Results | PROST

Summary

Q96CX6

Homolog: Q32NT4.
Function: Leucine-rich repeat-containing protein 58.

Statistics

Total GO Annotation: 680
Unique PROST Go: 127
Unique BLAST Go: 423

Total Homologs: 884
Unique PROST Homologs: 135
Unique BLAST Homologs: 630

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q32NT4 (Leucine-rich repeat-containing protein 58) with a FATCAT P-Value: 0.0 and RMSD of 3.22 angstrom. The sequence alignment identity is 66.8%.
Structural alignment shown in left. Query protein Q96CX6 colored as red in alignment, homolog Q32NT4 colored as blue. Query protein Q96CX6 is also shown in right top, homolog Q32NT4 showed in right bottom. They are colored based on secondary structures.

  Q96CX6 MEEAGAAVVTAGEAELNWSRLSVSTETLESELEARGEERRGAREALLRLLLPHNRLVSLPRALGSGFPHLQLLDVSGNALTALGPELLALRGLRTLLAKN 100
  Q32NT4 ME--GPE-VTDGDNVLNLTHLGL--ENL--NLELVSENKR--KD-VQQILLPHNRLVVLPPLVAS-FIHLHLLDISNNNMVYIGEEILGLTKLKTLLAKN 89

  Q96CX6 NRLGGPSALPK---GLAQSPLCRSLQVLNLSGNCFQEVPASLLELRALQTLSLGGNQLQSIPAEIENLQSLECLYLGGNFIKEIPPELGNLPSLNYLVLC 197
  Q32NT4 NRL-DEFSFPKEMGGM------R-LEVLNLSGNRFEEIPDQFLQIPTLKSLSLGGNRLKSIPAEIENLISLEFLYLGGNFISSIPSELANLPYLSYLVLC 181

  Q96CX6 DNKIQSIPPQLSQLHSLRSLSLHNNLLTYLPREILNLIHLEELSLRGNPLVVRFVRDLTYDPPTLLELAARTIKIRNISYTPYDLPGNLLRYLGSASNCP 297
  Q32NT4 DNRIQSIPPQLAQVHSLRSLSLHNNLLTYLPREILSLVHLHELSLRGNPLVVRFVRDLTYTPPTLLELAGRTIKSHGIPYCPWELPENLLRYLDLASKCP 281

  Q96CX6 NPKCGGVYFDCCVRQIKFVDFCGKYRLPLMHYLCSPECSSPCSSASHSSTSQSESDSEDEASVAARRMQKVLLG 371
  Q32NT4 NPKCSGVYFDCCVRQIKFVDFCGKYRLPLMHYLCSPECSSPCGSTSH-----SESDSEDEVNVAARRMQKVLLG 350

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
1. PB	GO:0010555	response to mannitol
1. PB	GO:0046007	negative regulation of activated T cell proliferation
1. PB	GO:0050729	positive regulation of inflammatory response
1. PB	GO:0032491	detection of molecule of fungal origin
1. PB	GO:0032755	positive regulation of interleukin-6 production
1. PB	GO:0002237	response to molecule of bacterial origin
1. PB	GO:0002718	regulation of cytokine production involved in immune response
1. PB	GO:0034123	positive regulation of toll-like receptor signaling pathway
1. PB	GO:0042043	neurexin family protein binding
1. PB	GO:0002225	positive regulation of antimicrobial peptide production
1. PB	GO:0002091	negative regulation of receptor internalization
1. PB	GO:0031430	M band
1. PB	GO:0030426	growth cone
1. PB	GO:0140059	dendrite arborization
1. PB	GO:0042567	insulin-like growth factor ternary complex
1. PB	GO:0032729	positive regulation of interferon-gamma production
1. PB	GO:0010376	stomatal complex formation
1. PB	GO:0061809	NAD+ nucleotidase, cyclic ADP-ribose generating
1. PB	GO:0099054	presynapse assembly
1. PB	GO:0090497	mesenchymal cell migration
1. PB	GO:0016201	synaptic target inhibition
1. PB	GO:0099060	integral component of postsynaptic specialization membrane
1. PB	GO:0048495	Roundabout binding
1. PB	GO:0005615	extracellular space
1. PB	GO:0060076	excitatory synapse
1. PB	GO:0009986	cell surface
1. PB	GO:0005030	neurotrophin receptor activity
1. PB	GO:0007165	signal transduction
1. PB	GO:0099061	integral component of postsynaptic density membrane
1. PB	GO:0004722	protein serine/threonine phosphatase activity
1. PB	GO:0050919	negative chemotaxis
1. PB	GO:0006954	inflammatory response
1. PB	GO:0098978	glutamatergic synapse
1. PB	GO:0050808	synapse organization
1. PB	GO:0043331	response to dsRNA
1. PB	GO:0055013	cardiac muscle cell development
1. PB	GO:0002756	MyD88-independent toll-like receptor signaling pathway
1. PB	GO:0052083	suppression by symbiont of host cell-mediated immune response
1. PB	GO:0010977	negative regulation of neuron projection development
1. PB	GO:0070062	extracellular exosome
1. PB	GO:0046813	receptor-mediated virion attachment to host cell
1. PB	GO:0097113	AMPA glutamate receptor clustering
1. PB	GO:0050431	transforming growth factor beta binding
1. PB	GO:0010073	meristem maintenance
1. PB	GO:0043231	intracellular membrane-bounded organelle
1. PB	GO:0034055	effector-mediated induction of programmed cell death in host
1. PB	GO:0038023	signaling receptor activity
1. PB	GO:0051770	positive regulation of nitric-oxide synthase biosynthetic process
1. PB	GO:0045671	negative regulation of osteoclast differentiation
1. PB	GO:1902875	regulation of embryonic pattern specification
1. PB	GO:0002730	regulation of dendritic cell cytokine production
1. PB	GO:0032728	positive regulation of interferon-beta production
1. PB	GO:1905034	regulation of antifungal innate immune response
1. PB	GO:1905606	regulation of presynapse assembly
1. PB	GO:0045087	innate immune response
1. PB	GO:0051897	positive regulation of protein kinase B signaling
1. PB	GO:0032722	positive regulation of chemokine production
1. PB	GO:0046790	virion binding
1. PB	GO:0022038	corpus callosum development
1. PB	GO:0044074	negative regulation by symbiont of host translation
1. PB	GO:0099104	potassium channel activator activity
1. PB	GO:0007411	axon guidance
1. PB	GO:0060291	long-term synaptic potentiation
1. PB	GO:0030500	regulation of bone mineralization
1. PB	GO:0010544	negative regulation of platelet activation
1. PB	GO:0032760	positive regulation of tumor necrosis factor production
1. PB	GO:1902004	positive regulation of amyloid-beta formation
1. PB	GO:1900155	negative regulation of bone trabecula formation
1. PB	GO:0035197	siRNA binding
1. PB	GO:1901398	regulation of transforming growth factor beta3 activation
1. PB	GO:0043236	laminin binding
1. PB	GO:0038187	pattern recognition receptor activity
1. PB	GO:0090696	post-embryonic plant organ development
1. PB	GO:0032727	positive regulation of interferon-alpha production
1. PB	GO:0008063	Toll signaling pathway
1. PB	GO:0007249	I-kappaB kinase/NF-kappaB signaling
1. PB	GO:1903818	positive regulation of voltage-gated potassium channel activity
1. PB	GO:0002224	toll-like receptor signaling pathway
1. PB	GO:0031012	extracellular matrix
1. PB	GO:0005518	collagen binding
1. PB	GO:0008201	heparin binding
1. PB	GO:0050135	NAD(P)+ nucleosidase activity
1. PB	GO:0072578	neurotransmitter-gated ion channel clustering
1. PB	GO:0001968	fibronectin binding
1. PB	GO:0032757	positive regulation of interleukin-8 production
1. PB	GO:0003401	axis elongation
1. PB	GO:0005789	endoplasmic reticulum membrane
1. PB	GO:0043395	heparan sulfate proteoglycan binding
1. PB	GO:0043204	perikaryon
1. PB	GO:0034158	toll-like receptor 8 signaling pathway
1. PB	GO:0007155	cell adhesion
1. PB	GO:0009597	detection of virus
1. PB	GO:0036020	endolysosome membrane
1. PB	GO:0051607	defense response to virus
1. PB	GO:0003677	DNA binding
1. PB	GO:0034346	positive regulation of type III interferon production
1. PB	GO:0043679	axon terminus
1. PB	GO:0051963	regulation of synapse assembly
1. PB	GO:0034138	toll-like receptor 3 signaling pathway
1. PB	GO:0043330	response to exogenous dsRNA
1. PB	GO:0098982	GABA-ergic synapse
1. PB	GO:0001932	regulation of protein phosphorylation
1. PB	GO:0032009	early phagosome
1. PB	GO:0048681	negative regulation of axon regeneration
1. PB	GO:1901388	regulation of transforming growth factor beta activation
1. PB	GO:0007252	I-kappaB phosphorylation
1. PB	GO:0051393	alpha-actinin binding
1. PB	GO:0002755	MyD88-dependent toll-like receptor signaling pathway
1. PB	GO:0030254	protein secretion by the type III secretion system
1. PB	GO:0051965	positive regulation of synapse assembly
1. PB	GO:1901629	regulation of presynaptic membrane organization
1. PB	GO:0031102	neuron projection regeneration
1. PB	GO:0002177	manchette
1. PB	GO:1903077	negative regulation of protein localization to plasma membrane
1. PB	GO:0062009	secondary palate development
1. PB	GO:0046872	metal ion binding
1. PB	GO:0099151	regulation of postsynaptic density assembly
1. PB	GO:0002240	response to molecule of oomycetes origin
1. PB	GO:0062023	collagen-containing extracellular matrix
1. PB	GO:0001818	negative regulation of cytokine production
1. PB	GO:0004888	transmembrane signaling receptor activity
1. PB	GO:0010811	positive regulation of cell-substrate adhesion
1. PB	GO:0042060	wound healing
1. PB	GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway
1. PB	GO:0048683	regulation of collateral sprouting of intact axon in response to injury
1. PB	GO:0046658	anchored component of plasma membrane
1. PB	GO:0007596	blood coagulation
1. PB	GO:0035374	chondroitin sulfate binding
1. PB	GO:0035640	exploration behavior
1. PB	GO:0030017	sarcomere
2. P	GO:0021540	corpus callosum morphogenesis
2. P	GO:0021766	hippocampus development
2. P	GO:0005768	endosome
2. P	GO:0005874	microtubule
2. P	GO:0006404	RNA import into nucleus
2. P	GO:0051932	synaptic transmission, GABAergic
2. P	GO:0005686	U2 snRNP
2. P	GO:0010375	stomatal complex patterning
2. P	GO:0002347	response to tumor cell
2. P	GO:0045121	membrane raft
2. P	GO:0090090	negative regulation of canonical Wnt signaling pathway
2. P	GO:0030424	axon
2. P	GO:0032733	positive regulation of interleukin-10 production
2. P	GO:0015459	potassium channel regulator activity
2. P	GO:0007021	tubulin complex assembly
2. P	GO:1902350	cellular response to chloroquine
2. P	GO:0003431	growth plate cartilage chondrocyte development
2. P	GO:0030620	U2 snRNA binding
2. P	GO:0045504	dynein heavy chain binding
2. P	GO:0009897	external side of plasma membrane
2. P	GO:0016200	synaptic target attraction
2. P	GO:0014005	microglia development
2. P	GO:0050871	positive regulation of B cell activation
2. P	GO:0035583	sequestering of TGFbeta in extracellular matrix
2. P	GO:1901895	negative regulation of ATPase-coupled calcium transmembrane transporter activity
2. P	GO:0033344	cholesterol efflux
2. P	GO:0005154	epidermal growth factor receptor binding
2. P	GO:0005815	microtubule organizing center
2. P	GO:0005524	ATP binding
2. P	GO:0006801	superoxide metabolic process
2. P	GO:0008076	voltage-gated potassium channel complex
2. P	GO:1990723	cytoplasmic periphery of the nuclear pore complex
2. P	GO:0030277	maintenance of gastrointestinal epithelium
2. P	GO:0036157	outer dynein arm
2. P	GO:0042995	cell projection
2. P	GO:0002804	positive regulation of antifungal peptide production
2. P	GO:0006955	immune response
2. P	GO:0010921	regulation of phosphatase activity
2. P	GO:0071805	potassium ion transmembrane transport
2. P	GO:0008203	cholesterol metabolic process
2. P	GO:0021670	lateral ventricle development
2. P	GO:0042635	positive regulation of hair cycle
2. P	GO:0070840	dynein complex binding
2. P	GO:0005783	endoplasmic reticulum
2. P	GO:0035418	protein localization to synapse
2. P	GO:0042622	photoreceptor outer segment membrane
2. P	GO:0030890	positive regulation of B cell proliferation
2. P	GO:0061073	ciliary body morphogenesis
2. P	GO:0051092	positive regulation of NF-kappaB transcription factor activity
2. P	GO:0006913	nucleocytoplasmic transport
2. P	GO:0050921	positive regulation of chemotaxis
2. P	GO:0034162	toll-like receptor 9 signaling pathway
2. P	GO:0040022	feminization of hermaphroditic germ-line
2. P	GO:0032911	negative regulation of transforming growth factor beta1 production
2. P	GO:0005856	cytoskeleton
2. P	GO:0045596	negative regulation of cell differentiation
2. P	GO:0060326	cell chemotaxis
2. P	GO:0051729	germline cell cycle switching, mitotic to meiotic cell cycle
2. P	GO:0048839	inner ear development
2. P	GO:0021960	anterior commissure morphogenesis
2. P	GO:0001944	vasculature development
2. P	GO:0036364	transforming growth factor beta1 activation
2. P	GO:0060122	inner ear receptor cell stereocilium organization
2. P	GO:0060760	positive regulation of response to cytokine stimulus
2. P	GO:0007179	transforming growth factor beta receptor signaling pathway
2. P	GO:0007023	post-chaperonin tubulin folding pathway
2. P	GO:0070983	dendrite guidance
2. P	GO:0036158	outer dynein arm assembly
2. P	GO:0016363	nuclear matrix
2. P	GO:0005764	lysosome
2. P	GO:0019834	phospholipase A2 inhibitor activity
2. P	GO:0043486	histone exchange
2. P	GO:0071014	post-mRNA release spliceosomal complex
2. P	GO:0032281	AMPA glutamate receptor complex
2. P	GO:1904761	negative regulation of myofibroblast differentiation
2. P	GO:1903124	negative regulation of thioredoxin peroxidase activity
2. P	GO:0032735	positive regulation of interleukin-12 production
2. P	GO:0036019	endolysosome
2. P	GO:0044325	transmembrane transporter binding
2. P	GO:0032715	negative regulation of interleukin-6 production
2. P	GO:0030425	dendrite
2. P	GO:0002218	activation of innate immune response
2. P	GO:0031103	axon regeneration
2. P	GO:0007166	cell surface receptor signaling pathway
2. P	GO:0046827	positive regulation of protein export from nucleus
2. P	GO:0045322	unmethylated CpG binding
2. P	GO:0098685	Schaffer collateral - CA1 synapse
2. P	GO:0043010	camera-type eye development
2. P	GO:0019212	phosphatase inhibitor activity
2. P	GO:0009277	fungal-type cell wall
