033 |
| 3. B | Q6QNU9 | Toll-like receptor 12 | 4.90e-04 | NA | 0.003 |
| 3. B | P28653 | Biglycan | 7.10e-09 | NA | 1.45e-04 |
| 3. B | Q96PX8 | SLIT and NTRK-like protein 1 | 3.67e-04 | NA | 5.48e-05 |
| 3. B | O80809 | Receptor-like protein CLAVATA2 | 3.80e-04 | NA | 0.030 |
| 3. B | P0DJM0 | Internalin A | 3.84e-04 | NA | 7.25e-04 |
| 3. B | W8DXL4 | Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 3 | 1.24e-02 | NA | 1.44e-04 |
| 3. B | B0M0P8 | Ras guanine nucleotide exchange factor L | 1.15e-02 | NA | 2.99e-14 |
| 3. B | Q6XHA6 | Probable inactive serine/threonine-protein kinase roco10 | 3.01e-02 | NA | 7.79e-13 |
| 3. B | Q91ZZ5 | Relaxin receptor 2 | 1.63e-05 | NA | 3.20e-06 |
| 3. B | Q9LSI9 | Inactive LRR receptor-like serine/threonine-protein kinase BIR2 | 2.55e-02 | NA | 2.22e-04 |
| 3. B | Q9SJH6 | Receptor like protein 29 | 3.38e-06 | NA | 5.18e-10 |
| 3. B | C0LGH8 | Probable LRR receptor-like serine/threonine-protein kinase At1g63430 | 1.13e-02 | NA | 0.002 |
| 3. B | Q4WQG5 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 3.67e-02 | NA | 2.65e-11 |
| 3. B | O94813 | Slit homolog 2 protein | 3.14e-02 | NA | 2.62e-06 |
| 3. B | Q9HBX9 | Relaxin receptor 1 | 7.56e-05 | NA | 3.79e-05 |
| 3. B | Q7TNJ4 | Amphoterin-induced protein 2 | 2.68e-03 | NA | 4.64e-05 |
| 3. B | Q7G768 | Brassinosteroid LRR receptor kinase BRL2 | 1.80e-03 | NA | 8.99e-10 |
| 3. B | C0LGQ9 | LRR receptor-like serine/threonine-protein kinase GHR1 | 1.02e-02 | NA | 2.13e-05 |
| 3. B | P43298 | Receptor protein kinase TMK1 | 7.18e-03 | NA | 1.31e-04 |
| 3. B | Q8IWT6 | Volume-regulated anion channel subunit LRRC8A | 6.09e-07 | NA | 9.60e-12 |
| 3. B | Q5RAV5 | Leucine-rich repeat protein SHOC-2 | 4.51e-08 | NA | 2.79e-14 |
| 3. B | Q7L1W4 | Volume-regulated anion channel subunit LRRC8D | 2.08e-06 | NA | 2.47e-14 |
| 3. B | O48809 | Leucine-rich repeat extensin-like protein 2 | 4.73e-03 | NA | 3.19e-05 |
| 3. B | Q9LH52 | Leucine-rich repeat protein FLOR 1 | 5.67e-06 | NA | 0.014 |
| 3. B | Q8BGT1 | Leucine-rich repeat transmembrane protein FLRT3 | 1.78e-05 | NA | 1.58e-07 |
| 3. B | P02750 | Leucine-rich alpha-2-glycoprotein | 2.58e-07 | NA | 2.01e-08 |
| 3. B | C0LGQ4 | Protein MALE DISCOVERER 2 | 1.30e-01 | NA | 0.031 |
| 3. B | A8WGA3 | Leucine-rich repeat and fibronectin type III domain-containing protein 1-like protein | 4.62e-04 | NA | 0.035 |
| 3. B | O22938 | Leucine-rich repeat receptor-like tyrosine-protein kinase PXC3 | 6.78e-04 | NA | 3.67e-07 |
| 3. B | Q99M75 | Reticulon-4 receptor | 2.99e-05 | NA | 0.001 |
| 3. B | Q5G5E0 | Plant intracellular Ras-group-related LRR protein 5 | 1.22e-06 | NA | 5.65e-13 |
| 3. B | Q6R2K3 | Protein STRUBBELIG-RECEPTOR FAMILY 3 | 9.91e-03 | NA | 9.83e-05 |
| 3. B | Q7Z7A1 | Centriolin | 5.47e-01 | NA | 5.23e-06 |
| 3. B | Q9FKZ1 | Probable disease resistance protein At5g66900 | 2.12e-03 | NA | 0.022 |
| 3. B | Q9UQ13 | Leucine-rich repeat protein SHOC-2 | 1.16e-08 | NA | 2.79e-14 |
| 3. B | C0LGK4 | Probable LRR receptor-like serine/threonine-protein kinase At2g16250 | 1.41e-03 | NA | 0.020 |
| 3. B | Q723K6 | Internalin A | 6.16e-03 | NA | 7.64e-04 |
| 3. B | Q9NZU1 | Leucine-rich repeat transmembrane protein FLRT1 | 1.43e-05 | NA | 6.68e-06 |
| 3. B | Q9P244 | Leucine-rich repeat and fibronectin type III domain-containing protein 1 | 1.45e-03 | NA | 0.014 |
| 3. B | Q9SCT4 | Probably inactive leucine-rich repeat receptor-like protein kinase IMK2 | 1.53e-03 | NA | 1.59e-06 |
| 3. B | V9M398 | Disease resistance protein RUN1 | 5.09e-03 | NA | 1.59e-11 |
| 3. B | Q6AYI5 | Leucine-rich repeat protein SHOC-2 | 9.24e-09 | NA | 1.06e-14 |
| 3. B | Q80ZD9 | Amphoterin-induced protein 2 | 2.11e-03 | NA | 1.54e-07 |
| 3. B | B1H234 | Leucine-rich repeat transmembrane protein FLRT3 | 1.89e-04 | NA | 1.80e-07 |
| 3. B | Q9SRL7 | Receptor-like protein 35 | 6.24e-07 | NA | 2.22e-07 |
| 3. B | Q5FW85 | Extracellular matrix protein 2 | 3.41e-06 | NA | 1.42e-07 |
| 3. B | O82318 | Leucine-rich repeat receptor-like serine/threonine-protein kinase SKM1 | 1.48e-03 | NA | 1.02e-08 |
| 3. B | Q8LPS5 | Somatic embryogenesis receptor kinase 5 | 1.40e-02 | NA | 0.031 |
| 3. B | Q9ZUI0 | Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g24130 | 3.32e-04 | NA | 1.20e-07 |
| 3. B | Q9ZU46 | Receptor protein kinase-like protein ZAR1 | 1.98e-03 | NA | 5.25e-05 |
| 3. B | Q9FL63 | Inactive leucine-rich repeat receptor-like serine/threonine-protein kinase At5g24100 | 3.45e-02 | NA | 0.014 |
| 3. B | Q40235 | Receptor-like protein Cf-9 | 1.10e-04 | NA | 6.31e-06 |
| 3. B | Q8RZV7 | Leucine-rich repeat receptor protein kinase MSP1 | 1.41e-05 | NA | 1.75e-06 |
| 3. B | Q9ZVR7 | Phytosulfokine receptor 1 | 5.79e-04 | NA | 1.07e-05 |
| 3. B | O61967 | Protein lap1 | 1.29e-05 | NA | 7.66e-16 |
| 3. B | Q9UBM4 | Opticin | 2.08e-06 | NA | 0.001 |
| 3. B | O65375 | Leucine-rich repeat extensin-like protein 1 | 2.42e-03 | NA | 2.29e-05 |
| 3. B | Q5MR23 | Receptor-like protein 9DC3 | 5.04e-03 | NA | 1.21e-04 |
| 3. B | Q0U7W4 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 2.85e-02 | NA | 3.20e-08 |
| 3. B | Q9SN46 | Leucine-rich repeat extensin-like protein 5 | 2.40e-03 | NA | 7.64e-06 |
| 3. B | Q960C5 | Leucine-rich repeat and calponin homology domain-containing protein | 2.86e-04 | NA | 4.72e-06 |
| 3. B | F4HTV4 | Receptor-like protein 14 | 3.17e-03 | NA | 0.010 |
