Summary

Q96E66

Homolog: B6CZ45.
Function: Leucine-rich repeat-containing protein 51.

Statistics

Total GO Annotation: 192
Unique PROST Go: 80
Unique BLAST Go: 95

Total Homologs: 168
Unique PROST Homologs: 75
Unique BLAST Homologs: 74

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was B6CZ45 (Leucine-rich repeat-containing protein 51) with a FATCAT P-Value: 0.0 and RMSD of 1.41 angstrom. The sequence alignment identity is 97.4%.
Structural alignment shown in left. Query protein Q96E66 colored as red in alignment, homolog B6CZ45 colored as blue. Query protein Q96E66 is also shown in right top, homolog B6CZ45 showed in right bottom. They are colored based on secondary structures. 

  Q96E66 MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSLTQSLWLNNNVLNDLRDFNQVASQLLEHPENLAWIDLSFNDLTSIDPVLTT 100
  B6CZ45 MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSLTQSLWLNNNVLNDLRDFNQVASQLLEHPENLAWIDLSFNDLTSIDPVLTT 100

  Q96E66 FFNLSVLYLHGNSIQRLGEVNKLAVLPRLRSLTLHGNPMEEEKGYRQYVLCTLSRITTFDFSGVTKADRTTAEVWKRMNIKPKKAWTKQNTL 192
  B6CZ45 FFNLSVLYLHGNSIQHLGEVNKLAVLPRLRSLTLHGNPMEEEKGYRQYVLCTLPHITTFDFSGVTKADRTTAEVWKRMNIKPKKARIKQNTL 192