2. P	GO:0005681	spliceosomal complex
2. P	GO:0071004	U2-type prespliceosome
2. P	GO:0022414	reproductive process
2. P	GO:0042393	histone binding
2. P	GO:0043014	alpha-tubulin binding
2. P	GO:0030286	dynein complex
2. P	GO:0032741	positive regulation of interleukin-18 production
2. P	GO:0048471	perinuclear region of cytoplasm
2. P	GO:0070373	negative regulation of ERK1 and ERK2 cascade
2. P	GO:0042632	cholesterol homeostasis
2. P	GO:0000398	mRNA splicing, via spliceosome
2. P	GO:0030178	negative regulation of Wnt signaling pathway
2. P	GO:0043410	positive regulation of MAPK cascade
2. P	GO:0097009	energy homeostasis
2. P	GO:0052170	suppression by symbiont of host innate immune response
2. P	GO:0002639	positive regulation of immunoglobulin production
2. P	GO:0031225	anchored component of membrane
2. P	GO:0042981	regulation of apoptotic process
2. P	GO:0021591	ventricular system development
2. P	GO:0030532	small nuclear ribonucleoprotein complex
2. P	GO:0071007	U2-type catalytic step 2 spliceosome
2. P	GO:0098868	bone growth
2. P	GO:0000812	Swr1 complex
2. P	GO:0034165	positive regulation of toll-like receptor 9 signaling pathway
2. P	GO:0015630	microtubule cytoskeleton
2. P	GO:0031505	fungal-type cell wall organization
2. P	GO:0003779	actin binding
2. P	GO:0015631	tubulin binding
2. P	GO:0045577	regulation of B cell differentiation
2. P	GO:0098686	hippocampal mossy fiber to CA3 synapse
2. P	GO:0035208	positive regulation of hemocyte proliferation
2. P	GO:0019838	growth factor binding
2. P	GO:0005249	voltage-gated potassium channel activity
2. P	GO:0008355	olfactory learning
2. P	GO:1904117	cellular response to vasopressin
2. P	GO:0034163	regulation of toll-like receptor 9 signaling pathway
2. P	GO:0002752	cell surface pattern recognition receptor signaling pathway
3. B	GO:0003345	proepicardium cell migration involved in pericardium morphogenesis
3. B	GO:0030198	extracellular matrix organization
3. B	GO:0030014	CCR4-NOT complex
3. B	GO:0009729	detection of brassinosteroid stimulus
3. B	GO:0016080	synaptic vesicle targeting
3. B	GO:0090141	positive regulation of mitochondrial fission
3. B	GO:0044300	cerebellar mossy fiber
3. B	GO:0090037	positive regulation of protein kinase C signaling
3. B	GO:2001013	epithelial cell proliferation involved in renal tubule morphogenesis
3. B	GO:0007089	traversing start control point of mitotic cell cycle
3. B	GO:1903217	negative regulation of protein processing involved in protein targeting to mitochondrion
3. B	GO:0010640	regulation of platelet-derived growth factor receptor signaling pathway
3. B	GO:0061161	positive regulation of establishment of bipolar cell polarity regulating cell shape
3. B	GO:0005095	GTPase inhibitor activity
3. B	GO:0030539	male genitalia development
3. B	GO:0010069	zygote asymmetric cytokinesis in embryo sac
3. B	GO:0060412	ventricular septum morphogenesis
3. B	GO:0015734	taurine transport
3. B	GO:0090406	pollen tube
3. B	GO:0030021	extracellular matrix structural constituent conferring compression resistance
3. B	GO:0045663	positive regulation of myoblast differentiation
3. B	GO:0019903	protein phosphatase binding
3. B	GO:0106310	protein serine kinase activity
3. B	GO:0009553	embryo sac development
3. B	GO:0035025	positive regulation of Rho protein signal transduction
3. B	GO:0120103	centriolar subdistal appendage
3. B	GO:0008330	protein tyrosine/threonine phosphatase activity
3. B	GO:0050840	extracellular matrix binding
3. B	GO:0060581	cell fate commitment involved in pattern specification
3. B	GO:0072282	metanephric nephron tubule morphogenesis
3. B	GO:0016239	positive regulation of macroautophagy
3. B	GO:0003725	double-stranded RNA binding
3. B	GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules
3. B	GO:1904027	negative regulation of collagen fibril organization
3. B	GO:0106307
3. B	GO:0030054	cell junction
3. B	GO:0045930	negative regulation of mitotic cell cycle
3. B	GO:0098887	neurotransmitter receptor transport, endosome to postsynaptic membrane
3. B	GO:0000076	DNA replication checkpoint signaling
3. B	GO:0030534	adult behavior
3. B	GO:0061975	articular cartilage development
3. B	GO:2001222	regulation of neuron migration
3. B	GO:0060348	bone development
3. B	GO:0001768	establishment of T cell polarity
3. B	GO:0044753	amphisome
3. B	GO:0140360	cyclic-GMP-AMP transmembrane transporter activity
3. B	GO:0032588	trans-Golgi network membrane
3. B	GO:0071485	cellular response to absence of light
3. B	GO:0070086	ubiquitin-dependent endocytosis
3. B	GO:0016336	establishment or maintenance of polarity of larval imaginal disc epithelium
3. B	GO:0042734	presynaptic membrane
3. B	GO:0042551	neuron maturation
3. B	GO:0050929	induction of negative chemotaxis
3. B	GO:0009934	regulation of meristem structural organization
3. B	GO:0017046	peptide hormone binding
3. B	GO:0090548	response to nitrate starvation
3. B	GO:0034142	toll-like receptor 4 signaling pathway
3. B	GO:0034750	Scrib-APC-beta-catenin complex
3. B	GO:0099560	synaptic membrane adhesion
3. B	GO:0007601	visual perception
3. B	GO:0099400	caveola neck
3. B	GO:0030239	myofibril assembly
3. B	GO:0005887	integral component of plasma membrane
3. B	GO:0009742	brassinosteroid mediated signaling pathway
3. B	GO:0071215	cellular response to abscisic acid stimulus
3. B	GO:0030056	hemidesmosome
3. B	GO:0098968	neurotransmitter receptor transport postsynaptic membrane to endosome
3. B	GO:0017017	MAP kinase tyrosine/serine/threonine phosphatase activity
3. B	GO:0004532	exoribonuclease activity
3. B	GO:0035385	Roundabout signaling pathway
3. B	GO:0060561	apoptotic process involved in morphogenesis
3. B	GO:0048437	floral organ development
3. B	GO:0006952	defense response
3. B	GO:0002758	innate immune response-activating signal transduction
3. B	GO:0010088	phloem development
3. B	GO:0040036	regulation of fibroblast growth factor receptor signaling pathway
3. B	GO:0004672	protein kinase activity
3. B	GO:0019800	peptide cross-linking via chondroitin 4-sulfate glycosaminoglycan
3. B	GO:0008528	G protein-coupled peptide receptor activity
3. B	GO:0010067	procambium histogenesis
3. B	GO:0010359	regulation of anion channel activity
3. B	GO:0005104	fibroblast growth factor receptor binding
3. B	GO:1903980	positive regulation of microglial cell activation
3. B	GO:0042730	fibrinolysis
3. B	GO:0070997	neuron death
3. B	GO:0010078	maintenance of root meristem identity
3. B	GO:0048481	plant ovule development
3. B	GO:0043928	exonucleolytic catabolism of deadenylated mRNA
3. B	GO:0061290	canonical Wnt signaling pathway involved in metanephric kidney development
3. B	GO:0010063	positive regulation of trichoblast fate specification
3. B	GO:0106311
3. B	GO:0048833	specification of floral organ number
3. B	GO:0010227	floral organ abscission
3. B	GO:0005496	steroid binding
3. B	GO:0036335	intestinal stem cell homeostasis
3. B	GO:0034137	positive regulation of toll-like receptor 2 signaling pathway
3. B	GO:0050772	positive regulation of axonogenesis
3. B	GO:0080092	regulation of pollen tube growth
3. B	GO:0071666	Slit-Robo signaling complex
3. B	GO:0071287	cellular response to manganese ion
3. B	GO:0030374	nuclear receptor coactivator activity
3. B	GO:0090288	negative regulation of cellular response to growth factor stimulus
3. B	GO:1902499	positive regulation of protein autoubiquitination
3. B	GO:0031223	auditory behavior
3. B	GO:0051646	mitochondrion localization
3. B	GO:0032914	positive regulation of transforming growth factor beta1 production
3. B	GO:0006281	DNA repair
3. B	GO:0007409	axonogenesis
3. B	GO:0043069	negative regulation of programmed cell death
3. B	GO:1900744	regulation of p38MAPK cascade
3. B	GO:0022028	tangential migration from the subventricular zone to the olfactory bulb
3. B	GO:1905279	regulation of retrograde transport, endosome to Golgi
3. B	GO:0005911	cell-cell junction
3. B	GO:1901333	positive regulation of lateral root development
3. B	GO:0008543	fibroblast growth factor receptor signaling pathway
3. B	GO:0048831	regulation of shoot system development
3. B	GO:0042562	hormone binding
3. B	GO:1902018	negative regulation of cilium assembly
3. B	GO:0030859	polarized epithelial cell differentiation
3. B	GO:0005737	cytoplasm
3. B	GO:0048226	Casparian strip
3. B	GO:0097120	receptor localization to synapse
3. B	GO:1990523	bone regeneration
3. B	GO:0004535	poly(A)-specific ribonuclease activity
3. B	GO:0014009	glial cell proliferation
3. B	GO:2000405	negative regulation of T cell migration
3. B	GO:1902288	regulation of defense response to oomycetes
3. B	GO:0009755	hormone-mediated signaling pathway
3. B	GO:0070831	basement membrane assembly
3. B	GO:0090619	meiotic spindle pole
3. B	GO:0000932	P-body
3. B	GO:0001649	osteoblast differentiation
3. B	GO:0048565	digestive tract development
3. B	GO:0010102	lateral root morphogenesis
3. B	GO:0035335	peptidyl-tyrosine dephosphorylation
3. B	GO:0010955	negative regulation of protein processing
3. B	GO:0120163	negative regulation of cold-induced thermogenesis
3. B	GO:0031047	gene silencing by RNA
3. B	GO:0034154	toll-like receptor 7 signaling pathway
3. B	GO:0030015	CCR4-NOT core complex
3. B	GO:0099072	regulation of postsynaptic membrane neurotransmitter receptor levels
3. B	GO:0004675	transmembrane receptor protein serine/threonine kinase activity
3. B	GO:0019806	bromide peroxidase activity
3. B	GO:0005614	interstitial matrix
3. B	GO:0098633	collagen fibril binding
3. B	GO:0034122	negative regulation of toll-like receptor signaling pathway
3. B	GO:1902533	positive regulation of intracellular signal transduction
3. B	GO:0050918	positive chemotaxis
3. B	GO:0010080	regulation of floral meristem growth
3. B	GO:0051901	positive regulation of mitochondrial depolarization
3. B	GO:0048598	embryonic morphogenesis
3. B	GO:0005225	volume-sensitive anion channel activity
3. B	GO:0036289	peptidyl-serine autophosphorylation
3. B	GO:0000175	3'-5'-exoribonuclease activity
3. B	GO:0008285	negative regulation of cell population proliferation
3. B	GO:0045197	establishment or maintenance of epithelial cell apical/basal polarity
3. B	GO:0004016	adenylate cyclase activity
3. B	GO:0035996	rhabdomere microvillus
3. B	GO:0032497	detection of lipopolysaccharide
3. B	GO:0010305	leaf vascular tissue pattern formation
3. B	GO:0032185	septin cytoskeleton organization
3. B	GO:0000287	magnesium ion binding
3. B	GO:0061364	apoptotic process involved in luteolysis
3. B	GO:0034136	negative regulation of toll-like receptor 2 signaling pathway
3. B	GO:0090190	positive regulation of branching involved in ureteric bud morphogenesis
3. B	GO:2000067	regulation of root morphogenesis
3. B	GO:0007567	parturition
3. B	GO:1902692	regulation of neuroblast proliferation
3. B	GO:0005539	glycosaminoglycan binding
3. B	GO:0032584	growth cone membrane
3. B	GO:0090024	negative regulation of neutrophil chemotaxis
3. B	GO:0072224	metanephric glomerulus development
3. B	GO:0031362	anchored component of external side of plasma membrane
3. B	GO:0009994	oocyte differentiation
3. B	GO:0032473	cytoplasmic side of mitochondrial outer membrane
3. B	GO:0016593	Cdc73/Paf1 complex
3. B	GO:0060007	linear vestibuloocular reflex
3. B	GO:0010593	negative regulation of lamellipodium assembly
3. B	GO:0030154	cell differentiation
3. B	GO:0060027	convergent extension involved in gastrulation
3. B	GO:0010082	regulation of root meristem growth
3. B	GO:0002093	auditory receptor cell morphogenesis
3. B	GO:0016021	integral component of membrane
3. B	GO:0046579	positive regulation of Ras protein signal transduction
3. B	GO:1901727	positive regulation of histone deacetylase activity
3. B	GO:0001653	peptide receptor activity
3. B	GO:0031175	neuron projection development
3. B	GO:0045499	chemorepellent activity
3. B	GO:0034260	negative regulation of GTPase activity
3. B	GO:1903224	regulation of endodermal cell differentiation
3. B	GO:0060161	positive regulation of dopamine receptor signaling pathway
3. B	GO:0004714	transmembrane receptor protein tyrosine kinase activity
3. B	GO:0002238	response to molecule of fungal origin
3. B	GO:0042802	identical protein binding
3. B	GO:0032474	otolith morphogenesis
3. B	GO:0034211	GTP-dependent protein kinase activity
3. B	GO:0071711	basement membrane organization
3. B	GO:0010449	root meristem growth
3. B	GO:0042277	peptide binding
3. B	GO:0009556	microsporogenesis
3. B	GO:0043198	dendritic shaft
3. B	GO:0038131	neuregulin receptor activity
3. B	GO:0005589	collagen type VI trimer
3. B	GO:0055046	microgametogenesis
3. B	GO:0004706	JUN kinase kinase kinase activity
3. B	GO:0005201	extracellular matrix structural constituent
3. B	GO:0005796	Golgi lumen
3. B	GO:0070052	collagen V binding
3. B	GO:0099147	extrinsic component of postsynaptic density membrane
3. B	GO:0006884	cell volume homeostasis
3. B	GO:0043615	astrocyte cell migration