| 3. B | V9M2S5 | Disease resistance protein RPV1 | 4.89e-03 | NA | 4.03e-10 |
| 3. B | Q2R8L1 | Disease resistance protein RGA5 | 1.31e-01 | NA | 0.009 |
| 3. B | Q8SPE9 | Toll-like receptor 4 | 1.80e-03 | NA | 0.042 |
| 3. B | Q9Y2L9 | Leucine-rich repeat and calponin homology domain-containing protein 1 | 6.75e-05 | NA | 3.07e-12 |
| 3. B | P35334 | Polygalacturonase inhibitor 1 | 8.57e-10 | NA | 2.73e-05 |
| 3. B | O75473 | Leucine-rich repeat-containing G-protein coupled receptor 5 | 4.17e-04 | NA | 1.99e-08 |
| 3. B | O46403 | Biglycan | 7.17e-09 | NA | 3.98e-04 |
| 3. B | Q5R482 | Leucine-rich repeat neuronal protein 3 | 1.36e-04 | NA | 0.021 |
| 3. B | P12024 | Chaoptin | 3.24e-03 | NA | 8.56e-06 |
| 3. B | Q32KP2 | Leucine-rich repeat-containing protein 23 | 1.07e-06 | NA | 6.82e-06 |
| 3. B | Q9CRC8 | Leucine-rich repeat-containing protein 40 | 5.36e-08 | NA | 2.49e-10 |
| 3. B | P31384 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 5.65e-02 | NA | 1.66e-11 |
| 3. B | O49545 | Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1 | 8.16e-07 | NA | 1.05e-12 |
| 3. B | Q53EV4 | Leucine-rich repeat-containing protein 23 | 2.74e-07 | NA | 7.81e-07 |
| 3. B | Q3SXY7 | Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 3 | 2.90e-02 | NA | 0.039 |
| 3. B | Q9H5Y7 | SLIT and NTRK-like protein 6 | 3.55e-03 | NA | 7.73e-06 |
| 3. B | Q940E8 | Leucine-rich repeat receptor-like protein FASCIATED EAR2 | 6.06e-05 | NA | 1.08e-07 |
| 3. B | Q8YA32 | Internalin I | 6.54e-02 | NA | 2.53e-06 |
| 3. B | Q54AX5 | Leucine-rich repeat protein lrrA | 2.01e-09 | NA | 4.71e-17 |
| 3. B | A1CIJ6 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 4.80e-02 | NA | 7.88e-11 |
| 3. B | C0LGR3 | LRR receptor-like serine/threonine-protein kinase RGI3 | 1.69e-03 | NA | 1.58e-11 |
| 3. B | B3LWU3 | Leucine-rich repeat protein soc-2 homolog | 8.55e-11 | NA | 8.20e-20 |
| 3. B | Q5S006 | Leucine-rich repeat serine/threonine-protein kinase 2 | 9.67e-02 | NA | 5.22e-08 |
| 3. B | Q94C77 | Receptor protein kinase-like protein At4g34220 | 9.81e-03 | NA | 1.10e-05 |
| 3. B | Q9SZ67 | Probable WRKY transcription factor 19 | 9.07e-04 | NA | 0.001 |
| 3. B | Q1L8Y7 | Leucine-rich repeat protein SHOC-2 | 5.75e-08 | NA | 3.58e-15 |
| 3. B | Q9SRL2 | Receptor-like protein 34 | 1.53e-05 | NA | 2.54e-07 |
| 3. B | Q05C16 | Leucine-rich repeat-containing protein 63 | 2.16e-04 | NA | 2.08e-11 |
| 3. B | Q9S9U3 | Receptor-like protein 53 | 6.24e-04 | NA | 4.71e-05 |
| 3. B | Q4PSE6 | Leucine-rich repeat extensin-like protein 7 | 3.95e-05 | NA | 7.35e-07 |
| 3. B | Q8N1G4 | Leucine-rich repeat-containing protein 47 | 1.52e-05 | NA | 2.08e-15 |
| 3. B | Q28256 | Platelet glycoprotein Ib alpha chain | 2.54e-04 | NA | 3.95e-08 |
| 3. B | Q86SJ2 | Amphoterin-induced protein 2 | 1.19e-03 | NA | 0.002 |
| 3. B | Q80TE7 | Leucine-rich repeat-containing protein 7 | 9.95e-02 | NA | 5.15e-14 |
| 3. B | Q9T0K5 | Leucine-rich repeat extensin-like protein 3 | 4.91e-03 | NA | 6.58e-06 |
| 3. B | Q01513 | Adenylate cyclase | 1.98e-02 | NA | 2.34e-11 |
| 3. B | Q9ZPS9 | Serine/threonine-protein kinase BRI1-like 2 | 5.10e-06 | NA | 2.03e-12 |
| 3. B | Q810C0 | SLIT and NTRK-like protein 2 | 2.37e-03 | NA | 7.48e-06 |
| 3. B | P47735 | Receptor-like protein kinase 5 | 1.22e-06 | NA | 1.57e-08 |
| 3. B | Q80TH2 | Erbin | 2.35e-03 | NA | 1.23e-13 |
| 3. B | P0DO06 | Receptor-like protein 9DC2 | 8.14e-03 | NA | 6.09e-06 |
| 3. B | Q9BZR6 | Reticulon-4 receptor | 1.64e-05 | NA | 2.47e-05 |
| 3. B | Q54WS5 | Probable serine/threonine-protein kinase roco6 | 7.64e-02 | NA | 4.18e-10 |
| 3. B | Q9FGL5 | Receptor protein-tyrosine kinase CEPR1 | 1.79e-03 | NA | 1.01e-07 |
| 3. B | Q9C637 | Receptor-like protein 6 | 4.04e-03 | NA | 1.35e-07 |
| 3. B | Q9LFS4 | Protein NSP-INTERACTING KINASE 1 | 4.15e-02 | NA | 8.35e-06 |
| 3. B | E9Q7T7 | Chondroadherin-like protein | 2.31e-04 | NA | 2.86e-08 |
| 3. B | A2AL36 | Centriolin | 4.13e-01 | NA | 7.99e-05 |
| 3. B | Q7XBQ9 | Disease resistance protein RGA2 | 4.28e-03 | NA | 0.005 |
| 3. B | Q6Z4U4 | LRR receptor kinase BAK1 | 2.37e-02 | NA | 1.43e-04 |
| 3. B | Q9LYN8 | Leucine-rich repeat receptor protein kinase EMS1 | 1.23e-02 | NA | 3.74e-09 |
| 3. B | Q8MVR1 | Cyclic GMP-binding protein C | 6.84e-01 | NA | 7.02e-05 |
| 3. B | Q9GKQ6 | Biglycan (Fragments) | 1.62e-08 | NA | 2.94e-04 |
| 3. B | Q6CJU4 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 5.49e-02 | NA | 1.62e-07 |
| 3. B | Q6NQP4 | Leucine-rich repeat protein 2 | 3.13e-04 | NA | 0.002 |
| 3. B | Q9C2R2 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 2.55e-02 | NA | 2.77e-08 |
| 3. B | Q9NT99 | Leucine-rich repeat-containing protein 4B | 1.41e-04 | NA | 1.58e-04 |
| 3. B | Q9FIZ3 | LRR receptor-like serine/threonine-protein kinase GSO2 | 1.18e-02 | NA | 9.66e-13 |
| 3. B | A6QLV3 | Leucine-rich repeat protein SHOC-2 | 7.27e-08 | NA | 2.79e-14 |
| 3. B | Q6ZCZ2 | Brassinosteroid LRR receptor kinase BRL3 | 1.64e-02 | NA | 1.37e-07 |
| 3. B | A0A1P8ATR9 | Receptor-like protein 9b | 5.36e-03 | NA | 1.37e-04 |
| 3. B | C0LGS3 | Probable LRR receptor-like serine/threonine-protein kinase At4g37250 | 5.86e-03 | NA | 0.017 |
| 3. B | C4V7I7 | Probable CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 6.74e-03 | NA | 2.45e-09 |
| 3. B | Q6AXU9 | CCR4-NOT transcription complex subunit 6 | 5.17e-03 | NA | 7.98e-09 |