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0043014 alpha-tubulin binding
1. PB GO:0036158 outer dynein arm assembly
1. PB GO:0030286 dynein complex
1. PB GO:0005815 microtubule organizing center
1. PB GO:0002177 manchette
1. PB GO:0030620 U2 snRNA binding
1. PB GO:0042995 cell projection
1. PB GO:0015630 microtubule cytoskeleton
1. PB GO:0000398 mRNA splicing, via spliceosome
1. PB GO:0045504 dynein heavy chain binding
1. PB GO:0005874 microtubule
1. PB GO:0005681 spliceosomal complex
1. PB GO:0071004 U2-type prespliceosome
1. PB GO:0031514 motile cilium
1. PB GO:0005686 U2 snRNP
1. PB GO:0036157 outer dynein arm
1. PB GO:0070840 dynein complex binding
2. P GO:0021540 corpus callosum morphogenesis
2. P GO:0021766 hippocampus development
2. P GO:0034142 toll-like receptor 4 signaling pathway
2. P GO:0021960 anterior commissure morphogenesis
2. P GO:1901970 positive regulation of mitotic sister chromatid separation
2. P GO:0030500 regulation of bone mineralization
2. P GO:0070848 response to growth factor
2. P GO:0007601 visual perception
2. P GO:0060122 inner ear receptor cell stereocilium organization
2. P GO:0043202 lysosomal lumen
2. P GO:0051216 cartilage development
2. P GO:0006404 RNA import into nucleus
2. P GO:0007023 post-chaperonin tubulin folding pathway
2. P GO:0032914 positive regulation of transforming growth factor beta1 production
2. P GO:0005796 Golgi lumen
2. P GO:0002718 regulation of cytokine production involved in immune response
2. P GO:0072357 PTW/PP1 phosphatase complex
2. P GO:0019834 phospholipase A2 inhibitor activity
2. P GO:0030017 sarcomere
2. P GO:2000179 positive regulation of neural precursor cell proliferation
2. P GO:1904761 negative regulation of myofibroblast differentiation
2. P GO:0051457 maintenance of protein location in nucleus
2. P GO:0031430 M band
2. P GO:0030021 extracellular matrix structural constituent conferring compression resistance
2. P GO:0023052 signaling
2. P GO:0007021 tubulin complex assembly
2. P GO:0000054 ribosomal subunit export from nucleus
2. P GO:0031012 extracellular matrix
2. P GO:0005518 collagen binding
2. P GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
2. P GO:0055008 cardiac muscle tissue morphogenesis
2. P GO:0072542 protein phosphatase activator activity
2. P GO:0010468 regulation of gene expression
2. P GO:0003431 growth plate cartilage chondrocyte development
2. P GO:0043010 camera-type eye development
2. P GO:0005615 extracellular space
2. P GO:0007155 cell adhesion
2. P GO:0007165 signal transduction
2. P GO:0004722 protein serine/threonine phosphatase activity
2. P GO:0033344 cholesterol efflux
2. P GO:0055013 cardiac muscle cell development
2. P GO:0090009 primitive streak formation
2. P GO:0006407 rRNA export from nucleus
2. P GO:0042632 cholesterol homeostasis
2. P GO:0010977 negative regulation of neuron projection development
2. P GO:0030178 negative regulation of Wnt signaling pathway
2. P GO:0070062 extracellular exosome
2. P GO:0060047 heart contraction
2. P GO:0097009 energy homeostasis
2. P GO:0046696 lipopolysaccharide receptor complex
2. P GO:0036122 BMP binding
2. P GO:0010921 regulation of phosphatase activity
2. P GO:0050431 transforming growth factor beta binding
2. P GO:0019005 SCF ubiquitin ligase complex
2. P GO:0008203 cholesterol metabolic process
2. P GO:0021670 lateral ventricle development
2. P GO:0043231 intracellular membrane-bounded organelle
2. P GO:0005583 fibrillar collagen trimer
2. P GO:0042635 positive regulation of hair cycle
2. P GO:0005925 focal adhesion
2. P GO:0051393 alpha-actinin binding
2. P GO:0098868 bone growth
2. P GO:0030199 collagen fibril organization
2. P GO:0005813 centrosome
2. P GO:0061073 ciliary body morphogenesis
2. P GO:0006409 tRNA export from nucleus
2. P GO:0003779 actin binding
2. P GO:0062023 collagen-containing extracellular matrix
2. P GO:0032911 negative regulation of transforming growth factor beta1 production
2. P GO:0005856 cytoskeleton
2. P GO:0010811 positive regulation of cell-substrate adhesion
2. P GO:0042060 wound healing
2. P GO:0030512 negative regulation of transforming growth factor beta receptor signaling pathway
2. P GO:0015631 tubulin binding
2. P GO:0000164 protein phosphatase type 1 complex
2. P GO:0046600 negative regulation of centriole replication
2. P GO:0014070 response to organic cyclic compound
2. P GO:0005614 interstitial matrix
2. P GO:0004865 protein serine/threonine phosphatase inhibitor activity
2. P GO:0043547 positive regulation of GTPase activity
3. B GO:0030014 CCR4-NOT complex
3. B GO:0035082 axoneme assembly