3. B	GO:0070430	positive regulation of nucleotide-binding oligomerization domain containing 1 signaling pathway
3. B	GO:0048281	inflorescence morphogenesis
3. B	GO:0060026	convergent extension
3. B	GO:0071470	cellular response to osmotic stress
3. B	GO:0006468	protein phosphorylation
3. B	GO:1904417	positive regulation of xenophagy
3. B	GO:0071672	negative regulation of smooth muscle cell chemotaxis
3. B	GO:0010103	stomatal complex morphogenesis
3. B	GO:0099179	regulation of synaptic membrane adhesion
3. B	GO:0016500	protein-hormone receptor activity
3. B	GO:0060628	regulation of ER to Golgi vesicle-mediated transport
3. B	GO:0050732	negative regulation of peptidyl-tyrosine phosphorylation
3. B	GO:1900150	regulation of defense response to fungus
3. B	GO:0050896	response to stimulus
3. B	GO:0007416	synapse assembly
3. B	GO:1904887	Wnt signalosome assembly
3. B	GO:0048508	embryonic meristem development
3. B	GO:0071260	cellular response to mechanical stimulus
3. B	GO:0031349	positive regulation of defense response
3. B	GO:0002667	regulation of T cell anergy
3. B	GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway
3. B	GO:0002329	pre-B cell differentiation
3. B	GO:1902803	regulation of synaptic vesicle transport
3. B	GO:0010075	regulation of meristem growth
3. B	GO:0010606	positive regulation of cytoplasmic mRNA processing body assembly
3. B	GO:0014041	regulation of neuron maturation
3. B	GO:0097060	synaptic membrane
3. B	GO:1905573	ganglioside GM1 binding
3. B	GO:0045108	regulation of intermediate filament polymerization or depolymerization
3. B	GO:0070100	negative regulation of chemokine-mediated signaling pathway
3. B	GO:0005886	plasma membrane
3. B	GO:1903351	cellular response to dopamine
3. B	GO:0010054	trichoblast differentiation
3. B	GO:0070966	nuclear-transcribed mRNA catabolic process, no-go decay
3. B	GO:0030714	anterior/posterior axis specification, follicular epithelium
3. B	GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling
3. B	GO:0061343	cell adhesion involved in heart morphogenesis
3. B	GO:0019199	transmembrane receptor protein kinase activity
3. B	GO:0010596	negative regulation of endothelial cell migration
3. B	GO:0030282	bone mineralization
3. B	GO:0005176	ErbB-2 class receptor binding
3. B	GO:2000280	regulation of root development
3. B	GO:0009826	unidimensional cell growth
3. B	GO:0042659	regulation of cell fate specification
3. B	GO:1905103	integral component of lysosomal membrane
3. B	GO:0044295	axonal growth cone
3. B	GO:0021972	corticospinal neuron axon guidance through spinal cord
3. B	GO:0003181	atrioventricular valve morphogenesis
3. B	GO:0045175	basal protein localization
3. B	GO:0090038	negative regulation of protein kinase C signaling
3. B	GO:0071676	negative regulation of mononuclear cell migration
3. B	GO:0002689	negative regulation of leukocyte chemotaxis
3. B	GO:0051014	actin filament severing
3. B	GO:0072202	cell differentiation involved in metanephros development
3. B	GO:0008157	protein phosphatase 1 binding
3. B	GO:0023041	neuronal signal transduction
3. B	GO:0005199	structural constituent of cell wall
3. B	GO:0006171	cAMP biosynthetic process
3. B	GO:0001974	blood vessel remodeling
3. B	GO:0032731	positive regulation of interleukin-1 beta production
3. B	GO:0051900	regulation of mitochondrial depolarization
3. B	GO:0060322	head development
3. B	GO:0003184	pulmonary valve morphogenesis
3. B	GO:0043531	ADP binding
3. B	GO:0060862	negative regulation of floral organ abscission
3. B	GO:0043030	regulation of macrophage activation
3. B	GO:0010071	root meristem specification
3. B	GO:0060427	lung connective tissue development
3. B	GO:0000188	obsolete inactivation of MAPK activity
3. B	GO:1990268	response to gold nanoparticle
3. B	GO:0048229	gametophyte development
3. B	GO:0009649	entrainment of circadian clock
3. B	GO:0005583	fibrillar collagen trimer
3. B	GO:0021836	chemorepulsion involved in postnatal olfactory bulb interneuron migration
3. B	GO:0010183	pollen tube guidance
3. B	GO:0140058	neuron projection arborization
3. B	GO:0032495	response to muramyl dipeptide
3. B	GO:0032809	neuronal cell body membrane
3. B	GO:0098609	cell-cell adhesion
3. B	GO:0014069	postsynaptic density
3. B	GO:0060658	nipple morphogenesis
3. B	GO:0033612	receptor serine/threonine kinase binding
3. B	GO:0050673	epithelial cell proliferation
3. B	GO:0014912	negative regulation of smooth muscle cell migration
3. B	GO:0010152	pollen maturation
3. B	GO:0016045	detection of bacterium
3. B	GO:0106306
3. B	GO:1900747	negative regulation of vascular endothelial growth factor signaling pathway
3. B	GO:1903206	negative regulation of hydrogen peroxide-induced cell death
3. B	GO:0007639	homeostasis of number of meristem cells
3. B	GO:0035970	peptidyl-threonine dephosphorylation
3. B	GO:0051414	response to cortisol
3. B	GO:0010508	positive regulation of autophagy
3. B	GO:0070973	protein localization to endoplasmic reticulum exit site
3. B	GO:0048653	anther development
3. B	GO:0035089	establishment of apical/basal cell polarity
3. B	GO:0043202	lysosomal lumen
3. B	GO:0032968	positive regulation of transcription elongation from RNA polymerase II promoter
3. B	GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules
3. B	GO:0140361	cyclic-GMP-AMP transmembrane import across plasma membrane
3. B	GO:0010008	endosome membrane
3. B	GO:0070171	negative regulation of tooth mineralization
3. B	GO:0009506	plasmodesma
3. B	GO:1905289	regulation of CAMKK-AMPK signaling cascade
3. B	GO:0060603	mammary gland duct morphogenesis
3. B	GO:0090263	positive regulation of canonical Wnt signaling pathway
3. B	GO:0051058	negative regulation of small GTPase mediated signal transduction
3. B	GO:0030517	negative regulation of axon extension
3. B	GO:0071504	cellular response to heparin
3. B	GO:0140426	PAMP-triggered immunity signalling pathway
3. B	GO:0043237	laminin-1 binding
3. B	GO:0035308	negative regulation of protein dephosphorylation
3. B	GO:0007190	activation of adenylate cyclase activity
3. B	GO:0090260	negative regulation of retinal ganglion cell axon guidance
3. B	GO:1900244	positive regulation of synaptic vesicle endocytosis
3. B	GO:0035751	regulation of lysosomal lumen pH
3. B	GO:0043194	axon initial segment
3. B	GO:0046849	bone remodeling
3. B	GO:0071896	protein localization to adherens junction
3. B	GO:0046777	protein autophosphorylation
3. B	GO:0001942	hair follicle development
3. B	GO:0048846	axon extension involved in axon guidance
3. B	GO:0034702	ion channel complex
3. B	GO:0034144	negative regulation of toll-like receptor 4 signaling pathway
3. B	GO:0009626	plant-type hypersensitive response
3. B	GO:0060866	leaf abscission
3. B	GO:0016020	membrane
3. B	GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest
3. B	GO:0016323	basolateral plasma membrane
3. B	GO:0097487	multivesicular body, internal vesicle
3. B	GO:0070433	negative regulation of nucleotide-binding oligomerization domain containing 2 signaling pathway
3. B	GO:0010234	anther wall tapetum cell fate specification
3. B	GO:0060384	innervation
3. B	GO:0035564	regulation of kidney size
3. B	GO:0004674	protein serine/threonine kinase activity
3. B	GO:0099059	integral component of presynaptic active zone membrane
3. B	GO:0048657	anther wall tapetum cell differentiation
3. B	GO:0005520	insulin-like growth factor binding
3. B	GO:1904713	beta-catenin destruction complex binding
3. B	GO:0021772	olfactory bulb development
3. B	GO:0045089	positive regulation of innate immune response
3. B	GO:0098742	cell-cell adhesion via plasma-membrane adhesion molecules
3. B	GO:0061303	cornea development in camera-type eye
3. B	GO:1902025	nitrate import
3. B	GO:0021747	cochlear nucleus development
3. B	GO:1905576	ganglioside GT1b binding
3. B	GO:0071638	negative regulation of monocyte chemotactic protein-1 production
3. B	GO:0010059	positive regulation of atrichoblast fate specification
3. B	GO:0032870	cellular response to hormone stimulus
3. B	GO:0034166	toll-like receptor 10 signaling pathway
3. B	GO:0046755	viral budding
3. B	GO:0090394	negative regulation of excitatory postsynaptic potential
3. B	GO:1990909	Wnt signalosome
3. B	GO:0031150	sorocarp stalk development
3. B	GO:0003180	aortic valve morphogenesis
3. B	GO:0021756	striatum development
3. B	GO:0015810	aspartate transmembrane transport
3. B	GO:0008154	actin polymerization or depolymerization
3. B	GO:0042246	tissue regeneration
3. B	GO:2000172	regulation of branching morphogenesis of a nerve
3. B	GO:0035748	myelin sheath abaxonal region
3. B	GO:0060159	regulation of dopamine receptor signaling pathway
3. B	GO:0044754	autolysosome
3. B	GO:0036035	osteoclast development
3. B	GO:0048678	response to axon injury
3. B	GO:1990138	neuron projection extension
3. B	GO:0010087	phloem or xylem histogenesis
3. B	GO:0001678	cellular glucose homeostasis
3. B	GO:0005102	signaling receptor binding
3. B	GO:0045806	negative regulation of endocytosis
3. B	GO:0046330	positive regulation of JNK cascade
3. B	GO:0009505	plant-type cell wall
3. B	GO:0048478	replication fork protection
3. B	GO:0010051	xylem and phloem pattern formation
3. B	GO:0009945	radial axis specification
3. B	GO:0048539	bone marrow development
3. B	GO:0043068	positive regulation of programmed cell death
3. B	GO:0050807	regulation of synapse organization
3. B	GO:0099055	integral component of postsynaptic membrane
3. B	GO:0001530	lipopolysaccharide binding
3. B	GO:0042592	homeostatic process
3. B	GO:0051019	mitogen-activated protein kinase binding
3. B	GO:0046328	regulation of JNK cascade
3. B	GO:1905421	regulation of plant organ morphogenesis
3. B	GO:0036479	peroxidase inhibitor activity
3. B	GO:0050832	defense response to fungus
3. B	GO:0097708	intracellular vesicle
3. B	GO:0090708	specification of plant organ axis polarity
3. B	GO:0043113	receptor clustering
3. B	GO:0000289	nuclear-transcribed mRNA poly(A) tail shortening
3. B	GO:0034214	protein hexamerization
3. B	GO:0098656	anion transmembrane transport
3. B	GO:0046696	lipopolysaccharide receptor complex
3. B	GO:0005618	cell wall
3. B	GO:0001875	lipopolysaccharide immune receptor activity
3. B	GO:0090027	negative regulation of monocyte chemotaxis
3. B	GO:0021562	vestibulocochlear nerve development
3. B	GO:1903125	negative regulation of thioredoxin peroxidase activity by peptidyl-threonine phosphorylation
3. B	GO:0005925	focal adhesion
3. B	GO:0048679	regulation of axon regeneration
3. B	GO:1901528	hydrogen peroxide mediated signaling pathway involved in stomatal movement
3. B	GO:1903215	negative regulation of protein targeting to mitochondrion
3. B	GO:0006820	anion transport
3. B	GO:0030199	collagen fibril organization
3. B	GO:0016525	negative regulation of angiogenesis
3. B	GO:0051016	barbed-end actin filament capping
3. B	GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway
3. B	GO:0000164	protein phosphatase type 1 complex
3. B	GO:1902823	negative regulation of late endosome to lysosome transport
3. B	GO:0010074	maintenance of meristem identity
3. B	GO:0035239	tube morphogenesis
3. B	GO:1901224	positive regulation of NIK/NF-kappaB signaling

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	A4IHG1	Leucine-rich repeat-containing protein 58	0.00e+00	8.63e-65	1.54e-151
1. PB	O08770	Platelet glycoprotein V	2.10e-04	1.70e-07	9.32e-07
1. PB	Q7L985	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2	7.27e-04	1.35e-05	6.63e-04
1. PB	Q32NT4	Leucine-rich repeat-containing protein 58	0.00e+00	8.63e-65	2.74e-153
1. PB	Q9D1G5	Leucine-rich repeat-containing protein 57	1.34e-10	4.65e-05	8.67e-14
1. PB	Q8BGA3	Leucine-rich repeat transmembrane neuronal protein 2	2.37e-06	8.83e-04	4.68e-10
1. PB	Q8N456	Leucine-rich repeat-containing protein 18	5.37e-06	2.72e-18	6.17e-10
1. PB	Q9CQ76	Nephrocan	6.37e-07	9.96e-06	5.80e-06
1. PB	Q9D9Q0	Leucine-rich repeat-containing protein 69	1.75e-10	1.13e-37	1.61e-15
1. PB	C0LGP4	Probable LRR receptor-like serine/threonine-protein kinase At3g47570	2.26e-03	3.10e-02	9.19e-08
1. PB	O93233	Phospholipase A2 inhibitor	1.08e-07	4.36e-04	1.08e-06
1. PB	Q80VQ1	Leucine-rich repeat-containing protein 1	6.67e-06	1.86e-07	3.59e-14
1. PB	Q5G5D8	Plant intracellular Ras-group-related LRR protein 7	1.17e-07	3.12e-11	1.24e-10
1. PB	A1A4H9	Leucine-rich repeat transmembrane neuronal protein 1	2.57e-05	8.23e-05	3.66e-08
1. PB	A6NM36	Leucine-rich repeat-containing protein 30	5.77e-12	1.37e-02	8.69e-13
1. PB	Q86UN2	Reticulon-4 receptor-like 1	2.60e-05	3.23e-02	0.001
1. PB	Q9DBB9	Carboxypeptidase N subunit 2	3.23e-05	2.84e-06	4.09e-11
1. PB	Q8R2R5	Leucine-rich repeat-containing protein 61	1.80e-03	3.66e-08	6.64e-04
1. PB	Q8CI70	Leucine-rich repeat-containing protein 20	6.97e-06	1.04e-03	4.43e-05
1. PB	Q96L50	Leucine-rich repeat protein 1	1.56e-07	2.16e-03	4.92e-17
1. PB	Q5E9C0	Ras suppressor protein 1	1.34e-08	1.76e-12	2.11e-16