| 3. B | C0LGP9 | Probable leucine-rich repeat receptor-like protein kinase IMK3 | 3.30e-04 | NA | 2.23e-05 |
| 3. B | Q9LP24 | Probable leucine-rich repeat receptor-like protein kinase At1g35710 | 5.11e-03 | NA | 6.19e-11 |
| 3. B | Q9LFG1 | Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At3g53590 | 3.76e-03 | NA | 4.58e-06 |
| 3. B | Q0CT27 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 2.81e-02 | NA | 2.70e-10 |
| 3. B | Q3UVD5 | Leucine-rich repeat-containing G-protein coupled receptor 6 | 5.97e-04 | NA | 3.86e-10 |
| 3. B | Q8IW52 | SLIT and NTRK-like protein 4 | 2.87e-03 | NA | 5.21e-04 |
| 3. B | Q6DF55 | Vasorin | 2.91e-05 | NA | 1.01e-05 |
| 3. B | Q01129 | Decorin | 4.61e-09 | NA | 1.41e-04 |
| 3. B | Q1ZXD6 | Probable serine/threonine-protein kinase roco5 | NA | NA | 1.01e-17 |
| 3. B | P33543 | Putative kinase-like protein TMKL1 | 7.90e-03 | NA | 0.007 |
| 3. B | Q09564 | Protein phosphatase PHLPP-like protein | 1.34e-03 | NA | 9.68e-09 |
| 3. B | D4AC13 | Leucine-rich repeat-containing G-protein coupled receptor 5 | 2.91e-03 | NA | 1.47e-11 |
| 3. B | A0A290U7C4 | Disease resistance protein Roq1 | 7.46e-03 | NA | 1.96e-04 |
| 3. B | Q00874 | DNA damage-repair/toleration protein DRT100 | 1.61e-10 | NA | 0.003 |
| 3. B | Q6P3Y9 | Podocan-like protein 1 | 1.91e-07 | NA | 3.82e-07 |
| 3. B | O46390 | Biglycan | 2.29e-11 | NA | 1.46e-04 |
| 3. B | Q8R502 | Volume-regulated anion channel subunit LRRC8C | 2.29e-06 | NA | 7.12e-12 |
| 3. B | Q9H156 | SLIT and NTRK-like protein 2 | 1.73e-03 | NA | 1.25e-04 |
| 3. B | Q9DE66 | Keratocan | 6.76e-11 | NA | 0.003 |
| 3. B | Q96II8 | DISP complex protein LRCH3 | 3.65e-05 | NA | 2.12e-13 |
| 3. B | Q6R5P0 | Toll-like receptor 11 | 4.92e-03 | NA | 1.91e-04 |
| 3. B | Q9M0G7 | MDIS1-interacting receptor like kinase 1 | 1.75e-06 | NA | 1.71e-14 |
| 3. B | O75325 | Leucine-rich repeat neuronal protein 2 | 1.90e-04 | NA | 4.46e-06 |
| 3. B | Q8N135 | Leucine-rich repeat LGI family member 4 | 4.36e-02 | NA | 0.027 |
| 3. B | Q68CR7 | Leucine-rich repeat-containing protein 66 | 3.95e-02 | NA | 8.01e-04 |
| 3. B | Q5F479 | Serine/threonine-protein kinase 11-interacting protein | 8.35e-03 | NA | 1.81e-04 |
| 3. B | Q1MX30 | Receptor kinase-like protein Xa21 | 3.77e-03 | NA | 3.64e-04 |
| 3. B | Q6ZH85 | Plant intracellular Ras-group-related LRR protein 2 | 1.44e-06 | NA | 6.20e-15 |
| 3. B | Q8VDB8 | Leucine-rich repeat-containing protein 2 | 2.92e-08 | NA | 4.92e-11 |
| 3. B | Q6UXM1 | Leucine-rich repeats and immunoglobulin-like domains protein 3 | 8.21e-03 | NA | 5.55e-07 |
| 3. B | Q6K4T4 | LRR receptor kinase SERK2 | 1.88e-02 | NA | 7.13e-07 |
| 3. B | Q54XZ5 | Probable serine/threonine-protein kinase DDB_G0278509 | 2.21e-03 | NA | 4.63e-08 |
| 3. B | Q6PEZ8 | Podocan-like protein 1 | 2.31e-05 | NA | 0.014 |
| 3. B | F4JTU7 | Receptor-like protein 48 | 1.22e-03 | NA | 9.36e-05 |
| 3. B | Q810C1 | SLIT and NTRK-like protein 1 | 2.17e-03 | NA | 1.58e-04 |
| 3. B | Q9M8T0 | Probable inactive receptor kinase At3g02880 | 1.21e-02 | NA | 0.002 |
| 3. B | Q9FII5 | Leucine-rich repeat receptor-like protein kinase TDR | 1.24e-04 | NA | 7.22e-09 |
| 3. B | P0CP22 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 3.48e-02 | NA | 6.95e-07 |
| 3. B | Q52KR2 | Leucine-rich repeats and immunoglobulin-like domains protein 2 | 2.92e-03 | NA | 4.16e-06 |
| 3. B | Q8VEG6 | CCR4-NOT transcription complex subunit 6-like | 1.02e-02 | NA | 2.41e-10 |
| 3. B | Q9SIT1 | Receptor-like kinase TMK3 | 1.24e-02 | NA | 3.04e-04 |
| 3. B | Q75BI3 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 4.18e-02 | NA | 3.10e-08 |
| 3. B | Q6XAT2 | LRR receptor-like serine/threonine-protein kinase ERL2 | 2.65e-04 | NA | 2.60e-14 |
| 3. B | I1Z695 | LRR receptor-like serine/threonine-protein kinase ER2 | 1.90e-03 | NA | 4.08e-16 |
| 3. B | Q24020 | Protein flightless-1 | 1.32e-04 | NA | 9.50e-11 |
| 3. B | B4IBI9 | Leucine-rich repeat protein soc-2 homolog | 9.23e-06 | NA | 8.81e-20 |
| 3. B | Q67X31 | LRR receptor kinase SERK2 | 3.62e-02 | NA | 1.96e-08 |
| 3. B | Q9UUG2 | Uncharacterized leucine-rich repeat-containing protein C926.06c | 3.83e-03 | NA | 0.004 |
| 3. B | Q2UUI3 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 5.76e-02 | NA | 1.98e-09 |
| 3. B | Q7XK44 | Plant intracellular Ras-group-related LRR protein 3 | 1.20e-09 | NA | 6.71e-16 |
| 3. B | Q5E9X4 | Leucine-rich repeat-containing protein 59 | 9.17e-04 | NA | 1.03e-05 |
| 3. B | Q3UQ28 | Peroxidasin homolog | 2.50e-01 | NA | 0.001 |
| 3. B | Q6P1C6 | Leucine-rich repeats and immunoglobulin-like domains protein 3 | 7.59e-03 | NA | 1.86e-06 |
| 3. B | B5UBC1 | Disease resistance protein Pikm1-TS | 7.77e-03 | NA | 4.22e-10 |
| 3. B | Q9LRV8 | Plant intracellular Ras-group-related LRR protein 2 | 4.48e-07 | NA | 1.72e-15 |
| 3. B | Q80XU8 | Leucine-rich repeat and fibronectin type-III domain-containing protein 4 | 8.23e-04 | NA | 3.25e-05 |
| 3. B | O75427 | Leucine-rich repeat and calponin homology domain-containing protein 4 | 3.62e-05 | NA | 3.49e-12 |
| 3. B | Q9TTB4 | Fibromodulin (Fragment) | 1.61e-09 | NA | 0.001 |
| 3. B | Q7SXW3 | Leucine-rich repeat-containing protein 40 | 1.87e-08 | NA | 8.44e-20 |
| 3. B | O88520 | Leucine-rich repeat protein SHOC-2 | 1.29e-08 | NA | 3.10e-15 |
| 3. B | Q6K7R2 | Plant intracellular Ras-group-related LRR protein 6 | 6.64e-07 | NA | 1.64e-11 |