1. PB	Q9BV99	Leucine-rich repeat-containing protein 61	8.93e-04	5.56e-08	0.003
1. PB	O43300	Leucine-rich repeat transmembrane neuronal protein 2	6.42e-05	1.09e-04	1.24e-09
1. PB	Q9Z0L0	Trophoblast glycoprotein	5.70e-05	7.58e-04	0.025
1. PB	Q9CQ07	Leucine-rich repeat-containing protein 18	9.70e-06	9.07e-19	7.81e-11
1. PB	F1R6I3	Leucine-rich repeat-containing protein 39	1.58e-10	1.70e-04	5.21e-17
1. PB	Q8TF66	Leucine-rich repeat-containing protein 15	3.25e-05	1.20e-03	1.67e-07
1. PB	Q6DHL5	Leucine-rich repeat-containing protein 57	8.01e-11	1.22e-03	1.80e-18
1. PB	O15335	Chondroadherin	7.79e-07	7.67e-03	0.006
1. PB	P90920	Leucine-rich repeat-containing protein egg-6	7.98e-04	3.33e-02	1.64e-06
1. PB	P70389	Insulin-like growth factor-binding protein complex acid labile subunit	1.63e-05	4.82e-02	2.22e-07
1. PB	Q9SVM3	Receptor-like protein 49	4.81e-03	4.91e-02	3.10e-04
1. PB	Q86UE6	Leucine-rich repeat transmembrane neuronal protein 1	3.29e-05	5.41e-05	4.49e-09
1. PB	Q3KQF4	Leucine-rich repeat-containing protein 69	7.51e-11	7.56e-38	1.31e-16
1. PB	D3ZAL8	Leucine-rich repeat transmembrane neuronal protein 3	9.28e-05	1.63e-02	2.40e-08
1. PB	Q9BTT6	Leucine-rich repeat-containing protein 1	2.57e-05	4.40e-07	2.06e-14
1. PB	Q24K06	Leucine-rich repeat-containing protein 10	1.43e-11	3.73e-13	3.74e-14
1. PB	Q5R6B1	Leucine-rich repeat transmembrane neuronal protein 1	2.00e-05	5.16e-05	2.80e-09
1. PB	Q9NR96	Toll-like receptor 9	5.82e-03	6.78e-03	0.008
1. PB	Q9LUI1	Leucine-rich repeat extensin-like protein 6	1.02e-04	3.27e-03	0.005
1. PB	D4A7P2	Leucine-rich repeat transmembrane neuronal protein 2	2.18e-05	7.49e-04	7.53e-11
1. PB	O70210	Chondroadherin	5.64e-07	3.39e-02	0.006
1. PB	P40197	Platelet glycoprotein V	6.98e-05	1.59e-07	1.36e-05
1. PB	O15455	Toll-like receptor 3	1.01e-04	9.13e-03	8.13e-05
1. PB	Q14392	Transforming growth factor beta activator LRRC32	1.11e-08	5.74e-03	0.006
1. PB	Q9C9H7	Receptor-like protein 12	3.02e-07	6.78e-03	4.85e-08
1. PB	D4A6D8	Leucine-rich repeat transmembrane neuronal protein 1	2.74e-05	1.29e-04	5.48e-08
1. PB	Q86VH5	Leucine-rich repeat transmembrane neuronal protein 3	5.85e-05	4.96e-02	0.046
1. PB	Q8R5M3	Leucine-rich repeat-containing protein 15	1.44e-04	2.18e-03	1.27e-08
1. PB	Q27972	Chondroadherin	NA	3.00e-03	0.005
1. PB	G9LZD7	Probable inactive leucine-rich repeat receptor kinase XIAO	5.02e-03	2.26e-02	2.00e-12
1. PB	Q9C9H6	Receptor-like protein 11	2.36e-05	6.78e-03	1.23e-05
1. PB	Q15404	Ras suppressor protein 1	1.24e-08	2.86e-14	2.49e-16
1. PB	Q7Z2Q7	Leucine-rich repeat-containing protein 70	1.14e-04	1.28e-02	4.63e-06
1. PB	Q9Z1S7	Osteomodulin	1.52e-06	2.51e-06	4.59e-08
1. PB	Q149C3	Leucine-rich repeat and immunoglobulin-like domain containing-NOGO receptor-interacting protein 4	3.06e-04	1.29e-07	0.045
1. PB	D3ZXS4	Leucine-rich repeat-containing protein 39	1.00e-09	3.41e-04	2.78e-16
1. PB	Q505F5	Leucine-rich repeat-containing protein 47	2.98e-04	4.73e-02	7.56e-17
1. PB	P18009	Probable E3 ubiquitin-protein ligase ipaH4.5	2.71e-04	2.77e-06	1.09e-04
1. PB	Q63912	Oligodendrocyte-myelin glycoprotein	6.05e-06	8.41e-03	2.88e-12
1. PB	Q7XNY1	Plant intracellular Ras-group-related LRR protein 1	6.37e-10	3.12e-16	2.58e-12
1. PB	Q3URE9	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2	3.96e-04	1.03e-05	0.001
1. PB	B9F655	Plant intracellular Ras-group-related LRR protein 7	1.37e-11	5.98e-09	3.31e-13
1. PB	Q01730	Ras suppressor protein 1	1.26e-08	7.78e-14	1.40e-15
1. PB	Q6ZVD8	PH domain leucine-rich repeat-containing protein phosphatase 2	1.20e-03	3.55e-05	8.40e-11
1. PB	Q9U3A0	P-granule-associated novel protein 1	3.89e-05	2.97e-05	0.005
1. PB	P18014	Probable E3 ubiquitin-protein ligase ipaH7.8	2.30e-04	4.61e-04	4.24e-04
1. PB	Q5FVI3	Leucine-rich repeat-containing protein 57	1.74e-10	2.38e-04	6.13e-15
1. PB	Q8BZ81	Leucine-rich repeat transmembrane neuronal protein 3	7.66e-05	1.29e-02	2.17e-08
1. PB	A6NIK2	Leucine-rich repeat-containing protein 10B	9.57e-09	1.68e-11	3.50e-15
1. PB	Q99983	Osteomodulin	5.64e-07	8.23e-05	1.61e-04
1. PB	Q8N9N7	Leucine-rich repeat-containing protein 57	1.60e-10	1.66e-04	3.57e-14
1. PB	Q8K377	Leucine-rich repeat transmembrane neuronal protein 1	1.09e-04	1.02e-04	9.32e-08
1. PB	Q96DD0	Leucine-rich repeat-containing protein 39	3.13e-08	3.85e-05	6.14e-15
1. PB	P08953	Protein toll	8.75e-03	4.42e-02	0.006
1. PB	O64566	Plant intracellular Ras-group-related LRR protein 6	8.28e-10	4.08e-08	2.38e-14
1. PB	Q8K3W2	Leucine-rich repeat-containing protein 10	8.99e-12	1.58e-11	1.10e-09
1. PB	Q9GZU5	Nyctalopin	1.33e-05	9.58e-09	3.32e-04
1. PB	Q80XG9	Leucine-rich repeat transmembrane neuronal protein 4	8.03e-05	1.59e-02	1.50e-06
1. PB	O77742	Osteomodulin	5.30e-06	1.19e-04	1.47e-04
1. PB	Q66HD6	Leucine-rich repeat-containing protein 18	1.64e-06	2.01e-17	5.04e-10
1. PB	Q6INV3	Leucine-rich repeat-containing protein 57	7.99e-11	3.90e-05	1.09e-17
1. PB	Q8BGI7	Leucine-rich repeat-containing protein 39	7.26e-09	2.46e-04	3.90e-15
1. PB	O08742	Platelet glycoprotein V	1.66e-04	2.26e-07	3.53e-07
1. PB	Q8TCA0	Leucine-rich repeat-containing protein 20	2.48e-06	7.74e-04	1.14e-06
1. PB	Q80X72	Leucine-rich repeat-containing protein 15	1.14e-04	8.33e-03	8.89e-10
1. PB	Q2I0M4	Leucine-rich repeat-containing protein 26	2.76e-05	2.39e-07	0.003
1. PB	Q80WD0	Reticulon-4 receptor-like 1	4.47e-05	5.88e-04	4.41e-04
1. PB	C0STK7	Phospholipase A2 inhibitor beta	NA	1.58e-03	2.23e-05
1. PB	Q91W20	Leucine-rich repeat-containing protein 26	5.21e-05	1.70e-06	0.014
1. PB	P58682	Toll-like receptor 8	6.83e-04	2.96e-02	0.017
1. PB	Q8RWE5	Plant intracellular Ras-group-related LRR protein 8	1.19e-07	5.17e-14	3.37e-11
1. PB	Q9SSD1	Protein TOO MANY MOUTHS	8.40e-05	1.07e-02	8.36e-13
1. PB	Q86X40	Leucine-rich repeat-containing protein 28	1.63e-10	2.48e-26	5.73e-10
1. PB	Q5BKY1	Leucine-rich repeat-containing protein 10	2.88e-10	1.36e-11	1.97e-13
1. PB	Q2T9T5	Leucine-rich repeat-containing protein 61	9.14e-04	6.32e-09	0.007
1. PB	Q9SVN2	Receptor-like protein 47	4.51e-04	2.68e-02	6.58e-07
1. PB	Q3TX51	Leucine-rich repeat-containing protein 28	2.09e-10	1.10e-28	3.92e-11
1. PB	O35103	Osteomodulin	1.77e-06	5.48e-05	1.03e-05
1. PB	P22792	Carboxypeptidase N subunit 2	7.70e-05	5.28e-06	3.29e-09
1. PB	Q65Z91	Tsukushi	1.04e-05	6.86e-04	0.002
1. PB	Q8BXA7	PH domain leucine-rich repeat-containing protein phosphatase 2	1.12e-03	3.42e-06	2.91e-08
1. PB	Q3UGP9	Leucine-rich repeat-containing protein 58	0.00e+00	4.24e-126	0.0
1. PB	Q8K0S5	Reticulon-4 receptor-like 1	5.01e-05	5.21e-04	1.38e-04
1. PB	Q5RF01	Transforming growth factor beta activator LRRC32	1.08e-08	9.41e-03	0.014
1. PB	Q3ZC49	Leucine-rich repeat-containing protein 39	2.15e-08	5.94e-05	3.94e-15
1. PB	Q5PQV5	Trophoblast glycoprotein	7.58e-05	3.81e-05	0.005
1. PB	Q6GLE8	Leucine-rich repeat-containing protein 28	3.79e-10	6.02e-26	1.45e-14
1. PB	Q9CXD9	Leucine-rich repeat-containing protein 17	8.08e-05	2.28e-03	8.77e-05
1. PB	Q7KIN0	Toll-like receptor 7	3.74e-05	1.64e-02	8.28e-08
1. PB	Q9VUN0	Toll-like receptor 6	9.88e-03	8.55e-04	2.90e-08
1. PB	Q5TJ59	Toll-like receptor 3	1.06e-04	1.66e-02	8.12e-07
1. PB	B4F7C5	Leucine-rich repeat transmembrane neuronal protein 4	2.24e-05	7.36e-03	1.39e-06
1. PB	Q96CX6	Leucine-rich repeat-containing protein 58	0	1.93e-163	0.0
1. PB	Q6ZNQ3	Leucine-rich repeat-containing protein 69	2.21e-10	7.36e-37	1.44e-08
1. PB	Q9MA83	Receptor-like protein 30	3.70e-05	4.13e-02	3.32e-08
1. PB	Q9BGP6	Leucine-rich repeat transmembrane neuronal protein 3	6.44e-05	4.96e-02	0.046
1. PB	Q86VH4	Leucine-rich repeat transmembrane neuronal protein 4	9.61e-05	2.45e-02	1.96e-06
1. PB	Q32KX5	Leucine-rich repeat-containing protein 28	2.42e-10	8.87e-25	2.64e-08
2. P	Q5RDJ4	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1	5.29e-04	9.26e-06	NA
2. P	G3XA59	Transforming growth factor beta activator LRRC32	1.29e-08	9.22e-03	NA
2. P	Q92688	Acidic leucine-rich nuclear phosphoprotein 32 family member B	2.43e-03	5.74e-03	NA
2. P	Q65YW8	Tsukushi-A	1.26e-07	2.76e-04	NA
2. P	Q9XHH2	Dynein axonemal light chain 1	1.62e-05	4.77e-04	NA
2. P	Q6QMY6	Tsukushi	7.99e-06	1.89e-02	NA
2. P	P83503	Nyctalopin	5.55e-06	1.07e-09	NA
2. P	P25380	Sporulation-specific protein 22	3.25e-02	3.30e-03	NA
2. P	Q7Z4L9	Protein phosphatase 1 regulatory subunit 42	7.63e-07	1.35e-06	NA
2. P	Q4KLL3	Leucine-rich repeat-containing protein 55	1.53e-06	1.39e-03	NA
2. P	Q6FV04	U2 small nuclear ribonucleoprotein A'	4.16e-03	2.24e-06	NA
2. P	O01615	Acidic leucine-rich nuclear phosphoprotein 32-related protein 2	5.00e-05	7.44e-06	NA
2. P	Q5F4A3	Acidic leucine-rich nuclear phosphoprotein 32 family member E	6.73e-03	1.07e-02	NA
2. P	Q3SZC6	Acidic leucine-rich nuclear phosphoprotein 32 family member B	5.77e-04	3.07e-02	NA
2. P	Q28XE2	Acidic leucine-rich nuclear phosphoprotein 32 family member A	4.12e-04	1.87e-02	NA
2. P	O35381	Acidic leucine-rich nuclear phosphoprotein 32 family member A	2.34e-03	3.55e-05	NA
2. P	O43423	Acidic leucine-rich nuclear phosphoprotein 32 family member C	1.21e-02	1.66e-02	NA
2. P	Q6GQN5	Protein phosphatase 1 regulatory subunit 42	3.27e-05	2.06e-04	NA
2. P	Q66HV9	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1-B	5.13e-04	6.81e-07	NA
2. P	Q7ZUP0	Acidic leucine-rich nuclear phosphoprotein 32 family member A	3.91e-04	1.99e-04	NA
2. P	Q9D1T0	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1	5.56e-04	3.55e-06	NA
2. P	Q4P5F9	U2 small nuclear ribonucleoprotein A'	8.61e-03	1.39e-07	NA
2. P	Q2EEY0	Toll-like receptor 9	5.72e-03	7.59e-05	NA
2. P	P49911	Acidic leucine-rich nuclear phosphoprotein 32 family member A	2.01e-03	1.56e-05	NA
2. P	O62220	Acidic leucine-rich nuclear phosphoprotein 32-related protein 1	6.14e-03	5.29e-05	NA
2. P	Q5QJ74	Tubulin-specific chaperone cofactor E-like protein	1.46e-04	1.18e-04	NA
2. P	Q587K4	Leucine-rich repeat-containing protein 73	1.67e-04	3.38e-04	NA
2. P	Q5I2M4	Toll-like receptor 9	7.90e-03	3.81e-05	NA
2. P	Q86UN3	Reticulon-4 receptor-like 2	1.05e-05	1.75e-03	NA
2. P	Q9V895	Acidic leucine-rich nuclear phosphoprotein 32 family member A	1.11e-02	2.82e-04	NA
2. P	Q5I2M7	Toll-like receptor 9	2.79e-03	1.97e-04	NA
2. P	Q13641	Trophoblast glycoprotein	5.62e-05	1.94e-04	NA
2. P	Q8ZQQ2	E3 ubiquitin-protein ligase SlrP	3.84e-04	3.89e-02	NA
2. P	Q6P7C4	Leucine-rich repeat-containing protein 26	5.79e-05	5.87e-05	NA
2. P	Q9N008	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1	2.84e-04	6.42e-06	NA
2. P	Q01819	Connectin	1.31e-04	2.48e-05	NA
2. P	Q7M6Z0	Reticulon-4 receptor-like 2	2.23e-05	8.45e-04	NA
2. P	Q5ZMN0	Acidic leucine-rich nuclear phosphoprotein 32 family member B	2.19e-03	8.16e-03	NA
2. P	P59034	Leucine-rich repeat-containing protein 3	7.86e-03	8.85e-03	NA
2. P	Q6C417	U2 small nuclear ribonucleoprotein A'	2.78e-03	3.94e-05	NA
2. P	A2VDH3	Leucine-rich repeat-containing protein 38	3.35e-05	1.38e-03	NA
2. P	P0C6S8	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3	7.36e-05	4.81e-07	NA
2. P	Q8C5W3	Tubulin-specific chaperone cofactor E-like protein	2.20e-04	5.41e-05	NA
2. P	Q9D9B4	Leucine-rich melanocyte differentiation-associated protein	6.28e-03	6.22e-04	NA
2. P	Q8HY67	Acidic leucine-rich nuclear phosphoprotein 32 family member A	NA	7.17e-06	NA
2. P	B6CZ45	Leucine-rich repeat-containing protein 51	1.46e-03	1.57e-03	NA
2. P	A6H759	Leucine-rich repeat-containing protein 72	1.83e-03	4.55e-06	NA
2. P	P59035	Leucine-rich repeat-containing protein 3	3.07e-03	1.50e-02	NA
2. P	P09661	U2 small nuclear ribonucleoprotein A'	1.99e-03	8.00e-10	NA
2. P	Q08963	U2 small nuclear ribonucleoprotein A'	2.88e-03	1.43e-08	NA
2. P	Q7ZY40	Acidic leucine-rich nuclear phosphoprotein 32 family member E	6.27e-03	3.00e-05	NA
2. P	Q8BMT4	Transforming growth factor beta activator LRRC33	1.11e-03	3.94e-05	NA
2. P	Q9USX8	U2 small nuclear ribonucleoprotein A'	7.52e-04	3.09e-04	NA
2. P	P97822	Acidic leucine-rich nuclear phosphoprotein 32 family member E	2.38e-03	3.45e-04	NA
2. P	P39687	Acidic leucine-rich nuclear phosphoprotein 32 family member A	2.36e-03	2.54e-05	NA
2. P	B6CZ54	Leucine-rich repeat-containing protein 51	3.88e-03	1.57e-03	NA
2. P	Q4R8Y9	Trophoblast glycoprotein	7.16e-05	1.53e-03	NA
2. P	Q4R803	Protein phosphatase 1 regulatory subunit 42	2.43e-04	8.97e-10	NA
2. P	Q5PPX0	Protein phosphatase 1 regulatory subunit 42	6.80e-05	8.30e-06	NA
2. P	Q4V8D9	Leucine-rich repeat-containing protein 34	5.64e-05	1.14e-02	NA
2. P	Q2KID4	Dynein axonemal light chain 1	1.57e-05	8.04e-05	NA
2. P	Q5AGC4	Cell surface GPI-anchored protein ECM33	5.91e-03	4.91e-02	NA
2. P	Q8CBR6	Tsukushi	5.33e-07	1.19e-02	NA
2. P	Q6NUW5	Acidic leucine-rich nuclear phosphoprotein 32 family member E	2.42e-05	2.89e-04	NA
2. P	Q4LDG9	Dynein axonemal light chain 1	1.69e-05	1.50e-05	NA
2. P	Q86YC3	Transforming growth factor beta activator LRRC33	4.82e-04	5.69e-04	NA
2. P	P11745	Ran GTPase-activating protein 1	3.62e-07	2.94e-03	NA
2. P	Q6GQU6	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3	2.38e-04	1.05e-06	NA
2. P	Q641R9	Dynein axonemal light chain 1	1.32e-05	3.19e-04	NA
2. P	Q5BGW9	U2 small nuclear ribonucleoprotein A'	1.46e-02	4.55e-02	NA
2. P	D0ZRB2	E3 ubiquitin-protein ligase SlrP	5.05e-04	4.68e-02	NA
2. P	P43333	U2 small nuclear ribonucleoprotein A'	1.29e-03	8.47e-07	NA
2. P	Q8WUA8	Tsukushi	7.15e-07	1.71e-02	NA
2. P	Q6PAF6	Acidic leucine-rich nuclear phosphoprotein 32 family member A	1.89e-03	1.32e-06	NA
2. P	Q7S9P4	U2 small nuclear ribonucleoprotein A'	1.08e-03	4.59e-05	NA
2. P	Q8N7C0	Leucine-rich repeat-containing protein 52	1.38e-05	5.15e-06	NA
2. P	Q9EST5	Acidic leucine-rich nuclear phosphoprotein 32 family member B	2.29e-05	2.09e-02	NA
2. P	Q9BTT0	Acidic leucine-rich nuclear phosphoprotein 32 family member E	1.01e-02	2.62e-03	NA
2. P	Q6BT60	U2 small nuclear ribonucleoprotein A'	6.36e-03	6.19e-06	NA
2. P	Q96FE5	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1	1.35e-04	9.14e-07	NA
2. P	Q5I2M8	Toll-like receptor 9	2.59e-03	7.17e-04	NA
2. P	Q9BLB6	Probable U2 small nuclear ribonucleoprotein A'	1.95e-03	3.09e-09	NA
2. P	Q5M8M9	Leucine-rich repeat-containing protein 52	3.91e-05	9.43e-04	NA
2. P	P0DKB5	Trophoblast glycoprotein-like	1.16e-03	2.01e-03	NA
2. P	Q28G94	Dynein axonemal light chain 1	1.47e-05	3.41e-04	NA
2. P	Q3ZBI5	Transforming growth factor beta activator LRRC33	1.82e-03	1.17e-03	NA
2. P	Q4WV66	U2 small nuclear ribonucleoprotein A'	3.18e-03	8.83e-04	NA
2. P	P57784	U2 small nuclear ribonucleoprotein A'	3.69e-03	1.46e-09	NA
2. P	Q9V4Q8	Probable U2 small nuclear ribonucleoprotein A'	1.78e-03	1.45e-08	NA
2. P	Q5VT99	Leucine-rich repeat-containing protein 38	1.09e-05	6.92e-03	NA
2. P	Q6A1I3	Acidic leucine-rich nuclear phosphoprotein 32 family member B	4.61e-03	1.24e-02	NA
2. P	Q3UY51	Leucine-rich repeat-containing protein 55	1.64e-06	1.03e-03	NA
2. P	Q6P1U7	Acidic leucine-rich nuclear phosphoprotein 32 family member B	2.66e-04	8.64e-04	NA
2. P	Q83RJ4	E3 ubiquitin-protein ligase ipaH3	1.43e-04	4.09e-02	NA
2. P	Q3U3V8	X-ray radiation resistance-associated protein 1	2.16e-02	9.41e-03	NA
2. P	Q5EAD8	Leucine-rich repeat-containing protein 51	1.08e-03	7.83e-03	NA
2. P	Q8C013	Trophoblast glycoprotein-like	2.65e-03	4.51e-04	NA
2. P	Q6AXZ2	Leucine-rich repeat-containing protein 46	4.00e-03	2.63e-02	NA
2. P	Q5I2M3	Toll-like receptor 9	1.17e-02	4.51e-04	NA
2. P	Q6DHB1	Dynein axonemal light chain 1	1.22e-05	2.46e-04	NA
2. P	P71451	Internalin C	6.28e-05	2.85e-03	NA
2. P	Q8ILI6	Acidic leucine-rich nuclear phosphoprotein 32-related protein	2.22e-03	1.73e-03	NA
2. P	Q5XIE0	Acidic leucine-rich nuclear phosphoprotein 32 family member E	7.11e-04	1.55e-04	NA
2. P	Q5JTD7	Leucine-rich repeat-containing protein 73	4.57e-05	6.57e-04	NA
2. P	P46060	Ran GTPase-activating protein 1	5.48e-04	3.97e-02	NA
2. P	Q05A62	Dynein axonemal light chain 1	1.78e-05	6.66e-06	NA
2. P	Q8R1Z4	Protein phosphatase 1 regulatory subunit 42	1.79e-05	1.19e-06	NA
2. P	A0A096MJZ0	Dynein axonemal light chain 1	1.76e-05	1.52e-05	NA
2. P	Q5M7S9	Tsukushi	1.50e-07	4.25e-02	NA
2. P	Q6UY18	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 4	3.55e-04	8.75e-08	NA
2. P	Q8BKR5	Protein phosphatase 1 regulatory subunit 37	1.46e-03	2.40e-02	NA
2. P	P51122	Acidic leucine-rich nuclear phosphoprotein 32 family member A	2.46e-03	8.40e-06	NA
2. P	O13066	Ran GTPase-activating protein 1	2.20e-03	4.37e-02	NA
2. P	Q5I2M5	Toll-like receptor 9	7.64e-03	6.36e-04	NA
2. P	Q8T888	Dynein axonemal light chain 1	1.61e-05	5.02e-03	NA
2. P	A6H793	Leucine-rich repeat-containing protein 3	2.39e-03	3.33e-02	NA
2. P	B6CZ61	Leucine-rich repeat-containing protein 51	9.55e-04	3.60e-02	NA
2. P	Q96E66	Leucine-rich repeat-containing protein 51	1.40e-03	1.41e-04	NA
2. P	Q755D2	U2 small nuclear ribonucleoprotein A'	4.67e-03	1.49e-08	NA
2. P	Q8AVC1	Acidic leucine-rich nuclear phosphoprotein 32 family member B	3.39e-04	2.79e-03	NA
2. P	Q7Y180	Acidic leucine-rich nuclear phosphoprotein 32-related protein 2	9.28e-05	9.13e-03	NA
2. P	A6NJI9	Leucine-rich repeat-containing protein 72	2.34e-03	5.20e-08	NA
2. P	Q4R8Y8	U2 small nuclear ribonucleoprotein A'	1.43e-03	8.00e-10	NA
2. P	Q6AXL3	Transforming growth factor beta activator LRRC33	1.64e-03	2.73e-04	NA
2. P	Q5UQX3	Putative leucine-rich repeat protein R380	NA	1.13e-06	NA
2. P	Q5A449	U2 small nuclear ribonucleoprotein A'	6.43e-04	1.67e-07	NA
2. P	Q5PQJ7	Tubulin-specific chaperone cofactor E-like protein	1.59e-04	5.80e-05	NA
2. P	Q6ZSA7	Leucine-rich repeat-containing protein 55	1.74e-06	4.81e-03	NA
2. P	Q80WD1	Reticulon-4 receptor-like 2	9.06e-06	4.67e-03	NA
2. P	Q9DAM1	Leucine-rich repeat-containing protein 34	7.95e-05	1.24e-02	NA
2. P	O13960	Cell wall protein ecm33	5.54e-03	1.33e-03	NA
2. P	B6CZ40	Leucine-rich repeat-containing protein 51	1.44e-03	7.00e-06	NA
2. P	Q5BK65	Transforming growth factor beta activator LRRC33	2.34e-04	1.69e-03	NA
2. P	A4IIW9	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1	4.12e-04	1.06e-04	NA
2. P	Q50L44	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1	2.38e-04	4.45e-07	NA
3. B	O43155	Leucine-rich repeat transmembrane protein FLRT2	7.78e-05	NA	0.009
3. B	Q723X5	Internalin I	2.91e-02	NA	1.60e-07
3. B	O46379	Lumican (Fragment)	3.82e-13	NA	0.003
3. B	O75094	Slit homolog 3 protein	1.61e-02	NA	2.68e-04
3. B	Q08817	Leucine-rich repeat-containing protein SOG2	3.18e-02	NA	4.41e-06
3. B	Q9BYS8	Leucine-rich repeat-containing protein 2	1.61e-07	NA	1.52e-12
3. B	Q8LPB4	Phytosulfokine receptor 1	1.98e-03	NA	7.71e-09
3. B	Q8AVI4	Leucine-rich repeat protein SHOC-2	1.32e-11	NA	4.00e-16
3. B	Q8GRU6	Leucine-rich repeat receptor-like kinase protein HAR1	8.97e-07	NA	1.15e-07
3. B	Q9VJ07	Protein phosphatase PHLPP-like protein	7.40e-04	NA	1.41e-06
3. B	B0BNK7	Leucine-rich repeat and fibronectin type-III domain-containing protein 3	4.76e-04	NA	0.022
3. B	Q5RFE9	Leucine-rich repeat-containing protein 40	2.45e-08	NA	1.16e-18
3. B	C0LGU1	Probable LRR receptor-like serine/threonine-protein kinase At5g37450	7.59e-03	NA	3.13e-05
3. B	Q5S007	Leucine-rich repeat serine/threonine-protein kinase 2	1.36e-01	NA	1.66e-07
3. B	Q9DE68	Decorin	9.75e-09	NA	0.025
3. B	Q5VUJ6	Leucine-rich repeat and calponin homology domain-containing protein 2	6.28e-07	NA	2.02e-12
3. B	Q96RT1	Erbin	1.68e-03	NA	1.78e-13
3. B	Q2R2D5	Receptor kinase-like protein Xa21	5.17e-03	NA	5.88e-06
3. B	Q6FRT2	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	8.90e-02	NA	9.48e-11
3. B	Q8L899	Systemin receptor SR160	1.64e-02	NA	2.54e-07
3. B	Q3V1N1	Malignant fibrous histiocytoma-amplified sequence 1 homolog	2.55e-04	NA	3.25e-22
3. B	Q3UMG5	Leucine-rich repeat and calponin homology domain-containing protein 2	7.98e-05	NA	2.68e-12
3. B	Q80YS5	Leucine-rich repeat-containing protein 27	8.54e-03	NA	0.005
3. B	Q9XSD9	Decorin	1.24e-08	NA	0.003
3. B	Q9SHI2	Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230	8.84e-03	NA	6.92e-11
3. B	Q9LVP0	Probable leucine-rich repeat receptor-like protein kinase At5g63930	1.92e-03	NA	5.54e-07
3. B	Q4H4B6	Protein scribble homolog	6.24e-03	NA	1.53e-16
3. B	Q6GPJ5	Leucine-rich repeat-containing protein 40	3.06e-08	NA	5.27e-17
3. B	P13605	Fibromodulin	1.39e-10	NA	2.99e-04
3. B	B5DX45	Leucine-rich repeat protein soc-2 homolog	6.83e-11	NA	9.19e-20
3. B	C0LGE4	Probable LRR receptor-like serine/threonine-protein kinase At1g12460	2.46e-03	NA	1.02e-07
3. B	C0LGE0	Probable LRR receptor-like serine/threonine-protein kinase At1g07650	8.50e-03	NA	5.63e-05
3. B	O55226	Chondroadherin	5.74e-07	NA	0.003
3. B	Q3UHC2	Leucine-rich repeat serine/threonine-protein kinase 1	4.43e-02	NA	1.85e-05
3. B	F4KIF3	Disease resistance-like protein CSA1	5.36e-03	NA	5.36e-05
3. B	Q7Z5L7	Podocan	2.47e-07	NA	1.55e-05
3. B	Q9SKB2	Leucine-rich repeat receptor-like serine/threonine/tyrosine-protein kinase SOBIR1	1.71e-02	NA	0.001
3. B	F4IUU1	Receptor like protein 27	7.83e-03	NA	0.015
3. B	Q9NZU0	Leucine-rich repeat transmembrane protein FLRT3	3.65e-05	NA	2.17e-07
3. B	Q9ASQ6	Probable LRR receptor-like serine/threonine-protein kinase At1g29720	9.27e-04	NA	4.16e-06
3. B	Q9N0E3	Reticulon-4 receptor	1.55e-05	NA	0.002
3. B	O04567	Probable inactive receptor kinase At1g27190	1.45e-02	NA	0.001
3. B	Q6JN47	Receptor-like protein EIX1	5.94e-06	NA	8.12e-06
3. B	F1MLX5	Leucine-rich repeat-containing G-protein coupled receptor 4	2.72e-04	NA	9.68e-10
3. B	Q9ESY6	Leucine-rich repeat neuronal protein 3	1.23e-04	NA	0.007
3. B	Q8RX63	Receptor-like protein 31	4.61e-04	NA	1.43e-08
3. B	P93194	Receptor-like protein kinase	6.09e-03	NA	1.73e-08
3. B	Q2WF71	Leucine-rich repeat and fibronectin type III domain-containing protein 1	1.29e-03	NA	0.013
3. B	Q96M69	Leucine-rich repeat and guanylate kinase domain-containing protein	1.75e-04	NA	0.017
3. B	Q8BGR2	Volume-regulated anion channel subunit LRRC8D	3.38e-06	NA	2.24e-14
3. B	C0LGN2	Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840	9.29e-03	NA	5.43e-08
3. B	Q5M8G4	Leucine-rich repeat-containing protein 40	3.66e-06	NA	1.81e-17
3. B	A8XWW4	Leucine-rich repeat protein soc-2	1.60e-11	NA	6.82e-12
3. B	O02678	Biglycan	6.41e-09	NA	2.63e-04
3. B	Q9BXN1	Asporin	1.45e-11	NA	0.022
3. B	P47853	Biglycan	6.95e-09	NA	1.79e-04
3. B	Q8BLY3	Leucine-rich repeat and fibronectin type-III domain-containing protein 3	1.29e-03	NA	0.023
3. B	Q6BMM5	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	5.92e-02	NA	7.86e-09
3. B	Q9C6A8	Receptor-like protein 15	2.84e-03	NA	1.21e-04
3. B	Q6R6I7	Relaxin receptor 1	2.26e-04	NA	6.64e-06
3. B	O49879	Receptor-like protein Cf-9 homolog	1.11e-03	NA	2.29e-05
3. B	Q5ZLN0	Leucine-rich repeat-containing protein 40	2.36e-07	NA	8.24e-22
3. B	P28654	Decorin	4.72e-09	NA	0.004
3. B	Q942F3	Brassinosteroid LRR receptor kinase BRI1	1.05e-02	NA	2.68e-05
3. B	Q810B8	SLIT and NTRK-like protein 4	1.04e-02	NA	4.82e-04
3. B	Q93YT3	Receptor-like protein 50	1.41e-04	NA	1.38e-04
3. B	Q9SSL9	Leucine-rich repeat receptor-like protein kinase PEPR1	3.70e-03	NA	6.17e-08
3. B	F4HTV6	Putative receptor-like protein 16	8.07e-09	NA	3.50e-05
3. B	Q9LJF3	Receptor-like protein kinase BRI1-like 3	NA	NA	1.97e-07
3. B	Q9WTR8	PH domain leucine-rich repeat protein phosphatase 1	1.90e-02	NA	1.89e-12
3. B	Q22875	Leucine-rich repeat protein soc-2	1.31e-11	NA	1.75e-13
3. B	Q6NSJ5	Volume-regulated anion channel subunit LRRC8E	1.69e-05	NA	2.10e-10
3. B	Q40392	TMV resistance protein N	7.62e-03	NA	0.045
3. B	Q5F334	Leucine-rich repeat-containing protein 59	2.10e-03	NA	0.001
3. B	Q9BXR5	Toll-like receptor 10	9.22e-04	NA	0.006
3. B	Q6RKD8	Leucine-rich repeat transmembrane protein FLRT1	7.82e-05	NA	5.22e-06
3. B	F4JT80	Disease resistance protein RPP2B	6.64e-03	NA	5.51e-05
3. B	F1MT22	Leucine-rich repeat-containing G-protein coupled receptor 5	2.97e-04	NA	1.57e-07
3. B	Q9C699	Receptor-like protein 7	1.14e-03	NA	1.86e-07
3. B	Q6Z8P4	Plant intracellular Ras-group-related LRR protein 4	2.75e-07	NA	9.86e-14
3. B	Q9LJM4	Receptor-like protein kinase HAIKU2	5.68e-03	NA	7.52e-09
3. B	Q8CBC6	Leucine-rich repeat neuronal protein 3	1.17e-04	NA	0.006
3. B	Q92626	Peroxidasin homolog	1.92e-01	NA	0.002
3. B	P0C895	LRR repeats and ubiquitin-like domain-containing protein At2g30105	8.94e-09	NA	5.94e-13
3. B	Q9LJS2	Receptor-like protein 41	3.15e-03	NA	4.39e-05
3. B	Q9XIL9	Pollen-specific leucine-rich repeat extensin-like protein 3	1.00e-03	NA	0.002
3. B	Q9LRR5	Putative disease resistance protein At3g14460	1.01e-01	NA	0.004
3. B	Q9FL28	LRR receptor-like serine/threonine-protein kinase FLS2	3.59e-03	NA	6.80e-09
3. B	Q9SH71	Putative inactive receptor-like protein kinase At1g64210	7.66e-03	NA	0.006
3. B	Q9R1B9	Slit homolog 2 protein	1.61e-02	NA	7.09e-06
3. B	Q13045	Protein flightless-1 homolog	3.44e-04	NA	4.91e-12
3. B	Q29393	Decorin	1.19e-08	NA	0.019
3. B	Q5BJ41	CCR4-NOT transcription complex subunit 6	9.16e-03	NA	8.01e-09
3. B	P0CP23	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	8.31e-02	NA	6.77e-07
3. B	Q9DBY4	TLR4 interactor with leucine rich repeats	6.99e-04	NA	0.002
3. B	P50608	Fibromodulin	6.40e-11	NA	0.007
3. B	Q9ULM6	CCR4-NOT transcription complex subunit 6	6.50e-03	NA	3.93e-12
3. B	D4ABX8	Leucine-rich repeat and fibronectin type-III domain-containing protein 4	1.05e-03	NA	3.62e-05
3. B	Q9V780	Protein lap1	2.38e-05	NA	6.29e-17
3. B	Q7KRY7	Protein lap4	3.76e-02	NA	3.48e-17
3. B	Q01631	Adenylate cyclase	2.51e-02	NA	8.20e-15
3. B	Q965M2	Leucine-rich repeats and immunoglobulin-like domains protein sma-10	2.36e-03	NA	3.10e-04
3. B	Q84MA9	Inactive leucine-rich repeat receptor-like serine/threonine-protein kinase At1g60630	2.38e-02	NA	0.003
3. B	Q9LS79	Receptor-like protein 38	1.12e-03	NA	5.85e-09
3. B	Q9C9N5	Probable inactive leucine-rich repeat receptor-like protein kinase At1g66830	1.51e-03	NA	1.64e-06
3. B	P21809	Biglycan	7.24e-09	NA	1.66e-04
3. B	Q96FV0	Leucine-rich repeat-containing protein 46	2.09e-03	NA	0.025
3. B	Q5RAC4	SLIT and NTRK-like protein 1	1.30e-03	NA	5.39e-05