| 3. B | Q4UWF4 | Uridine 5'-monophosphate transferase | 1.90e-04 | NA | 2.10e-06 |
| 3. B | B0BLW3 | Leucine-rich repeat-containing G-protein coupled receptor 4 | 3.02e-04 | NA | 1.98e-15 |
| 3. B | Q8N967 | Leucine-rich repeat and transmembrane domain-containing protein 2 | 9.88e-04 | NA | 0.015 |
| 3. B | Q3V1M1 | Immunoglobulin superfamily member 10 | 4.23e-01 | NA | 6.41e-04 |
| 3. B | C0LGH2 | Probable LRR receptor-like serine/threonine-protein kinase At1g56130 | 7.24e-03 | NA | 0.001 |
| 3. B | C0LGT1 | Probable LRR receptor-like serine/threonine-protein kinase At5g10290 | 2.95e-02 | NA | 0.031 |
| 3. B | O35930 | Platelet glycoprotein Ib alpha chain | 2.62e-03 | NA | 1.21e-07 |
| 3. B | Q4P9T3 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 6.84e-02 | NA | 5.64e-09 |
| 3. B | P14605 | Adenylate cyclase | 2.72e-03 | NA | 1.43e-07 |
| 3. B | Q9Z1P4 | Leucine-rich repeat-containing G-protein coupled receptor 5 | 1.81e-03 | NA | 4.34e-11 |
| 3. B | Q9LZV7 | Leucine-rich repeat receptor-like protein kinase PXC2 | 6.97e-07 | NA | 8.71e-07 |
| 3. B | A4IGL7 | Peroxidasin | 3.10e-01 | NA | 0.007 |
| 3. B | C0LGT6 | LRR receptor-like serine/threonine-protein kinase EFR | 3.62e-03 | NA | 2.62e-06 |
| 3. B | Q55CS7 | MAP kinase phosphatase with leucine-rich repeats protein 1 | 8.36e-06 | NA | 1.18e-09 |
| 3. B | Q42371 | LRR receptor-like serine/threonine-protein kinase ERECTA | 1.16e-03 | NA | 4.29e-14 |
| 3. B | Q9RBS2 | Protein PopC | 2.50e-04 | NA | 3.23e-13 |
| 3. B | Q9HB75 | p53-induced death domain-containing protein 1 | 6.08e-04 | NA | 2.45e-20 |
| 3. B | C0LGW6 | LRR receptor-like serine/threonine-protein kinase ERL1 | 1.85e-03 | NA | 6.33e-13 |
| 3. B | B4N9T4 | Leucine-rich repeat protein soc-2 homolog | 8.35e-11 | NA | 1.20e-19 |
| 3. B | A1CW67 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 1.66e-02 | NA | 2.49e-11 |
| 3. B | Q5XH73 | CCR4-NOT transcription complex subunit 6-like-B | 1.06e-02 | NA | 3.07e-05 |
| 3. B | Q3UV48 | Leucine-rich repeat-containing protein 30 | 9.33e-12 | NA | 3.62e-14 |
| 3. B | B3P3E8 | Leucine-rich repeat protein soc-2 homolog | 7.78e-11 | NA | 1.80e-19 |
| 3. B | F1MCA7 | Leucine-rich repeat-containing protein 7 | 8.03e-03 | NA | 1.05e-14 |
| 3. B | P0DL10 | Leucine-rich repeat receptor-like kinase protein THICK TASSEL DWARF1 | 2.79e-03 | NA | 2.28e-09 |
| 3. B | Q9LY03 | Probable LRR receptor-like serine/threonine-protein kinase IRK | 3.82e-03 | NA | 5.22e-12 |
| 3. B | P0C7J6 | Leucine-rich repeat and fibronectin type III domain-containing protein 1 | 1.54e-03 | NA | 0.011 |
| 3. B | Q7TQ62 | Podocan | 4.75e-07 | NA | 4.93e-05 |
| 3. B | Q9FHF0 | Disease resistance protein RPS4B | 8.44e-03 | NA | 0.006 |
| 3. B | P21810 | Biglycan | 6.76e-09 | NA | 1.87e-04 |
| 3. B | Q9LRW9 | Receptor-like protein 40 | 7.30e-07 | NA | 0.002 |
| 3. B | A8JAM0 | Dynein regulatory complex subunit 7 (Fragment) | 2.29e-03 | NA | 4.07e-19 |
| 3. B | Q4R6F0 | Leucine-rich repeat and death domain-containing protein 1 | 4.96e-09 | NA | 3.66e-17 |
| 3. B | Q96NW7 | Leucine-rich repeat-containing protein 7 | 4.37e-03 | NA | 1.35e-14 |
| 3. B | Q658G7 | LRR receptor-like serine/threonine-protein kinase SIK1 | 2.10e-03 | NA | 2.32e-12 |
| 3. B | Q6UWE0 | E3 ubiquitin-protein ligase LRSAM1 | 1.42e-03 | NA | 5.34e-13 |
| 3. B | Q9LVN2 | Probably inactive leucine-rich repeat receptor-like protein kinase At5g58150 | 2.10e-03 | NA | 1.62e-06 |
| 3. B | B8ABC2 | Leucine-rich repeat protein 1 | 1.40e-04 | NA | 0.010 |
| 3. B | Q6NX28 | Leucine-rich repeat-containing protein 59 | 3.24e-03 | NA | 1.23e-06 |
| 3. B | Q5R5V8 | Relaxin receptor 1 | 1.22e-04 | NA | 1.60e-06 |
| 3. B | F4HX15 | Phospholipase A I | 7.17e-02 | NA | 6.52e-06 |
| 3. B | Q8BVU0 | DISP complex protein LRCH3 | 1.82e-05 | NA | 1.88e-12 |
| 3. B | Q8TDW0 | Volume-regulated anion channel subunit LRRC8C | 5.94e-06 | NA | 2.14e-12 |
| 3. B | Q38SD2 | Leucine-rich repeat serine/threonine-protein kinase 1 | 6.39e-02 | NA | 2.40e-07 |
| 3. B | Q9SGP2 | Receptor-like protein kinase HSL1 | 6.01e-07 | NA | 3.02e-09 |
| 3. B | Q55FD8 | Ras guanine nucleotide exchange factor V | 1.56e-02 | NA | 2.41e-13 |
| 3. B | A6NM62 | Leucine-rich repeat-containing protein 53 | 7.49e-03 | NA | 3.57e-04 |
| 3. B | C0LGG9 | Probable LRR receptor-like serine/threonine-protein kinase At1g53440 | 8.27e-03 | NA | 2.05e-04 |
| 3. B | Q9BXB1 | Leucine-rich repeat-containing G-protein coupled receptor 4 | 8.79e-04 | NA | 9.77e-14 |
| 3. B | E5DHB5 | Leucine-rich repeat-containing G-protein coupled receptor 5A | 1.73e-03 | NA | 5.17e-06 |
| 3. B | Q55CS8 | MAP kinase phosphatase with leucine-rich repeats protein 2 | 1.01e-05 | NA | 2.34e-09 |
| 3. B | Q9LJS0 | Receptor-like protein 42 | 2.35e-03 | NA | 2.58e-05 |
| 3. B | Q96AG4 | Leucine-rich repeat-containing protein 59 | 1.05e-03 | NA | 2.95e-05 |
| 3. B | P58874 | Opticin | 2.83e-08 | NA | 4.98e-04 |
| 3. B | Q8AVS8 | Leucine-rich repeat-containing protein 59 | 1.87e-03 | NA | 9.41e-06 |
| 3. B | Q9LNV9 | Receptor-like protein 1 | 1.02e-02 | NA | 5.96e-07 |
| 3. B | Q55E58 | Probable serine/threonine-protein kinase pats1 | NA | NA | 1.29e-11 |
| 3. B | Q1PEN0 | Receptor-like protein 36 | 1.87e-05 | NA | 7.49e-04 |
| 3. B | F4J7T6 | Receptor-like protein 39 | 1.27e-04 | NA | 3.63e-04 |