3. B	Q9HBX8	Leucine-rich repeat-containing G-protein coupled receptor 6	2.98e-03	NA	6.50e-08
3. B	F4I9S3	Receptor-like protein 9a	2.81e-03	NA	2.87e-05
3. B	Q99MQ4	Asporin	2.15e-11	NA	0.026
3. B	Q8VYG9	Plant intracellular Ras-group-related LRR protein 9	1.36e-06	NA	3.52e-13
3. B	Q5RI43	Keratocan	8.19e-08	NA	1.17e-06
3. B	B4LXW1	Leucine-rich repeat protein soc-2 homolog	3.72e-11	NA	5.48e-19
3. B	Q8CHE4	PH domain leucine-rich repeat-containing protein phosphatase 1	2.49e-02	NA	5.72e-12
3. B	P45969	Protein phosphatase 1 regulatory subunit SDS22 homolog	8.19e-13	NA	6.12e-06
3. B	Q9NR97	Toll-like receptor 8	1.20e-03	NA	0.001
3. B	Q9NR99	Matrix-remodeling-associated protein 5	NA	NA	0.006
3. B	Q9ZUK3	Receptor-like protein 19	7.53e-05	NA	2.17e-08
3. B	Q9VEK6	Leucine-rich repeat protein soc-2 homolog	1.56e-09	NA	1.17e-19
3. B	Q6NWG1	Leucine-rich repeat-containing protein 59	1.60e-03	NA	0.004
3. B	Q8LFN2	Probable inactive leucine-rich repeat receptor-like protein kinase At3g03770	7.34e-04	NA	0.025
3. B	D3ZTV3	Leucine-rich repeat transmembrane protein FLRT2	1.31e-04	NA	0.007
3. B	A7SFP1	Leucine-rich repeat protein soc-2 homolog	7.59e-09	NA	4.80e-17
3. B	Q8VZG8	MDIS1-interacting receptor like kinase 2	1.90e-04	NA	3.19e-10
3. B	O60346	PH domain leucine-rich repeat-containing protein phosphatase 1	2.57e-02	NA	1.63e-11
3. B	Q0WVM4	Probable LRR receptor-like serine/threonine-protein kinase At2g23950	1.82e-02	NA	0.010
3. B	Q8K1S1	Leucine-rich repeat LGI family member 4	1.64e-02	NA	0.017
3. B	A2Q9L0	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	1.28e-02	NA	2.00e-10
3. B	Q9C7T7	Receptor protein-tyrosine kinase CEPR2	9.96e-05	NA	5.66e-08
3. B	G7JIK2	Leucine-rich repeat receptor-like kinase protein SUNN	3.61e-04	NA	3.28e-11
3. B	Q80ZI6	E3 ubiquitin-protein ligase LRSAM1	9.41e-04	NA	2.69e-11
3. B	O46378	Fibromodulin (Fragment)	1.60e-09	NA	0.002
3. B	Q9C6A6	Receptor-like protein 13	1.46e-03	NA	2.03e-06
3. B	Q3ZBN5	Asporin	3.72e-09	NA	0.001
3. B	Q9FZ59	Leucine-rich repeat receptor-like protein kinase PEPR2	3.71e-03	NA	2.44e-10
3. B	Q80U72	Protein scribble homolog	2.81e-03	NA	5.88e-14
3. B	Q8S7M7	Plant intracellular Ras-group-related LRR protein 5	5.09e-07	NA	3.34e-13
3. B	B3DH20	Dynein axonemal assembly factor 11	4.14e-03	NA	0.033
3. B	Q6QNU9	Toll-like receptor 12	4.90e-04	NA	0.003
3. B	P28653	Biglycan	7.10e-09	NA	1.45e-04
3. B	Q96PX8	SLIT and NTRK-like protein 1	3.67e-04	NA	5.48e-05
3. B	O80809	Receptor-like protein CLAVATA2	3.80e-04	NA	0.030
3. B	P0DJM0	Internalin A	3.84e-04	NA	7.25e-04
3. B	W8DXL4	Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 3	1.24e-02	NA	1.44e-04
3. B	B0M0P8	Ras guanine nucleotide exchange factor L	1.15e-02	NA	2.99e-14
3. B	Q6XHA6	Probable inactive serine/threonine-protein kinase roco10	3.01e-02	NA	7.79e-13
3. B	Q91ZZ5	Relaxin receptor 2	1.63e-05	NA	3.20e-06
3. B	Q9LSI9	Inactive LRR receptor-like serine/threonine-protein kinase BIR2	2.55e-02	NA	2.22e-04
3. B	Q9SJH6	Receptor like protein 29	3.38e-06	NA	5.18e-10
3. B	C0LGH8	Probable LRR receptor-like serine/threonine-protein kinase At1g63430	1.13e-02	NA	0.002
3. B	Q4WQG5	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	3.67e-02	NA	2.65e-11
3. B	O94813	Slit homolog 2 protein	3.14e-02	NA	2.62e-06
3. B	Q9HBX9	Relaxin receptor 1	7.56e-05	NA	3.79e-05
3. B	Q7TNJ4	Amphoterin-induced protein 2	2.68e-03	NA	4.64e-05
3. B	Q7G768	Brassinosteroid LRR receptor kinase BRL2	1.80e-03	NA	8.99e-10
3. B	C0LGQ9	LRR receptor-like serine/threonine-protein kinase GHR1	1.02e-02	NA	2.13e-05
3. B	P43298	Receptor protein kinase TMK1	7.18e-03	NA	1.31e-04
3. B	Q8IWT6	Volume-regulated anion channel subunit LRRC8A	6.09e-07	NA	9.60e-12
3. B	Q5RAV5	Leucine-rich repeat protein SHOC-2	4.51e-08	NA	2.79e-14
3. B	Q7L1W4	Volume-regulated anion channel subunit LRRC8D	2.08e-06	NA	2.47e-14
3. B	O48809	Leucine-rich repeat extensin-like protein 2	4.73e-03	NA	3.19e-05
3. B	Q9LH52	Leucine-rich repeat protein FLOR 1	5.67e-06	NA	0.014
3. B	Q8BGT1	Leucine-rich repeat transmembrane protein FLRT3	1.78e-05	NA	1.58e-07
3. B	P02750	Leucine-rich alpha-2-glycoprotein	2.58e-07	NA	2.01e-08
3. B	C0LGQ4	Protein MALE DISCOVERER 2	1.30e-01	NA	0.031
3. B	A8WGA3	Leucine-rich repeat and fibronectin type III domain-containing protein 1-like protein	4.62e-04	NA	0.035
3. B	O22938	Leucine-rich repeat receptor-like tyrosine-protein kinase PXC3	6.78e-04	NA	3.67e-07
3. B	Q99M75	Reticulon-4 receptor	2.99e-05	NA	0.001
3. B	Q5G5E0	Plant intracellular Ras-group-related LRR protein 5	1.22e-06	NA	5.65e-13
3. B	Q6R2K3	Protein STRUBBELIG-RECEPTOR FAMILY 3	9.91e-03	NA	9.83e-05
3. B	Q7Z7A1	Centriolin	5.47e-01	NA	5.23e-06
3. B	Q9FKZ1	Probable disease resistance protein At5g66900	2.12e-03	NA	0.022
3. B	Q9UQ13	Leucine-rich repeat protein SHOC-2	1.16e-08	NA	2.79e-14
3. B	C0LGK4	Probable LRR receptor-like serine/threonine-protein kinase At2g16250	1.41e-03	NA	0.020
3. B	Q723K6	Internalin A	6.16e-03	NA	7.64e-04
3. B	Q9NZU1	Leucine-rich repeat transmembrane protein FLRT1	1.43e-05	NA	6.68e-06
3. B	Q9P244	Leucine-rich repeat and fibronectin type III domain-containing protein 1	1.45e-03	NA	0.014
3. B	Q9SCT4	Probably inactive leucine-rich repeat receptor-like protein kinase IMK2	1.53e-03	NA	1.59e-06
3. B	V9M398	Disease resistance protein RUN1	5.09e-03	NA	1.59e-11
3. B	Q6AYI5	Leucine-rich repeat protein SHOC-2	9.24e-09	NA	1.06e-14
3. B	Q80ZD9	Amphoterin-induced protein 2	2.11e-03	NA	1.54e-07
3. B	B1H234	Leucine-rich repeat transmembrane protein FLRT3	1.89e-04	NA	1.80e-07
3. B	Q9SRL7	Receptor-like protein 35	6.24e-07	NA	2.22e-07
3. B	Q5FW85	Extracellular matrix protein 2	3.41e-06	NA	1.42e-07
3. B	O82318	Leucine-rich repeat receptor-like serine/threonine-protein kinase SKM1	1.48e-03	NA	1.02e-08
3. B	Q8LPS5	Somatic embryogenesis receptor kinase 5	1.40e-02	NA	0.031
3. B	Q9ZUI0	Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g24130	3.32e-04	NA	1.20e-07
3. B	Q9ZU46	Receptor protein kinase-like protein ZAR1	1.98e-03	NA	5.25e-05
3. B	Q9FL63	Inactive leucine-rich repeat receptor-like serine/threonine-protein kinase At5g24100	3.45e-02	NA	0.014
3. B	Q40235	Receptor-like protein Cf-9	1.10e-04	NA	6.31e-06
3. B	Q8RZV7	Leucine-rich repeat receptor protein kinase MSP1	1.41e-05	NA	1.75e-06
3. B	Q9ZVR7	Phytosulfokine receptor 1	5.79e-04	NA	1.07e-05
3. B	O61967	Protein lap1	1.29e-05	NA	7.66e-16
3. B	Q9UBM4	Opticin	2.08e-06	NA	0.001
3. B	O65375	Leucine-rich repeat extensin-like protein 1	2.42e-03	NA	2.29e-05
3. B	Q5MR23	Receptor-like protein 9DC3	5.04e-03	NA	1.21e-04
3. B	Q0U7W4	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	2.85e-02	NA	3.20e-08
3. B	Q9SN46	Leucine-rich repeat extensin-like protein 5	2.40e-03	NA	7.64e-06
3. B	Q960C5	Leucine-rich repeat and calponin homology domain-containing protein	2.86e-04	NA	4.72e-06
3. B	F4HTV4	Receptor-like protein 14	3.17e-03	NA	0.010
3. B	V9M2S5	Disease resistance protein RPV1	4.89e-03	NA	4.03e-10
3. B	Q2R8L1	Disease resistance protein RGA5	1.31e-01	NA	0.009
3. B	Q8SPE9	Toll-like receptor 4	1.80e-03	NA	0.042
3. B	Q9Y2L9	Leucine-rich repeat and calponin homology domain-containing protein 1	6.75e-05	NA	3.07e-12
3. B	P35334	Polygalacturonase inhibitor 1	8.57e-10	NA	2.73e-05
3. B	O75473	Leucine-rich repeat-containing G-protein coupled receptor 5	4.17e-04	NA	1.99e-08
3. B	O46403	Biglycan	7.17e-09	NA	3.98e-04
3. B	Q5R482	Leucine-rich repeat neuronal protein 3	1.36e-04	NA	0.021
3. B	P12024	Chaoptin	3.24e-03	NA	8.56e-06
3. B	Q32KP2	Leucine-rich repeat-containing protein 23	1.07e-06	NA	6.82e-06
3. B	Q9CRC8	Leucine-rich repeat-containing protein 40	5.36e-08	NA	2.49e-10
3. B	P31384	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	5.65e-02	NA	1.66e-11
3. B	O49545	Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1	8.16e-07	NA	1.05e-12
3. B	Q53EV4	Leucine-rich repeat-containing protein 23	2.74e-07	NA	7.81e-07
3. B	Q3SXY7	Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 3	2.90e-02	NA	0.039
3. B	Q9H5Y7	SLIT and NTRK-like protein 6	3.55e-03	NA	7.73e-06
3. B	Q940E8	Leucine-rich repeat receptor-like protein FASCIATED EAR2	6.06e-05	NA	1.08e-07
3. B	Q8YA32	Internalin I	6.54e-02	NA	2.53e-06
3. B	Q54AX5	Leucine-rich repeat protein lrrA	2.01e-09	NA	4.71e-17
3. B	A1CIJ6	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	4.80e-02	NA	7.88e-11
3. B	C0LGR3	LRR receptor-like serine/threonine-protein kinase RGI3	1.69e-03	NA	1.58e-11
3. B	B3LWU3	Leucine-rich repeat protein soc-2 homolog	8.55e-11	NA	8.20e-20
3. B	Q5S006	Leucine-rich repeat serine/threonine-protein kinase 2	9.67e-02	NA	5.22e-08
3. B	Q94C77	Receptor protein kinase-like protein At4g34220	9.81e-03	NA	1.10e-05
3. B	Q9SZ67	Probable WRKY transcription factor 19	9.07e-04	NA	0.001
3. B	Q1L8Y7	Leucine-rich repeat protein SHOC-2	5.75e-08	NA	3.58e-15
3. B	Q9SRL2	Receptor-like protein 34	1.53e-05	NA	2.54e-07
3. B	Q05C16	Leucine-rich repeat-containing protein 63	2.16e-04	NA	2.08e-11
3. B	Q9S9U3	Receptor-like protein 53	6.24e-04	NA	4.71e-05
3. B	Q4PSE6	Leucine-rich repeat extensin-like protein 7	3.95e-05	NA	7.35e-07
3. B	Q8N1G4	Leucine-rich repeat-containing protein 47	1.52e-05	NA	2.08e-15
3. B	Q28256	Platelet glycoprotein Ib alpha chain	2.54e-04	NA	3.95e-08
3. B	Q86SJ2	Amphoterin-induced protein 2	1.19e-03	NA	0.002
3. B	Q80TE7	Leucine-rich repeat-containing protein 7	9.95e-02	NA	5.15e-14
3. B	Q9T0K5	Leucine-rich repeat extensin-like protein 3	4.91e-03	NA	6.58e-06
3. B	Q01513	Adenylate cyclase	1.98e-02	NA	2.34e-11
3. B	Q9ZPS9	Serine/threonine-protein kinase BRI1-like 2	5.10e-06	NA	2.03e-12
3. B	Q810C0	SLIT and NTRK-like protein 2	2.37e-03	NA	7.48e-06
3. B	P47735	Receptor-like protein kinase 5	1.22e-06	NA	1.57e-08
3. B	Q80TH2	Erbin	2.35e-03	NA	1.23e-13
3. B	P0DO06	Receptor-like protein 9DC2	8.14e-03	NA	6.09e-06
3. B	Q9BZR6	Reticulon-4 receptor	1.64e-05	NA	2.47e-05
3. B	Q54WS5	Probable serine/threonine-protein kinase roco6	7.64e-02	NA	4.18e-10
3. B	Q9FGL5	Receptor protein-tyrosine kinase CEPR1	1.79e-03	NA	1.01e-07
3. B	Q9C637	Receptor-like protein 6	4.04e-03	NA	1.35e-07
3. B	Q9LFS4	Protein NSP-INTERACTING KINASE 1	4.15e-02	NA	8.35e-06
3. B	E9Q7T7	Chondroadherin-like protein	2.31e-04	NA	2.86e-08
3. B	A2AL36	Centriolin	4.13e-01	NA	7.99e-05
3. B	Q7XBQ9	Disease resistance protein RGA2	4.28e-03	NA	0.005
3. B	Q6Z4U4	LRR receptor kinase BAK1	2.37e-02	NA	1.43e-04
3. B	Q9LYN8	Leucine-rich repeat receptor protein kinase EMS1	1.23e-02	NA	3.74e-09
3. B	Q8MVR1	Cyclic GMP-binding protein C	6.84e-01	NA	7.02e-05
3. B	Q9GKQ6	Biglycan (Fragments)	1.62e-08	NA	2.94e-04
3. B	Q6CJU4	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	5.49e-02	NA	1.62e-07
3. B	Q6NQP4	Leucine-rich repeat protein 2	3.13e-04	NA	0.002
3. B	Q9C2R2	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	2.55e-02	NA	2.77e-08
3. B	Q9NT99	Leucine-rich repeat-containing protein 4B	1.41e-04	NA	1.58e-04
3. B	Q9FIZ3	LRR receptor-like serine/threonine-protein kinase GSO2	1.18e-02	NA	9.66e-13
3. B	A6QLV3	Leucine-rich repeat protein SHOC-2	7.27e-08	NA	2.79e-14
3. B	Q6ZCZ2	Brassinosteroid LRR receptor kinase BRL3	1.64e-02	NA	1.37e-07
3. B	A0A1P8ATR9	Receptor-like protein 9b	5.36e-03	NA	1.37e-04
3. B	C0LGS3	Probable LRR receptor-like serine/threonine-protein kinase At4g37250	5.86e-03	NA	0.017
3. B	C4V7I7	Probable CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	6.74e-03	NA	2.45e-09
3. B	Q6AXU9	CCR4-NOT transcription complex subunit 6	5.17e-03	NA	7.98e-09
3. B	C0LGP9	Probable leucine-rich repeat receptor-like protein kinase IMK3	3.30e-04	NA	2.23e-05
3. B	Q9LP24	Probable leucine-rich repeat receptor-like protein kinase At1g35710	5.11e-03	NA	6.19e-11
3. B	Q9LFG1	Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At3g53590	3.76e-03	NA	4.58e-06
3. B	Q0CT27	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	2.81e-02	NA	2.70e-10
3. B	Q3UVD5	Leucine-rich repeat-containing G-protein coupled receptor 6	5.97e-04	NA	3.86e-10
3. B	Q8IW52	SLIT and NTRK-like protein 4	2.87e-03	NA	5.21e-04
3. B	Q6DF55	Vasorin	2.91e-05	NA	1.01e-05
3. B	Q01129	Decorin	4.61e-09	NA	1.41e-04
3. B	Q1ZXD6	Probable serine/threonine-protein kinase roco5	NA	NA	1.01e-17
3. B	P33543	Putative kinase-like protein TMKL1	7.90e-03	NA	0.007
3. B	Q09564	Protein phosphatase PHLPP-like protein	1.34e-03	NA	9.68e-09
3. B	D4AC13	Leucine-rich repeat-containing G-protein coupled receptor 5	2.91e-03	NA	1.47e-11
3. B	A0A290U7C4	Disease resistance protein Roq1	7.46e-03	NA	1.96e-04
3. B	Q00874	DNA damage-repair/toleration protein DRT100	1.61e-10	NA	0.003
3. B	Q6P3Y9	Podocan-like protein 1	1.91e-07	NA	3.82e-07
3. B	O46390	Biglycan	2.29e-11	NA	1.46e-04
3. B	Q8R502	Volume-regulated anion channel subunit LRRC8C	2.29e-06	NA	7.12e-12
3. B	Q9H156	SLIT and NTRK-like protein 2	1.73e-03	NA	1.25e-04
3. B	Q9DE66	Keratocan	6.76e-11	NA	0.003
3. B	Q96II8	DISP complex protein LRCH3	3.65e-05	NA	2.12e-13
3. B	Q6R5P0	Toll-like receptor 11	4.92e-03	NA	1.91e-04
3. B	Q9M0G7	MDIS1-interacting receptor like kinase 1	1.75e-06	NA	1.71e-14