| 3. B | Q54Y32 | MAP kinase phosphatase with leucine-rich repeats protein 3 | 1.29e-04 | NA | 1.51e-10 |
| 3. B | A2ARI4 | Leucine-rich repeat-containing G-protein coupled receptor 4 | 4.06e-04 | NA | 4.44e-13 |
| 3. B | O49329 | Receptor like protein 24 | 2.46e-03 | NA | 5.93e-05 |
| 3. B | Q6NU09 | Volume-regulated anion channel subunit LRRC8E | 1.07e-08 | NA | 4.72e-12 |
| 3. B | Q28CU0 | Leucine-rich repeat-containing protein 23 | 8.47e-08 | NA | 3.80e-06 |
| 3. B | F4I2N7 | Receptor-like protein kinase 7 | 1.31e-04 | NA | 1.45e-04 |
| 3. B | O48849 | Receptor like protein 23 | 6.45e-05 | NA | 0.003 |
| 3. B | Q9C0I9 | Leucine-rich repeat-containing protein 27 | 2.50e-02 | NA | 0.035 |
| 3. B | B7XK66 | Probable CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 2.60e-03 | NA | 1.37e-09 |
| 3. B | Q6IRN0 | Serine/threonine-protein kinase 11-interacting protein | 9.49e-03 | NA | 0.002 |
| 3. B | P07359 | Platelet glycoprotein Ib alpha chain | 1.19e-03 | NA | 3.03e-05 |
| 3. B | Q9SJQ1 | Leucine-rich repeat receptor-like protein kinase PXC1 | 1.97e-02 | NA | 0.003 |
| 3. B | P70587 | Leucine-rich repeat-containing protein 7 | 6.52e-03 | NA | 5.69e-14 |
| 3. B | Q94F62 | BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 | 1.87e-02 | NA | 0.024 |
| 3. B | B4PU77 | Leucine-rich repeat protein soc-2 homolog | 7.88e-11 | NA | 1.51e-19 |
| 3. B | Q96LI5 | CCR4-NOT transcription complex subunit 6-like | 8.23e-03 | NA | 8.15e-07 |
| 3. B | Q7XA40 | Putative disease resistance protein RGA3 | 6.78e-04 | NA | 1.51e-05 |
| 3. B | F4KHA2 | Receptor-like protein 54 | 5.04e-03 | NA | 3.18e-04 |
| 3. B | Q7L0X0 | TLR4 interactor with leucine rich repeats | 2.22e-04 | NA | 1.69e-04 |
| 3. B | Q0PV50 | Toll-like receptor 3 | 2.99e-03 | NA | 5.62e-07 |
| 3. B | C0LGF5 | LRR receptor-like serine/threonine-protein kinase RGI5 | 3.45e-03 | NA | 1.01e-09 |
| 3. B | P0CC10 | Leucine-rich repeat-containing protein 4B | 1.32e-04 | NA | 1.27e-04 |
| 3. B | A6H694 | Leucine-rich repeat-containing protein 63 | 4.50e-05 | NA | 2.50e-15 |
| 3. B | Q8N6Y2 | Leucine-rich repeat-containing protein 17 | 4.54e-05 | NA | 1.20e-04 |
| 3. B | Q9LJY0 | Pollen receptor-like kinase 4 | 4.97e-02 | NA | 0.031 |
| 3. B | Q9M9S4 | Probable LRR receptor-like serine/threonine-protein kinase At1g14390 | 5.25e-04 | NA | 0.004 |
| 3. B | P35859 | Insulin-like growth factor-binding protein complex acid labile subunit | 1.75e-05 | NA | 2.58e-07 |
| 3. B | Q9BGY6 | Leucine-rich repeat-containing protein 53 | 1.75e-04 | NA | 1.95e-05 |
| 3. B | Q8K3P5 | CCR4-NOT transcription complex subunit 6 | 6.17e-03 | NA | 7.98e-09 |
| 3. B | P51890 | Lumican | 3.73e-11 | NA | 7.81e-04 |
| 3. B | C0LGD7 | Probable LRR receptor-like serine/threonine-protein kinase At1g06840 | 4.27e-03 | NA | 0.018 |
| 3. B | Q9ERV7 | p53-induced death domain-containing protein 1 | 7.97e-04 | NA | 5.26e-17 |
| 3. B | O48573 | Disease resistance protein LAZ5 | 1.23e-02 | NA | 1.67e-04 |
| 3. B | C0LGI5 | Probable LRR receptor-like serine/threonine-protein kinase At1g69990 | 1.86e-02 | NA | 1.83e-05 |
| 3. B | P50609 | Fibromodulin | 6.33e-11 | NA | 0.003 |
| 3. B | Q9H9A6 | Leucine-rich repeat-containing protein 40 | 1.86e-08 | NA | 1.03e-18 |
| 3. B | O94294 | Leucine-rich repeat-containing protein sog2 | 2.97e-02 | NA | 1.21e-06 |
| 3. B | Q54M77 | Probable serine/threonine-protein kinase roco8 | 3.49e-02 | NA | 8.80e-15 |
| 3. B | Q5Z9N5 | Leucine-rich repeat receptor-like kinase protein FLORAL ORGAN NUMBER1 | 3.17e-03 | NA | 1.06e-06 |
| 3. B | O35367 | Keratocan | 3.93e-11 | NA | 0.004 |
| 3. B | F4K6B8 | Leucine-rich repeat receptor-like serine/threonine-protein kinase RGI4 | 5.70e-03 | NA | 1.70e-13 |
| 3. B | Q810B9 | SLIT and NTRK-like protein 3 | 1.74e-02 | NA | 6.14e-04 |
| 3. B | Q9Y4C4 | Malignant fibrous histiocytoma-amplified sequence 1 | 1.47e-03 | NA | 2.22e-24 |
| 3. B | Q9C7S5 | Tyrosine-sulfated glycopeptide receptor 1 | 5.45e-03 | NA | 1.27e-05 |
| 3. B | Q66JT1 | Volume-regulated anion channel subunit LRRC8E | 1.66e-05 | NA | 6.23e-14 |
| 3. B | Q9LHP4 | LRR receptor-like serine/threonine-protein kinase RGI1 | 4.78e-03 | NA | 6.94e-09 |
| 3. B | Q14160 | Protein scribble homolog | 2.83e-03 | NA | 1.29e-12 |
| 3. B | Q6XHA7 | Probable serine/threonine-protein kinase roco9 | NA | NA | 9.49e-15 |
| 3. B | P0DO09 | Disease resistance protein Piks-1 | 6.82e-03 | NA | 4.69e-10 |
| 3. B | Q9SVW8 | Plant intracellular Ras-group-related LRR protein 4 | 1.22e-06 | NA | 1.84e-11 |
| 3. B | F7D3V9 | Leucine-rich repeat-containing G-protein coupled receptor 5 | 1.46e-03 | NA | 6.38e-10 |
| 3. B | Q6R2K1 | Protein STRUBBELIG-RECEPTOR FAMILY 5 | 1.36e-02 | NA | 7.37e-04 |
| 3. B | A6H6A4 | Leucine-rich repeat and IQ domain-containing protein 4 | 2.89e-06 | NA | 1.85e-15 |
| 3. B | Q9SUQ3 | Probable inactive receptor kinase At4g23740 | 1.60e-02 | NA | 0.006 |
| 3. B | Q1ENI8 | Peroxidasin homolog pxn-1 | 1.92e-01 | NA | 0.013 |
| 3. B | Q6NUI6 | Chondroadherin-like protein | 2.53e-04 | NA | 1.29e-08 |
| 3. B | P17778 | Outer membrane protein YopM | 5.75e-05 | NA | 2.95e-07 |
| 3. B | Q9ZWC8 | Serine/threonine-protein kinase BRI1-like 1 | 1.50e-02 | NA | 6.85e-07 |
| 3. B | Q1EA11 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 2.27e-02 | NA | 3.43e-08 |
| 3. B | Q5RJR8 | Leucine-rich repeat-containing protein 59 | 8.91e-04 | NA | 7.32e-05 |
| 3. B | P49606 | Adenylate cyclase | 8.78e-02 | NA | 1.26e-10 |
| 3. B | O81825 | Probable disease resistance protein At4g27220 | 3.21e-03 | NA | 1.76e-04 |
| 3. B | O88280 | Slit homolog 3 protein | 1.53e-02 | NA | 3.03e-04 |
| 3. B | Q9FFJ3 | Plant intracellular Ras-group-related LRR protein 1 | 2.50e-07 | NA | 7.12e-15 |
| 3. B | Q93373 | Leucine-rich repeat-containing protein let-4 | 5.05e-05 | NA | 3.71e-06 |
| 3. B | Q9M2Z1 | Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2 | 6.66e-07 | NA | 4.93e-09 |
| 3. B | Q9WVB4 | Slit homolog 3 protein | 2.82e-02 | NA | 2.31e-04 |
| 3. B | Q9Z2H4 | Leucine-rich repeat-containing G-protein coupled receptor 4 | 2.67e-03 | NA | 1.15e-12 |
| 3. B | Q6CEJ6 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 8.35e-02 | NA | 6.53e-07 |
| 3. B | P0DM44 | Leucine-rich repeat-containing G-protein coupled receptor 6 | 1.49e-03 | NA | 8.15e-09 |
| 3. B | Q8W4S5 | Probable LRR receptor-like serine/threonine-protein kinase At5g63710 | 1.40e-01 | NA | 0.016 |
| 3. B | A0A0R0HPY5 | Leucine-rich repeat receptor-like kinase protein CLV1a | 5.14e-03 | NA | 7.53e-11 |
| 3. B | P35858 | Insulin-like growth factor-binding protein complex acid labile subunit | 1.69e-05 | NA | 1.78e-04 |
| 3. B | Q6GV17 | Toll-like receptor 10 | 8.76e-04 | NA | 7.87e-04 |
| 3. B | Q9D5S7 | Leucine-rich repeat and guanylate kinase domain-containing protein | 4.67e-04 | NA | 2.27e-07 |
| 3. B | Q9QX05 | Toll-like receptor 4 | 3.51e-04 | NA | 0.049 |
| 3. B | O35125 | Leucine-rich repeat-containing protein 23 | 1.21e-06 | NA | 5.13e-06 |
| 3. B | O65440 | Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM3 | 6.54e-03 | NA | 4.21e-12 |
| 3. B | Q7XV05 | LRR receptor kinase SERK2 | 2.18e-02 | NA | 1.99e-04 |
| 3. B | Q69SP5 | LRR receptor-like serine/threonine-protein kinase ER1 | 1.83e-03 | NA | 3.96e-16 |
| 3. B | Q8VYT3 | Probable LRR receptor-like serine/threonine-protein kinase At4g30520 | 3.01e-02 | NA | 8.21e-04 |
| 3. B | Q9CAK1 | Disease resistance protein RML1B | 2.73e-02 | NA | 0.019 |
| 3. B | Q54T82 | Putative leucine-rich repeat-containing protein DDB_G0281931 | 4.61e-04 | NA | 4.63e-05 |
| 3. B | Q6WRH9 | Immunoglobulin superfamily member 10 | 4.02e-01 | NA | 5.30e-04 |
| 3. B | O46542 | Decorin | 1.10e-08 | NA | 0.012 |
| 3. B | Q9SHI3 | Receptor-like protein 2 | 6.14e-04 | NA | 2.30e-06 |
| 3. B | F2VYU4 | Disease resistance protein Pik-1 | 5.53e-03 | NA | 4.53e-10 |
| 3. B | P58823 | Polygalacturonase inhibitor 3 | 9.49e-10 | NA | 3.54e-05 |
| 3. B | D0ZVG2 | E3 ubiquitin-protein ligase SspH1 | 8.35e-04 | NA | 2.64e-06 |
| 3. B | A2BHJ4 | CCR4-NOT transcription complex subunit 6-like | 8.97e-03 | NA | 8.70e-12 |
| 3. B | Q5VQP7 | Leucine-rich repeat protein 1 | 8.12e-04 | NA | 0.010 |
| 3. B | Q9M6A7 | Leucine-rich repeat receptor-like kinase protein CLV1B | 3.37e-03 | NA | 5.88e-08 |
| 3. B | D0ZPH9 | E3 ubiquitin-protein ligase SspH2 | 7.21e-04 | NA | 1.77e-06 |
| 3. B | Q99PI8 | Reticulon-4 receptor | 3.72e-05 | NA | 3.63e-04 |
| 3. B | Q9FL51 | Probably inactive leucine-rich repeat receptor-like protein kinase At5g06940 | 6.31e-04 | NA | 3.17e-07 |
| 3. B | Q9LK43 | Receptor-like kinase TMK4 | 9.64e-03 | NA | 0.003 |
| 3. B | P82963 | Chaoptin (Fragment) | 7.91e-04 | NA | 1.73e-05 |
| 3. B | B8BB68 | LRR receptor kinase BAK1 | 3.88e-02 | NA | 1.45e-04 |
| 3. B | F4J8G2 | Receptor-like protein 33 | 1.08e-03 | NA | 1.22e-07 |
| 3. B | Q6P4K6 | Serine/threonine-protein kinase 11-interacting protein | 6.32e-03 | NA | 0.015 |
| 3. B | Q69JN6 | Brassinosteroid LRR receptor kinase BRL1 | 2.55e-02 | NA | 1.41e-08 |
| 3. B | C0LGK9 | Probable LRR receptor-like serine/threonine-protein kinase At2g24230 | 1.10e-03 | NA | 2.28e-05 |
| 3. B | O94991 | SLIT and NTRK-like protein 5 | 2.06e-02 | NA | 4.63e-04 |
| 3. B | Q9VPF0 | Protein artichoke | 1.51e-02 | NA | 4.55e-05 |
| 3. B | Q9SD62 | Putative receptor-like protein kinase At3g47110 | 2.87e-03 | NA | 0.004 |
| 3. B | Q9FRS6 | Leucine-rich repeat receptor-like protein kinase PXL1 | 3.23e-03 | NA | 3.63e-13 |
| 3. B | P08678 | Adenylate cyclase | 2.92e-02 | NA | 8.41e-13 |
| 3. B | Q9ZUK7 | Receptor-like protein 18 | 2.72e-07 | NA | 4.83e-06 |
| 3. B | Q6PJG9 | Leucine-rich repeat and fibronectin type-III domain-containing protein 4 | 5.91e-04 | NA | 4.58e-05 |
| 3. B | Q9BTN0 | Leucine-rich repeat and fibronectin type-III domain-containing protein 3 | 1.67e-03 | NA | 0.029 |
| 3. B | P34268 | Protein flightless-1 homolog | 1.24e-03 | NA | 5.81e-12 |
| 3. B | Q86WK6 | Amphoterin-induced protein 1 | 6.98e-04 | NA | 7.59e-05 |
| 3. B | P0DO05 | Receptor-like protein 9DC1 | 7.53e-03 | NA | 6.09e-06 |
| 3. B | P51887 | Fibromodulin | 5.45e-07 | NA | 1.86e-05 |
| 3. B | Q3E991 | Pollen receptor-like kinase 6 | 1.63e-02 | NA | 3.17e-07 |
| 3. B | Q8RWZ1 | Protein STRUBBELIG | 1.11e-02 | NA | 8.92e-04 |
| 3. B | Q8W4Q3 | Plant intracellular Ras-group-related LRR protein 3 | 7.83e-07 | NA | 2.71e-15 |
| 3. B | Q9SHI4 | Receptor-like protein 3 | 1.38e-03 | NA | 2.31e-06 |
| 3. B | C0LGX1 | Probable LRR receptor-like serine/threonine-protein kinase At5g65240 | 5.63e-02 | NA | 0.008 |
| 3. B | Q70AK3 | Leucine-rich repeat transmembrane protein FLRT3 | 1.42e-04 | NA | 6.90e-04 |
| 3. B | D2HFT7 | Leucine-rich repeat and fibronectin type-III domain-containing protein 3 | 1.23e-03 | NA | 0.030 |