3. B	O75325	Leucine-rich repeat neuronal protein 2	1.90e-04	NA	4.46e-06
3. B	Q8N135	Leucine-rich repeat LGI family member 4	4.36e-02	NA	0.027
3. B	Q68CR7	Leucine-rich repeat-containing protein 66	3.95e-02	NA	8.01e-04
3. B	Q5F479	Serine/threonine-protein kinase 11-interacting protein	8.35e-03	NA	1.81e-04
3. B	Q1MX30	Receptor kinase-like protein Xa21	3.77e-03	NA	3.64e-04
3. B	Q6ZH85	Plant intracellular Ras-group-related LRR protein 2	1.44e-06	NA	6.20e-15
3. B	Q8VDB8	Leucine-rich repeat-containing protein 2	2.92e-08	NA	4.92e-11
3. B	Q6UXM1	Leucine-rich repeats and immunoglobulin-like domains protein 3	8.21e-03	NA	5.55e-07
3. B	Q6K4T4	LRR receptor kinase SERK2	1.88e-02	NA	7.13e-07
3. B	Q54XZ5	Probable serine/threonine-protein kinase DDB_G0278509	2.21e-03	NA	4.63e-08
3. B	Q6PEZ8	Podocan-like protein 1	2.31e-05	NA	0.014
3. B	F4JTU7	Receptor-like protein 48	1.22e-03	NA	9.36e-05
3. B	Q810C1	SLIT and NTRK-like protein 1	2.17e-03	NA	1.58e-04
3. B	Q9M8T0	Probable inactive receptor kinase At3g02880	1.21e-02	NA	0.002
3. B	Q9FII5	Leucine-rich repeat receptor-like protein kinase TDR	1.24e-04	NA	7.22e-09
3. B	P0CP22	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	3.48e-02	NA	6.95e-07
3. B	Q52KR2	Leucine-rich repeats and immunoglobulin-like domains protein 2	2.92e-03	NA	4.16e-06
3. B	Q8VEG6	CCR4-NOT transcription complex subunit 6-like	1.02e-02	NA	2.41e-10
3. B	Q9SIT1	Receptor-like kinase TMK3	1.24e-02	NA	3.04e-04
3. B	Q75BI3	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	4.18e-02	NA	3.10e-08
3. B	Q6XAT2	LRR receptor-like serine/threonine-protein kinase ERL2	2.65e-04	NA	2.60e-14
3. B	I1Z695	LRR receptor-like serine/threonine-protein kinase ER2	1.90e-03	NA	4.08e-16
3. B	Q24020	Protein flightless-1	1.32e-04	NA	9.50e-11
3. B	B4IBI9	Leucine-rich repeat protein soc-2 homolog	9.23e-06	NA	8.81e-20
3. B	Q67X31	LRR receptor kinase SERK2	3.62e-02	NA	1.96e-08
3. B	Q9UUG2	Uncharacterized leucine-rich repeat-containing protein C926.06c	3.83e-03	NA	0.004
3. B	Q2UUI3	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	5.76e-02	NA	1.98e-09
3. B	Q7XK44	Plant intracellular Ras-group-related LRR protein 3	1.20e-09	NA	6.71e-16
3. B	Q5E9X4	Leucine-rich repeat-containing protein 59	9.17e-04	NA	1.03e-05
3. B	Q3UQ28	Peroxidasin homolog	2.50e-01	NA	0.001
3. B	Q6P1C6	Leucine-rich repeats and immunoglobulin-like domains protein 3	7.59e-03	NA	1.86e-06
3. B	B5UBC1	Disease resistance protein Pikm1-TS	7.77e-03	NA	4.22e-10
3. B	Q9LRV8	Plant intracellular Ras-group-related LRR protein 2	4.48e-07	NA	1.72e-15
3. B	Q80XU8	Leucine-rich repeat and fibronectin type-III domain-containing protein 4	8.23e-04	NA	3.25e-05
3. B	O75427	Leucine-rich repeat and calponin homology domain-containing protein 4	3.62e-05	NA	3.49e-12
3. B	Q9TTB4	Fibromodulin (Fragment)	1.61e-09	NA	0.001
3. B	Q7SXW3	Leucine-rich repeat-containing protein 40	1.87e-08	NA	8.44e-20
3. B	O88520	Leucine-rich repeat protein SHOC-2	1.29e-08	NA	3.10e-15
3. B	Q6K7R2	Plant intracellular Ras-group-related LRR protein 6	6.64e-07	NA	1.64e-11
3. B	Q4UWF4	Uridine 5'-monophosphate transferase	1.90e-04	NA	2.10e-06
3. B	B0BLW3	Leucine-rich repeat-containing G-protein coupled receptor 4	3.02e-04	NA	1.98e-15
3. B	Q8N967	Leucine-rich repeat and transmembrane domain-containing protein 2	9.88e-04	NA	0.015
3. B	Q3V1M1	Immunoglobulin superfamily member 10	4.23e-01	NA	6.41e-04
3. B	C0LGH2	Probable LRR receptor-like serine/threonine-protein kinase At1g56130	7.24e-03	NA	0.001
3. B	C0LGT1	Probable LRR receptor-like serine/threonine-protein kinase At5g10290	2.95e-02	NA	0.031
3. B	O35930	Platelet glycoprotein Ib alpha chain	2.62e-03	NA	1.21e-07
3. B	Q4P9T3	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	6.84e-02	NA	5.64e-09
3. B	P14605	Adenylate cyclase	2.72e-03	NA	1.43e-07
3. B	Q9Z1P4	Leucine-rich repeat-containing G-protein coupled receptor 5	1.81e-03	NA	4.34e-11
3. B	Q9LZV7	Leucine-rich repeat receptor-like protein kinase PXC2	6.97e-07	NA	8.71e-07
3. B	A4IGL7	Peroxidasin	3.10e-01	NA	0.007
3. B	C0LGT6	LRR receptor-like serine/threonine-protein kinase EFR	3.62e-03	NA	2.62e-06
3. B	Q55CS7	MAP kinase phosphatase with leucine-rich repeats protein 1	8.36e-06	NA	1.18e-09
3. B	Q42371	LRR receptor-like serine/threonine-protein kinase ERECTA	1.16e-03	NA	4.29e-14
3. B	Q9RBS2	Protein PopC	2.50e-04	NA	3.23e-13
3. B	Q9HB75	p53-induced death domain-containing protein 1	6.08e-04	NA	2.45e-20
3. B	C0LGW6	LRR receptor-like serine/threonine-protein kinase ERL1	1.85e-03	NA	6.33e-13
3. B	B4N9T4	Leucine-rich repeat protein soc-2 homolog	8.35e-11	NA	1.20e-19
3. B	A1CW67	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	1.66e-02	NA	2.49e-11
3. B	Q5XH73	CCR4-NOT transcription complex subunit 6-like-B	1.06e-02	NA	3.07e-05
3. B	Q3UV48	Leucine-rich repeat-containing protein 30	9.33e-12	NA	3.62e-14
3. B	B3P3E8	Leucine-rich repeat protein soc-2 homolog	7.78e-11	NA	1.80e-19
3. B	F1MCA7	Leucine-rich repeat-containing protein 7	8.03e-03	NA	1.05e-14
3. B	P0DL10	Leucine-rich repeat receptor-like kinase protein THICK TASSEL DWARF1	2.79e-03	NA	2.28e-09
3. B	Q9LY03	Probable LRR receptor-like serine/threonine-protein kinase IRK	3.82e-03	NA	5.22e-12
3. B	P0C7J6	Leucine-rich repeat and fibronectin type III domain-containing protein 1	1.54e-03	NA	0.011
3. B	Q7TQ62	Podocan	4.75e-07	NA	4.93e-05
3. B	Q9FHF0	Disease resistance protein RPS4B	8.44e-03	NA	0.006
3. B	P21810	Biglycan	6.76e-09	NA	1.87e-04
3. B	Q9LRW9	Receptor-like protein 40	7.30e-07	NA	0.002
3. B	A8JAM0	Dynein regulatory complex subunit 7 (Fragment)	2.29e-03	NA	4.07e-19
3. B	Q4R6F0	Leucine-rich repeat and death domain-containing protein 1	4.96e-09	NA	3.66e-17
3. B	Q96NW7	Leucine-rich repeat-containing protein 7	4.37e-03	NA	1.35e-14
3. B	Q658G7	LRR receptor-like serine/threonine-protein kinase SIK1	2.10e-03	NA	2.32e-12
3. B	Q6UWE0	E3 ubiquitin-protein ligase LRSAM1	1.42e-03	NA	5.34e-13
3. B	Q9LVN2	Probably inactive leucine-rich repeat receptor-like protein kinase At5g58150	2.10e-03	NA	1.62e-06
3. B	B8ABC2	Leucine-rich repeat protein 1	1.40e-04	NA	0.010
3. B	Q6NX28	Leucine-rich repeat-containing protein 59	3.24e-03	NA	1.23e-06
3. B	Q5R5V8	Relaxin receptor 1	1.22e-04	NA	1.60e-06
3. B	F4HX15	Phospholipase A I	7.17e-02	NA	6.52e-06
3. B	Q8BVU0	DISP complex protein LRCH3	1.82e-05	NA	1.88e-12
3. B	Q8TDW0	Volume-regulated anion channel subunit LRRC8C	5.94e-06	NA	2.14e-12
3. B	Q38SD2	Leucine-rich repeat serine/threonine-protein kinase 1	6.39e-02	NA	2.40e-07
3. B	Q9SGP2	Receptor-like protein kinase HSL1	6.01e-07	NA	3.02e-09
3. B	Q55FD8	Ras guanine nucleotide exchange factor V	1.56e-02	NA	2.41e-13
3. B	A6NM62	Leucine-rich repeat-containing protein 53	7.49e-03	NA	3.57e-04
3. B	C0LGG9	Probable LRR receptor-like serine/threonine-protein kinase At1g53440	8.27e-03	NA	2.05e-04
3. B	Q9BXB1	Leucine-rich repeat-containing G-protein coupled receptor 4	8.79e-04	NA	9.77e-14
3. B	E5DHB5	Leucine-rich repeat-containing G-protein coupled receptor 5A	1.73e-03	NA	5.17e-06
3. B	Q55CS8	MAP kinase phosphatase with leucine-rich repeats protein 2	1.01e-05	NA	2.34e-09
3. B	Q9LJS0	Receptor-like protein 42	2.35e-03	NA	2.58e-05
3. B	Q96AG4	Leucine-rich repeat-containing protein 59	1.05e-03	NA	2.95e-05
3. B	P58874	Opticin	2.83e-08	NA	4.98e-04
3. B	Q8AVS8	Leucine-rich repeat-containing protein 59	1.87e-03	NA	9.41e-06
3. B	Q9LNV9	Receptor-like protein 1	1.02e-02	NA	5.96e-07
3. B	Q55E58	Probable serine/threonine-protein kinase pats1	NA	NA	1.29e-11
3. B	Q1PEN0	Receptor-like protein 36	1.87e-05	NA	7.49e-04
3. B	F4J7T6	Receptor-like protein 39	1.27e-04	NA	3.63e-04
3. B	Q54Y32	MAP kinase phosphatase with leucine-rich repeats protein 3	1.29e-04	NA	1.51e-10
3. B	A2ARI4	Leucine-rich repeat-containing G-protein coupled receptor 4	4.06e-04	NA	4.44e-13
3. B	O49329	Receptor like protein 24	2.46e-03	NA	5.93e-05
3. B	Q6NU09	Volume-regulated anion channel subunit LRRC8E	1.07e-08	NA	4.72e-12
3. B	Q28CU0	Leucine-rich repeat-containing protein 23	8.47e-08	NA	3.80e-06
3. B	F4I2N7	Receptor-like protein kinase 7	1.31e-04	NA	1.45e-04
3. B	O48849	Receptor like protein 23	6.45e-05	NA	0.003
3. B	Q9C0I9	Leucine-rich repeat-containing protein 27	2.50e-02	NA	0.035
3. B	B7XK66	Probable CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	2.60e-03	NA	1.37e-09
3. B	Q6IRN0	Serine/threonine-protein kinase 11-interacting protein	9.49e-03	NA	0.002
3. B	P07359	Platelet glycoprotein Ib alpha chain	1.19e-03	NA	3.03e-05
3. B	Q9SJQ1	Leucine-rich repeat receptor-like protein kinase PXC1	1.97e-02	NA	0.003
3. B	P70587	Leucine-rich repeat-containing protein 7	6.52e-03	NA	5.69e-14
3. B	Q94F62	BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1	1.87e-02	NA	0.024
3. B	B4PU77	Leucine-rich repeat protein soc-2 homolog	7.88e-11	NA	1.51e-19
3. B	Q96LI5	CCR4-NOT transcription complex subunit 6-like	8.23e-03	NA	8.15e-07
3. B	Q7XA40	Putative disease resistance protein RGA3	6.78e-04	NA	1.51e-05
3. B	F4KHA2	Receptor-like protein 54	5.04e-03	NA	3.18e-04
3. B	Q7L0X0	TLR4 interactor with leucine rich repeats	2.22e-04	NA	1.69e-04
3. B	Q0PV50	Toll-like receptor 3	2.99e-03	NA	5.62e-07
3. B	C0LGF5	LRR receptor-like serine/threonine-protein kinase RGI5	3.45e-03	NA	1.01e-09
3. B	P0CC10	Leucine-rich repeat-containing protein 4B	1.32e-04	NA	1.27e-04
3. B	A6H694	Leucine-rich repeat-containing protein 63	4.50e-05	NA	2.50e-15
3. B	Q8N6Y2	Leucine-rich repeat-containing protein 17	4.54e-05	NA	1.20e-04
3. B	Q9LJY0	Pollen receptor-like kinase 4	4.97e-02	NA	0.031
3. B	Q9M9S4	Probable LRR receptor-like serine/threonine-protein kinase At1g14390	5.25e-04	NA	0.004
3. B	P35859	Insulin-like growth factor-binding protein complex acid labile subunit	1.75e-05	NA	2.58e-07
3. B	Q9BGY6	Leucine-rich repeat-containing protein 53	1.75e-04	NA	1.95e-05
3. B	Q8K3P5	CCR4-NOT transcription complex subunit 6	6.17e-03	NA	7.98e-09
3. B	P51890	Lumican	3.73e-11	NA	7.81e-04
3. B	C0LGD7	Probable LRR receptor-like serine/threonine-protein kinase At1g06840	4.27e-03	NA	0.018
3. B	Q9ERV7	p53-induced death domain-containing protein 1	7.97e-04	NA	5.26e-17
3. B	O48573	Disease resistance protein LAZ5	1.23e-02	NA	1.67e-04
3. B	C0LGI5	Probable LRR receptor-like serine/threonine-protein kinase At1g69990	1.86e-02	NA	1.83e-05
3. B	P50609	Fibromodulin	6.33e-11	NA	0.003
3. B	Q9H9A6	Leucine-rich repeat-containing protein 40	1.86e-08	NA	1.03e-18
3. B	O94294	Leucine-rich repeat-containing protein sog2	2.97e-02	NA	1.21e-06
3. B	Q54M77	Probable serine/threonine-protein kinase roco8	3.49e-02	NA	8.80e-15
3. B	Q5Z9N5	Leucine-rich repeat receptor-like kinase protein FLORAL ORGAN NUMBER1	3.17e-03	NA	1.06e-06
3. B	O35367	Keratocan	3.93e-11	NA	0.004
3. B	F4K6B8	Leucine-rich repeat receptor-like serine/threonine-protein kinase RGI4	5.70e-03	NA	1.70e-13
3. B	Q810B9	SLIT and NTRK-like protein 3	1.74e-02	NA	6.14e-04
3. B	Q9Y4C4	Malignant fibrous histiocytoma-amplified sequence 1	1.47e-03	NA	2.22e-24
3. B	Q9C7S5	Tyrosine-sulfated glycopeptide receptor 1	5.45e-03	NA	1.27e-05
3. B	Q66JT1	Volume-regulated anion channel subunit LRRC8E	1.66e-05	NA	6.23e-14
3. B	Q9LHP4	LRR receptor-like serine/threonine-protein kinase RGI1	4.78e-03	NA	6.94e-09
3. B	Q14160	Protein scribble homolog	2.83e-03	NA	1.29e-12
3. B	Q6XHA7	Probable serine/threonine-protein kinase roco9	NA	NA	9.49e-15
3. B	P0DO09	Disease resistance protein Piks-1	6.82e-03	NA	4.69e-10
3. B	Q9SVW8	Plant intracellular Ras-group-related LRR protein 4	1.22e-06	NA	1.84e-11
3. B	F7D3V9	Leucine-rich repeat-containing G-protein coupled receptor 5	1.46e-03	NA	6.38e-10
3. B	Q6R2K1	Protein STRUBBELIG-RECEPTOR FAMILY 5	1.36e-02	NA	7.37e-04
3. B	A6H6A4	Leucine-rich repeat and IQ domain-containing protein 4	2.89e-06	NA	1.85e-15
3. B	Q9SUQ3	Probable inactive receptor kinase At4g23740	1.60e-02	NA	0.006
3. B	Q1ENI8	Peroxidasin homolog pxn-1	1.92e-01	NA	0.013
3. B	Q6NUI6	Chondroadherin-like protein	2.53e-04	NA	1.29e-08
3. B	P17778	Outer membrane protein YopM	5.75e-05	NA	2.95e-07
3. B	Q9ZWC8	Serine/threonine-protein kinase BRI1-like 1	1.50e-02	NA	6.85e-07
3. B	Q1EA11	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	2.27e-02	NA	3.43e-08
3. B	Q5RJR8	Leucine-rich repeat-containing protein 59	8.91e-04	NA	7.32e-05
3. B	P49606	Adenylate cyclase	8.78e-02	NA	1.26e-10
3. B	O81825	Probable disease resistance protein At4g27220	3.21e-03	NA	1.76e-04
3. B	O88280	Slit homolog 3 protein	1.53e-02	NA	3.03e-04
3. B	Q9FFJ3	Plant intracellular Ras-group-related LRR protein 1	2.50e-07	NA	7.12e-15
3. B	Q93373	Leucine-rich repeat-containing protein let-4	5.05e-05	NA	3.71e-06
3. B	Q9M2Z1	Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2	6.66e-07	NA	4.93e-09
3. B	Q9WVB4	Slit homolog 3 protein	2.82e-02	NA	2.31e-04
3. B	Q9Z2H4	Leucine-rich repeat-containing G-protein coupled receptor 4	2.67e-03	NA	1.15e-12
3. B	Q6CEJ6	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	8.35e-02	NA	6.53e-07
3. B	P0DM44	Leucine-rich repeat-containing G-protein coupled receptor 6	1.49e-03	NA	8.15e-09