| 3. B | Q9SYQ8 | Receptor protein kinase CLAVATA1 | 3.54e-03 | NA | 6.88e-08 |
| 3. B | Q9M9X0 | Receptor-like protein 32 | 2.06e-03 | NA | 6.72e-06 |
| 3. B | C0LGG8 | Probable LRR receptor-like serine/threonine-protein kinase At1g53430 | 1.00e-02 | NA | 7.45e-06 |
| 3. B | Q9SKK2 | Receptor like protein 21 | 5.41e-03 | NA | 1.37e-09 |
| 3. B | O94769 | Extracellular matrix protein 2 | 2.05e-04 | NA | 7.17e-08 |
| 3. B | Q9IB75 | Biglycan | 8.05e-09 | NA | 1.50e-05 |
| 3. B | Q920A0 | Opticin | 1.40e-06 | NA | 0.038 |
| 3. B | Q5XM32 | Relaxin receptor 2 | 1.80e-04 | NA | 2.87e-05 |
| 3. B | Q7XA42 | Putative disease resistance protein RGA1 | 3.74e-04 | NA | 0.003 |
| 3. B | P36047 | Protein phosphatase 1 regulatory subunit SDS22 | 4.30e-13 | NA | 0.012 |
| 3. B | Q68F79 | Volume-regulated anion channel subunit LRRC8E | 2.99e-06 | NA | 7.59e-12 |
| 3. B | B4JTV9 | Leucine-rich repeat protein soc-2 homolog | 6.01e-11 | NA | 9.63e-18 |
| 3. B | Q6IR85 | CCR4-NOT transcription complex subunit 6-like-A | 1.15e-02 | NA | 2.78e-05 |
| 3. B | C0LGX3 | LRR receptor-like serine/threonine-protein kinase HSL2 | 2.72e-06 | NA | 4.85e-08 |
| 3. B | A8WHP9 | Leucine-rich repeat-containing protein 3 | 2.83e-03 | NA | 0.005 |
| 3. B | Q9JJ28 | Protein flightless-1 homolog | 7.97e-04 | NA | 4.48e-13 |
| 3. B | V5NAL9 | Toll-like receptor 4 | 8.00e-03 | NA | 0.001 |
| 3. B | Q9LVM0 | Probable inactive receptor kinase At5g58300 | 2.96e-02 | NA | 0.005 |
| 3. B | Q9FN37 | Phytosulfokine receptor 2 | 1.85e-03 | NA | 7.09e-05 |
| 3. B | B0W6M9 | Leucine-rich repeat protein soc-2 homolog | 1.86e-08 | NA | 6.87e-17 |
| 3. B | Q6R6I6 | Relaxin receptor 1 | 2.02e-04 | NA | 6.30e-06 |
| 3. B | Q2QZF2 | Disease resistance protein PIK5-NP | 1.17e-03 | NA | 2.15e-13 |
| 3. B | Q810B7 | SLIT and NTRK-like protein 5 | 1.80e-02 | NA | 4.88e-04 |
| 3. B | Q9LRT1 | Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040 | 1.05e-03 | NA | 3.89e-07 |
| 3. B | O49325 | Receptor like protein 28 | 1.76e-03 | NA | 2.94e-05 |
| 3. B | O02833 | Insulin-like growth factor-binding protein complex acid labile subunit | 1.67e-05 | NA | 1.54e-04 |
| 3. B | Q922Q8 | Leucine-rich repeat-containing protein 59 | 1.49e-03 | NA | 5.85e-05 |
| 3. B | Q5R7M3 | Amphoterin-induced protein 2 | 2.58e-03 | NA | 0.002 |
| 3. B | P58822 | Polygalacturonase inhibitor 2 | 8.13e-10 | NA | 3.32e-05 |
| 3. B | O22476 | Protein BRASSINOSTEROID INSENSITIVE 1 | 4.59e-03 | NA | 9.36e-06 |
| 3. B | Q6JN46 | Receptor-like protein EIX2 | 3.99e-06 | NA | 0.003 |
| 3. B | Q9FPJ5 | Leucine-rich repeat protein 1 | 1.48e-04 | NA | 0.002 |
| 3. B | P0C192 | Leucine-rich repeat-containing protein 4B | 1.32e-04 | NA | 1.16e-04 |
| 3. B | A4IIK1 | Malignant fibrous histiocytoma-amplified sequence 1 homolog | 1.03e-06 | NA | 3.53e-17 |
| 3. B | Q9TTE2 | Decorin | 1.40e-08 | NA | 0.030 |
| 3. B | Q5DU41 | Volume-regulated anion channel subunit LRRC8B | 7.46e-07 | NA | 5.65e-09 |
| 3. B | Q5PP26 | Piriformospora indica-insensitive protein 2 | 1.85e-06 | NA | 0.017 |
| 3. B | O74874 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 5.46e-02 | NA | 2.46e-11 |
| 3. B | Q94AG2 | Somatic embryogenesis receptor kinase 1 | 3.23e-02 | NA | 0.036 |
| 3. B | C0LGF4 | LRR receptor-like serine/threonine-protein kinase FEI 1 | 1.62e-02 | NA | 5.01e-04 |
| 3. B | Q8SU52 | Probable CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 4.36e-03 | NA | 4.41e-13 |
| 3. B | Q9TZM3 | Leucine-rich repeat serine/threonine-protein kinase 1 | 9.99e-02 | NA | 0.003 |
| 3. B | P58681 | Toll-like receptor 7 | 2.65e-03 | NA | 0.004 |
| 3. B | P0CE12 | E3 ubiquitin-protein ligase SspH2 | 7.34e-04 | NA | 1.77e-06 |
| 3. B | Q9V477 | Toll-like receptor Tollo | 6.31e-03 | NA | 6.97e-07 |
| 3. B | C0LGH3 | Probable LRR receptor-like serine/threonine-protein kinase At1g56140 | 7.10e-03 | NA | 0.002 |
| 3. B | Q9T048 | Disease resistance protein At4g27190 | 2.69e-02 | NA | 0.002 |
| 3. B | Q8C110 | SLIT and NTRK-like protein 6 | 1.54e-03 | NA | 7.79e-04 |
| 3. B | Q7XA39 | Putative disease resistance protein RGA4 | 9.15e-04 | NA | 4.99e-04 |
| 3. B | O48788 | Probable inactive receptor kinase At2g26730 | 5.92e-03 | NA | 0.006 |
| 3. B | C0LGU5 | Probable LRR receptor-like serine/threonine-protein kinase At5g45780 | 2.29e-02 | NA | 0.036 |
| 3. B | B4QVR7 | Leucine-rich repeat protein soc-2 homolog | 1.92e-05 | NA | 1.34e-19 |
| 3. B | Q4R3P6 | Leucine-rich repeat-containing protein 40 | 1.82e-06 | NA | 6.91e-19 |
| 3. B | Q6P9F7 | Volume-regulated anion channel subunit LRRC8B | 8.05e-07 | NA | 1.85e-09 |
| 3. B | Q5A761 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 5.61e-02 | NA | 4.61e-08 |
| 3. B | O48851 | Receptor like protein 22 | 3.58e-05 | NA | 4.05e-06 |
| 3. B | C0LGL9 | LRR receptor-like serine/threonine-protein kinase FEI 2 | 1.76e-02 | NA | 3.43e-04 |
| 3. B | Q7F8Q9 | Leucine-rich repeat receptor protein kinase MSL1 | 3.42e-03 | NA | 2.36e-08 |
| 3. B | Q8GUQ5 | Brassinosteroid LRR receptor kinase | 1.12e-02 | NA | 2.32e-07 |
| 3. B | Q6XHB2 | Probable serine/threonine-protein kinase roco4 | 6.43e-01 | NA | 1.93e-05 |
| 3. B | O94898 | Leucine-rich repeats and immunoglobulin-like domains protein 2 | 1.59e-03 | NA | 2.21e-05 |
| 3. B | Q9LJW7 | Receptor-like protein 43 | 6.76e-05 | NA | 4.17e-05 |
| 3. B | A6NIV6 | Leucine-rich repeat and IQ domain-containing protein 4 | 7.13e-06 | NA | 1.05e-18 |
| 3. B | P24014 | Protein slit | 4.54e-02 | NA | 0.006 |
| 3. B | Q9LRR4 | Putative disease resistance RPP13-like protein 1 | 6.57e-03 | NA | 0.011 |
| 3. B | P62046 | Leucine-rich repeat and calponin homology domain-containing protein 1 | 5.14e-05 | NA | 8.89e-12 |
| 3. B | Q498T9 | Volume-regulated anion channel subunit LRRC8C | 3.18e-06 | NA | 9.74e-12 |
| 3. B | Q7FZR1 | Receptor-like protein 52 | 3.95e-04 | NA | 1.85e-06 |
| 3. B | Q9LT96 | Probable leucine-rich repeat receptor-like protein kinase At5g49770 | 2.77e-03 | NA | 4.70e-04 |
| 3. B | O60938 | Keratocan | 3.79e-11 | NA | 0.036 |
| 3. B | Q4V8G0 | Leucine-rich repeat-containing protein 63 | 2.88e-05 | NA | 3.03e-15 |
| 3. B | Q9S7I6 | LRR receptor-like serine/threonine-protein kinase RPK2 | 5.52e-03 | NA | 7.87e-07 |
| 3. B | Q8IW35 | Centrosomal protein of 97 kDa | 7.60e-04 | NA | 1.22e-05 |
| 3. B | C0LGI2 | Probable LRR receptor-like serine/threonine-protein kinase At1g67720 | 3.22e-01 | NA | 0.017 |
| 3. B | C0LGV1 | LRR receptor-like serine/threonine-protein kinase RGI2 | 2.73e-03 | NA | 7.24e-09 |
| 3. B | Q8C0R9 | Leucine-rich repeat and death domain-containing protein 1 | 1.26e-05 | NA | 1.64e-18 |
| 3. B | A4IFA6 | Immunoglobulin superfamily containing leucine-rich repeat protein | 1.42e-03 | NA | 0.025 |
| 3. B | Q9M2Y3 | Receptor-like protein 44 | 4.23e-04 | NA | 0.002 |
| 3. B | Q9M1L7 | Pollen receptor-like kinase 3 | 9.80e-03 | NA | 0.004 |
| 3. B | Q3KRC6 | Volume-regulated anion channel subunit LRRC8E | 8.15e-06 | NA | 5.02e-14 |
| 3. B | Q7XDQ7 | Plant intracellular Ras-group-related LRR protein 8 | 7.84e-09 | NA | 1.34e-16 |
| 3. B | O94933 | SLIT and NTRK-like protein 3 | 1.10e-02 | NA | 5.98e-04 |
| 3. B | Q9CZ62 | Centrosomal protein of 97 kDa | 1.47e-03 | NA | 1.06e-04 |
| 3. B | Q9VZZ4 | Peroxidasin | 1.51e-01 | NA | 0.001 |
| 3. B | Q06828 | Fibromodulin | 6.77e-11 | NA | 0.001 |
| 3. B | Q921G6 | Leucine-rich repeat and calponin homology domain-containing protein 4 | 6.51e-06 | NA | 1.14e-09 |
| 3. B | Q8WXD0 | Relaxin receptor 2 | 1.90e-04 | NA | 0.004 |
| 3. B | O81765 | Pollen-specific leucine-rich repeat extensin-like protein 4 | 7.71e-04 | NA | 9.20e-05 |
| 3. B | G2K3G6 | Internalin A | 2.86e-04 | NA | 0.001 |
| 3. B | Q84WJ9 | Protein phosphatase 1 regulatory inhibitor subunit PPP1R7 homolog | 2.44e-08 | NA | 0.022 |
| 3. B | Q0JA29 | LRR receptor-like serine/threonine-protein kinase FLS2 | 5.52e-03 | NA | 8.42e-12 |
| 3. B | Q4V8I7 | Volume-regulated anion channel subunit LRRC8A | 7.02e-07 | NA | 6.53e-12 |
| 3. B | E7FE13 | Leucine-rich repeat-containing G-protein coupled receptor 4 | 9.61e-05 | NA | 1.32e-11 |
| 3. B | C0LGJ1 | Probable LRR receptor-like serine/threonine-protein kinase At1g74360 | 1.19e-03 | NA | 2.35e-10 |
| 3. B | Q9NYK1 | Toll-like receptor 7 | 3.58e-03 | NA | 0.022 |
| 3. B | P23515 | Oligodendrocyte-myelin glycoprotein | 1.49e-05 | NA | 2.54e-12 |
| 3. B | Q9LJ64 | Pollen-specific leucine-rich repeat extensin-like protein 1 | 4.23e-03 | NA | 0.032 |
| 3. B | F4J9A8 | Receptor-like protein 45 | 7.63e-04 | NA | 7.52e-04 |
| 3. B | A5PK13 | Volume-regulated anion channel subunit LRRC8C | 8.95e-07 | NA | 1.90e-12 |
| 3. B | C0LGQ5 | LRR receptor-like serine/threonine-protein kinase GSO1 | 5.37e-03 | NA | 1.45e-10 |
| 3. B | F1NUK7 | Leucine-rich repeat transmembrane protein FLRT3 | 3.27e-05 | NA | 3.71e-06 |
| 3. B | Q5U308 | Volume-regulated anion channel subunit LRRC8D | 3.04e-06 | NA | 2.68e-14 |
| 3. B | Q496Z2 | TLR4 interactor with leucine rich repeats | 1.18e-03 | NA | 0.003 |
| 3. B | Q5R6T0 | Leucine-rich repeat transmembrane protein FLRT3 | 3.98e-05 | NA | 4.72e-07 |
| 3. B | Q5B778 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 4.68e-02 | NA | 6.93e-10 |
| 3. B | Q3MHH9 | Extracellular matrix protein 2 | 4.35e-08 | NA | 4.53e-07 |
| 3. B | C0LGG7 | Probable LRR receptor-like serine/threonine-protein kinase At1g53420 | 4.27e-03 | NA | 8.71e-06 |
| 3. B | Q5U508 | Tubulin-specific chaperone E | 4.99e-04 | NA | 3.24e-06 |
| 3. B | P28675 | Decorin | 9.96e-09 | NA | 0.020 |
| 3. B | Q8BLU0 | Leucine-rich repeat transmembrane protein FLRT2 | 1.24e-04 | NA | 0.014 |
| 3. B | A4D1F6 | Leucine-rich repeat and death domain-containing protein 1 | 2.16e-09 | NA | 1.45e-16 |
| 3. B | Q9FP13 | LRR receptor kinase SERL2 | 5.41e-02 | NA | 5.77e-04 |
| 3. B | P23466 | Adenylate cyclase | 2.17e-02 | NA | 9.91e-12 |
| 3. B | Q6XHA5 | Probable serine/threonine-protein kinase roco11 | 3.60e-01 | NA | 1.11e-05 |
| 3. B | B1H134 | Leucine-rich repeat transmembrane protein FLRT3 | 4.62e-05 | NA | 3.68e-04 |
| 3. B | Q5F4C4 | Leucine-rich repeat protein SHOC-2 | 2.16e-09 | NA | 4.20e-16 |
| 3. B | O49318 | Probable leucine-rich repeat receptor-like protein kinase At2g33170 | 5.19e-03 | NA | 1.41e-08 |
| 3. B | Q54TM7 | Probable serine/threonine-protein kinase drkD | 2.62e-02 | NA | 5.02e-12 |
| 3. B | F4JGB6 | Receptor-like protein 46 | 9.78e-04 | NA | 1.05e-06 |
| 3. B | F4K4T3 | Receptor-like protein 56 | 1.31e-06 | NA | 9.06e-07 |
| 3. B | C0LGS2 | Probable LRR receptor-like serine/threonine-protein kinase At4g36180 | 6.46e-03 | NA | 9.20e-10 |
| 3. B | Q9DE67 | Lumican | 1.38e-10 | NA | 0.001 |
| 3. B | P21793 | Decorin | 2.27e-08 | NA | 0.035 |
| 3. B | Q80WG5 | Volume-regulated anion channel subunit LRRC8A | 6.81e-07 | NA | 6.02e-12 |