3. B	Q8W4S5	Probable LRR receptor-like serine/threonine-protein kinase At5g63710	1.40e-01	NA	0.016
3. B	A0A0R0HPY5	Leucine-rich repeat receptor-like kinase protein CLV1a	5.14e-03	NA	7.53e-11
3. B	P35858	Insulin-like growth factor-binding protein complex acid labile subunit	1.69e-05	NA	1.78e-04
3. B	Q6GV17	Toll-like receptor 10	8.76e-04	NA	7.87e-04
3. B	Q9D5S7	Leucine-rich repeat and guanylate kinase domain-containing protein	4.67e-04	NA	2.27e-07
3. B	Q9QX05	Toll-like receptor 4	3.51e-04	NA	0.049
3. B	O35125	Leucine-rich repeat-containing protein 23	1.21e-06	NA	5.13e-06
3. B	O65440	Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM3	6.54e-03	NA	4.21e-12
3. B	Q7XV05	LRR receptor kinase SERK2	2.18e-02	NA	1.99e-04
3. B	Q69SP5	LRR receptor-like serine/threonine-protein kinase ER1	1.83e-03	NA	3.96e-16
3. B	Q8VYT3	Probable LRR receptor-like serine/threonine-protein kinase At4g30520	3.01e-02	NA	8.21e-04
3. B	Q9CAK1	Disease resistance protein RML1B	2.73e-02	NA	0.019
3. B	Q54T82	Putative leucine-rich repeat-containing protein DDB_G0281931	4.61e-04	NA	4.63e-05
3. B	Q6WRH9	Immunoglobulin superfamily member 10	4.02e-01	NA	5.30e-04
3. B	O46542	Decorin	1.10e-08	NA	0.012
3. B	Q9SHI3	Receptor-like protein 2	6.14e-04	NA	2.30e-06
3. B	F2VYU4	Disease resistance protein Pik-1	5.53e-03	NA	4.53e-10
3. B	P58823	Polygalacturonase inhibitor 3	9.49e-10	NA	3.54e-05
3. B	D0ZVG2	E3 ubiquitin-protein ligase SspH1	8.35e-04	NA	2.64e-06
3. B	A2BHJ4	CCR4-NOT transcription complex subunit 6-like	8.97e-03	NA	8.70e-12
3. B	Q5VQP7	Leucine-rich repeat protein 1	8.12e-04	NA	0.010
3. B	Q9M6A7	Leucine-rich repeat receptor-like kinase protein CLV1B	3.37e-03	NA	5.88e-08
3. B	D0ZPH9	E3 ubiquitin-protein ligase SspH2	7.21e-04	NA	1.77e-06
3. B	Q99PI8	Reticulon-4 receptor	3.72e-05	NA	3.63e-04
3. B	Q9FL51	Probably inactive leucine-rich repeat receptor-like protein kinase At5g06940	6.31e-04	NA	3.17e-07
3. B	Q9LK43	Receptor-like kinase TMK4	9.64e-03	NA	0.003
3. B	P82963	Chaoptin (Fragment)	7.91e-04	NA	1.73e-05
3. B	B8BB68	LRR receptor kinase BAK1	3.88e-02	NA	1.45e-04
3. B	F4J8G2	Receptor-like protein 33	1.08e-03	NA	1.22e-07
3. B	Q6P4K6	Serine/threonine-protein kinase 11-interacting protein	6.32e-03	NA	0.015
3. B	Q69JN6	Brassinosteroid LRR receptor kinase BRL1	2.55e-02	NA	1.41e-08
3. B	C0LGK9	Probable LRR receptor-like serine/threonine-protein kinase At2g24230	1.10e-03	NA	2.28e-05
3. B	O94991	SLIT and NTRK-like protein 5	2.06e-02	NA	4.63e-04
3. B	Q9VPF0	Protein artichoke	1.51e-02	NA	4.55e-05
3. B	Q9SD62	Putative receptor-like protein kinase At3g47110	2.87e-03	NA	0.004
3. B	Q9FRS6	Leucine-rich repeat receptor-like protein kinase PXL1	3.23e-03	NA	3.63e-13
3. B	P08678	Adenylate cyclase	2.92e-02	NA	8.41e-13
3. B	Q9ZUK7	Receptor-like protein 18	2.72e-07	NA	4.83e-06
3. B	Q6PJG9	Leucine-rich repeat and fibronectin type-III domain-containing protein 4	5.91e-04	NA	4.58e-05
3. B	Q9BTN0	Leucine-rich repeat and fibronectin type-III domain-containing protein 3	1.67e-03	NA	0.029
3. B	P34268	Protein flightless-1 homolog	1.24e-03	NA	5.81e-12
3. B	Q86WK6	Amphoterin-induced protein 1	6.98e-04	NA	7.59e-05
3. B	P0DO05	Receptor-like protein 9DC1	7.53e-03	NA	6.09e-06
3. B	P51887	Fibromodulin	5.45e-07	NA	1.86e-05
3. B	Q3E991	Pollen receptor-like kinase 6	1.63e-02	NA	3.17e-07
3. B	Q8RWZ1	Protein STRUBBELIG	1.11e-02	NA	8.92e-04
3. B	Q8W4Q3	Plant intracellular Ras-group-related LRR protein 3	7.83e-07	NA	2.71e-15
3. B	Q9SHI4	Receptor-like protein 3	1.38e-03	NA	2.31e-06
3. B	C0LGX1	Probable LRR receptor-like serine/threonine-protein kinase At5g65240	5.63e-02	NA	0.008
3. B	Q70AK3	Leucine-rich repeat transmembrane protein FLRT3	1.42e-04	NA	6.90e-04
3. B	D2HFT7	Leucine-rich repeat and fibronectin type-III domain-containing protein 3	1.23e-03	NA	0.030
3. B	Q9SYQ8	Receptor protein kinase CLAVATA1	3.54e-03	NA	6.88e-08
3. B	Q9M9X0	Receptor-like protein 32	2.06e-03	NA	6.72e-06
3. B	C0LGG8	Probable LRR receptor-like serine/threonine-protein kinase At1g53430	1.00e-02	NA	7.45e-06
3. B	Q9SKK2	Receptor like protein 21	5.41e-03	NA	1.37e-09
3. B	O94769	Extracellular matrix protein 2	2.05e-04	NA	7.17e-08
3. B	Q9IB75	Biglycan	8.05e-09	NA	1.50e-05
3. B	Q920A0	Opticin	1.40e-06	NA	0.038
3. B	Q5XM32	Relaxin receptor 2	1.80e-04	NA	2.87e-05
3. B	Q7XA42	Putative disease resistance protein RGA1	3.74e-04	NA	0.003
3. B	P36047	Protein phosphatase 1 regulatory subunit SDS22	4.30e-13	NA	0.012
3. B	Q68F79	Volume-regulated anion channel subunit LRRC8E	2.99e-06	NA	7.59e-12
3. B	B4JTV9	Leucine-rich repeat protein soc-2 homolog	6.01e-11	NA	9.63e-18
3. B	Q6IR85	CCR4-NOT transcription complex subunit 6-like-A	1.15e-02	NA	2.78e-05
3. B	C0LGX3	LRR receptor-like serine/threonine-protein kinase HSL2	2.72e-06	NA	4.85e-08
3. B	A8WHP9	Leucine-rich repeat-containing protein 3	2.83e-03	NA	0.005
3. B	Q9JJ28	Protein flightless-1 homolog	7.97e-04	NA	4.48e-13
3. B	V5NAL9	Toll-like receptor 4	8.00e-03	NA	0.001
3. B	Q9LVM0	Probable inactive receptor kinase At5g58300	2.96e-02	NA	0.005
3. B	Q9FN37	Phytosulfokine receptor 2	1.85e-03	NA	7.09e-05
3. B	B0W6M9	Leucine-rich repeat protein soc-2 homolog	1.86e-08	NA	6.87e-17
3. B	Q6R6I6	Relaxin receptor 1	2.02e-04	NA	6.30e-06
3. B	Q2QZF2	Disease resistance protein PIK5-NP	1.17e-03	NA	2.15e-13
3. B	Q810B7	SLIT and NTRK-like protein 5	1.80e-02	NA	4.88e-04
3. B	Q9LRT1	Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040	1.05e-03	NA	3.89e-07
3. B	O49325	Receptor like protein 28	1.76e-03	NA	2.94e-05
3. B	O02833	Insulin-like growth factor-binding protein complex acid labile subunit	1.67e-05	NA	1.54e-04
3. B	Q922Q8	Leucine-rich repeat-containing protein 59	1.49e-03	NA	5.85e-05
3. B	Q5R7M3	Amphoterin-induced protein 2	2.58e-03	NA	0.002
3. B	P58822	Polygalacturonase inhibitor 2	8.13e-10	NA	3.32e-05
3. B	O22476	Protein BRASSINOSTEROID INSENSITIVE 1	4.59e-03	NA	9.36e-06
3. B	Q6JN46	Receptor-like protein EIX2	3.99e-06	NA	0.003
3. B	Q9FPJ5	Leucine-rich repeat protein 1	1.48e-04	NA	0.002
3. B	P0C192	Leucine-rich repeat-containing protein 4B	1.32e-04	NA	1.16e-04
3. B	A4IIK1	Malignant fibrous histiocytoma-amplified sequence 1 homolog	1.03e-06	NA	3.53e-17
3. B	Q9TTE2	Decorin	1.40e-08	NA	0.030
3. B	Q5DU41	Volume-regulated anion channel subunit LRRC8B	7.46e-07	NA	5.65e-09
3. B	Q5PP26	Piriformospora indica-insensitive protein 2	1.85e-06	NA	0.017
3. B	O74874	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	5.46e-02	NA	2.46e-11
3. B	Q94AG2	Somatic embryogenesis receptor kinase 1	3.23e-02	NA	0.036
3. B	C0LGF4	LRR receptor-like serine/threonine-protein kinase FEI 1	1.62e-02	NA	5.01e-04
3. B	Q8SU52	Probable CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	4.36e-03	NA	4.41e-13
3. B	Q9TZM3	Leucine-rich repeat serine/threonine-protein kinase 1	9.99e-02	NA	0.003
3. B	P58681	Toll-like receptor 7	2.65e-03	NA	0.004
3. B	P0CE12	E3 ubiquitin-protein ligase SspH2	7.34e-04	NA	1.77e-06
3. B	Q9V477	Toll-like receptor Tollo	6.31e-03	NA	6.97e-07
3. B	C0LGH3	Probable LRR receptor-like serine/threonine-protein kinase At1g56140	7.10e-03	NA	0.002
3. B	Q9T048	Disease resistance protein At4g27190	2.69e-02	NA	0.002
3. B	Q8C110	SLIT and NTRK-like protein 6	1.54e-03	NA	7.79e-04
3. B	Q7XA39	Putative disease resistance protein RGA4	9.15e-04	NA	4.99e-04
3. B	O48788	Probable inactive receptor kinase At2g26730	5.92e-03	NA	0.006
3. B	C0LGU5	Probable LRR receptor-like serine/threonine-protein kinase At5g45780	2.29e-02	NA	0.036
3. B	B4QVR7	Leucine-rich repeat protein soc-2 homolog	1.92e-05	NA	1.34e-19
3. B	Q4R3P6	Leucine-rich repeat-containing protein 40	1.82e-06	NA	6.91e-19
3. B	Q6P9F7	Volume-regulated anion channel subunit LRRC8B	8.05e-07	NA	1.85e-09
3. B	Q5A761	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	5.61e-02	NA	4.61e-08
3. B	O48851	Receptor like protein 22	3.58e-05	NA	4.05e-06
3. B	C0LGL9	LRR receptor-like serine/threonine-protein kinase FEI 2	1.76e-02	NA	3.43e-04
3. B	Q7F8Q9	Leucine-rich repeat receptor protein kinase MSL1	3.42e-03	NA	2.36e-08
3. B	Q8GUQ5	Brassinosteroid LRR receptor kinase	1.12e-02	NA	2.32e-07
3. B	Q6XHB2	Probable serine/threonine-protein kinase roco4	6.43e-01	NA	1.93e-05
3. B	O94898	Leucine-rich repeats and immunoglobulin-like domains protein 2	1.59e-03	NA	2.21e-05
3. B	Q9LJW7	Receptor-like protein 43	6.76e-05	NA	4.17e-05
3. B	A6NIV6	Leucine-rich repeat and IQ domain-containing protein 4	7.13e-06	NA	1.05e-18
3. B	P24014	Protein slit	4.54e-02	NA	0.006
3. B	Q9LRR4	Putative disease resistance RPP13-like protein 1	6.57e-03	NA	0.011
3. B	P62046	Leucine-rich repeat and calponin homology domain-containing protein 1	5.14e-05	NA	8.89e-12
3. B	Q498T9	Volume-regulated anion channel subunit LRRC8C	3.18e-06	NA	9.74e-12
3. B	Q7FZR1	Receptor-like protein 52	3.95e-04	NA	1.85e-06
3. B	Q9LT96	Probable leucine-rich repeat receptor-like protein kinase At5g49770	2.77e-03	NA	4.70e-04
3. B	O60938	Keratocan	3.79e-11	NA	0.036
3. B	Q4V8G0	Leucine-rich repeat-containing protein 63	2.88e-05	NA	3.03e-15
3. B	Q9S7I6	LRR receptor-like serine/threonine-protein kinase RPK2	5.52e-03	NA	7.87e-07
3. B	Q8IW35	Centrosomal protein of 97 kDa	7.60e-04	NA	1.22e-05
3. B	C0LGI2	Probable LRR receptor-like serine/threonine-protein kinase At1g67720	3.22e-01	NA	0.017
3. B	C0LGV1	LRR receptor-like serine/threonine-protein kinase RGI2	2.73e-03	NA	7.24e-09
3. B	Q8C0R9	Leucine-rich repeat and death domain-containing protein 1	1.26e-05	NA	1.64e-18
3. B	A4IFA6	Immunoglobulin superfamily containing leucine-rich repeat protein	1.42e-03	NA	0.025
3. B	Q9M2Y3	Receptor-like protein 44	4.23e-04	NA	0.002
3. B	Q9M1L7	Pollen receptor-like kinase 3	9.80e-03	NA	0.004
3. B	Q3KRC6	Volume-regulated anion channel subunit LRRC8E	8.15e-06	NA	5.02e-14
3. B	Q7XDQ7	Plant intracellular Ras-group-related LRR protein 8	7.84e-09	NA	1.34e-16
3. B	O94933	SLIT and NTRK-like protein 3	1.10e-02	NA	5.98e-04
3. B	Q9CZ62	Centrosomal protein of 97 kDa	1.47e-03	NA	1.06e-04
3. B	Q9VZZ4	Peroxidasin	1.51e-01	NA	0.001
3. B	Q06828	Fibromodulin	6.77e-11	NA	0.001
3. B	Q921G6	Leucine-rich repeat and calponin homology domain-containing protein 4	6.51e-06	NA	1.14e-09
3. B	Q8WXD0	Relaxin receptor 2	1.90e-04	NA	0.004
3. B	O81765	Pollen-specific leucine-rich repeat extensin-like protein 4	7.71e-04	NA	9.20e-05
3. B	G2K3G6	Internalin A	2.86e-04	NA	0.001
3. B	Q84WJ9	Protein phosphatase 1 regulatory inhibitor subunit PPP1R7 homolog	2.44e-08	NA	0.022
3. B	Q0JA29	LRR receptor-like serine/threonine-protein kinase FLS2	5.52e-03	NA	8.42e-12
3. B	Q4V8I7	Volume-regulated anion channel subunit LRRC8A	7.02e-07	NA	6.53e-12
3. B	E7FE13	Leucine-rich repeat-containing G-protein coupled receptor 4	9.61e-05	NA	1.32e-11
3. B	C0LGJ1	Probable LRR receptor-like serine/threonine-protein kinase At1g74360	1.19e-03	NA	2.35e-10
3. B	Q9NYK1	Toll-like receptor 7	3.58e-03	NA	0.022
3. B	P23515	Oligodendrocyte-myelin glycoprotein	1.49e-05	NA	2.54e-12
3. B	Q9LJ64	Pollen-specific leucine-rich repeat extensin-like protein 1	4.23e-03	NA	0.032
3. B	F4J9A8	Receptor-like protein 45	7.63e-04	NA	7.52e-04
3. B	A5PK13	Volume-regulated anion channel subunit LRRC8C	8.95e-07	NA	1.90e-12
3. B	C0LGQ5	LRR receptor-like serine/threonine-protein kinase GSO1	5.37e-03	NA	1.45e-10
3. B	F1NUK7	Leucine-rich repeat transmembrane protein FLRT3	3.27e-05	NA	3.71e-06
3. B	Q5U308	Volume-regulated anion channel subunit LRRC8D	3.04e-06	NA	2.68e-14
3. B	Q496Z2	TLR4 interactor with leucine rich repeats	1.18e-03	NA	0.003
3. B	Q5R6T0	Leucine-rich repeat transmembrane protein FLRT3	3.98e-05	NA	4.72e-07
3. B	Q5B778	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	4.68e-02	NA	6.93e-10
3. B	Q3MHH9	Extracellular matrix protein 2	4.35e-08	NA	4.53e-07
3. B	C0LGG7	Probable LRR receptor-like serine/threonine-protein kinase At1g53420	4.27e-03	NA	8.71e-06
3. B	Q5U508	Tubulin-specific chaperone E	4.99e-04	NA	3.24e-06
3. B	P28675	Decorin	9.96e-09	NA	0.020
3. B	Q8BLU0	Leucine-rich repeat transmembrane protein FLRT2	1.24e-04	NA	0.014
3. B	A4D1F6	Leucine-rich repeat and death domain-containing protein 1	2.16e-09	NA	1.45e-16
3. B	Q9FP13	LRR receptor kinase SERL2	5.41e-02	NA	5.77e-04
3. B	P23466	Adenylate cyclase	2.17e-02	NA	9.91e-12
3. B	Q6XHA5	Probable serine/threonine-protein kinase roco11	3.60e-01	NA	1.11e-05
3. B	B1H134	Leucine-rich repeat transmembrane protein FLRT3	4.62e-05	NA	3.68e-04
3. B	Q5F4C4	Leucine-rich repeat protein SHOC-2	2.16e-09	NA	4.20e-16
3. B	O49318	Probable leucine-rich repeat receptor-like protein kinase At2g33170	5.19e-03	NA	1.41e-08
3. B	Q54TM7	Probable serine/threonine-protein kinase drkD	2.62e-02	NA	5.02e-12
3. B	F4JGB6	Receptor-like protein 46	9.78e-04	NA	1.05e-06
3. B	F4K4T3	Receptor-like protein 56	1.31e-06	NA	9.06e-07
3. B	C0LGS2	Probable LRR receptor-like serine/threonine-protein kinase At4g36180	6.46e-03	NA	9.20e-10
3. B	Q9DE67	Lumican	1.38e-10	NA	0.001
3. B	P21793	Decorin	2.27e-08	NA	0.035
3. B	Q80WG5	Volume-regulated anion channel subunit LRRC8A	6.81e-07	NA	6.02e-12