3. B GO:0090651 apical cytoplasm
3. B GO:0035904 aorta development
3. B GO:0061512 protein localization to cilium
3. B GO:0070286 axonemal dynein complex assembly
3. B GO:0003351 epithelial cilium movement involved in extracellular fluid movement
3. B GO:0000175 3'-5'-exoribonuclease activity
3. B GO:0010378 temperature compensation of the circadian clock
3. B GO:0055037 recycling endosome
3. B GO:0090660 cerebrospinal fluid circulation
3. B GO:0045171 intercellular bridge
3. B GO:0001947 heart looping
3. B GO:2000155 positive regulation of cilium-dependent cell motility
3. B GO:0033365 protein localization to organelle
3. B GO:0016601 Rac protein signal transduction
3. B GO:0006006 glucose metabolic process
3. B GO:0000389 mRNA 3'-splice site recognition
3. B GO:0005178 integrin binding
3. B GO:0071907 determination of digestive tract left/right asymmetry
3. B GO:0097733 photoreceptor cell cilium
3. B GO:0036064 ciliary basal body
3. B GO:0008092 cytoskeletal protein binding
3. B GO:0005929 cilium
3. B GO:0005930 axoneme
3. B GO:0090543 Flemming body
3. B GO:0120103 centriolar subdistal appendage
3. B GO:0035469 determination of pancreatic left/right asymmetry
3. B GO:0120293 dynein axonemal particle
3. B GO:0007010 cytoskeleton organization
3. B GO:0003146 heart jogging
3. B GO:0048243 norepinephrine secretion
3. B GO:0032228 regulation of synaptic transmission, GABAergic
3. B GO:0097431 mitotic spindle pole
3. B GO:0003281 ventricular septum development
3. B GO:0007268 chemical synaptic transmission
3. B GO:0060294 cilium movement involved in cell motility
3. B GO:0048132 female germ-line stem cell asymmetric division
3. B GO:0043393 regulation of protein binding
3. B GO:0030336 negative regulation of cell migration
3. B GO:0005524 ATP binding
3. B GO:0001750 photoreceptor outer segment
3. B GO:0000289 nuclear-transcribed mRNA poly(A) tail shortening
3. B GO:0003341 cilium movement
3. B GO:0004535 poly(A)-specific ribonuclease activity
3. B GO:0008217 regulation of blood pressure
3. B GO:0071910 determination of liver left/right asymmetry
3. B GO:0048793 pronephros development
3. B GO:0030036 actin cytoskeleton organization
3. B GO:0060027 convergent extension involved in gastrulation
3. B GO:0001822 kidney development
3. B GO:0003305 cell migration involved in heart jogging
3. B GO:0003314 heart rudiment morphogenesis
3. B GO:0005769 early endosome
3. B GO:0003143 embryonic heart tube morphogenesis
3. B GO:0007283 spermatogenesis
3. B GO:0030324 lung development
3. B GO:0072687 meiotic spindle
3. B GO:0061458 reproductive system development
3. B GO:0004385 guanylate kinase activity
3. B GO:0042769 obsolete DNA damage response, detection of DNA damage
3. B GO:0035091 phosphatidylinositol binding
3. B GO:0060287 epithelial cilium movement involved in determination of left/right asymmetry
3. B GO:0032391 photoreceptor connecting cilium
3. B GO:0060271 cilium assembly
3. B GO:0030317 flagellated sperm motility
3. B GO:0060285 cilium-dependent cell motility
3. B GO:0030532 small nuclear ribonucleoprotein complex
3. B GO:0071007 U2-type catalytic step 2 spliceosome
3. B GO:0060972 left/right pattern formation
3. B GO:0120229 protein localization to motile cilium
3. B GO:0071005 U2-type precatalytic spliceosome
3. B GO:0045433 male courtship behavior, veined wing generated song production
3. B GO:0003356 regulation of cilium beat frequency
3. B GO:0007368 determination of left/right symmetry
3. B GO:0005829 cytosol
3. B GO:0030030 cell projection organization
3. B GO:0036159 inner dynein arm assembly
3. B GO:0003279 cardiac septum development
3. B GO:0090619 meiotic spindle pole
3. B GO:0000932 P-body
3. B GO:0061371 determination of heart left/right asymmetry
3. B GO:0051493 regulation of cytoskeleton organization
3. B GO:0045202 synapse
3. B GO:0044458 motile cilium assembly
3. B GO:0051649 establishment of localization in cell
3. B GO:0071013 catalytic step 2 spliceosome
3. B GO:0040022 feminization of hermaphroditic germ-line
3. B GO:0001669 acrosomal vesicle
3. B GO:0016607 nuclear speck
3. B GO:0007224 smoothened signaling pathway
3. B GO:0030015 CCR4-NOT core complex
3. B GO:0060976 coronary vasculature development
3. B GO:0051729 germline cell cycle switching, mitotic to meiotic cell cycle
3. B GO:0008584 male gonad development

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q4LDG9 Dynein axonemal light chain 1 6.36e-09 8.86e-26 0.048
1. PB Q5EAD8 Leucine-rich repeat-containing protein 51 0.00e+00 7.72e-91 1.65e-126
1. PB Q9XHH2 Dynein axonemal light chain 1 1.92e-11 3.54e-28 1.05e-06
1. PB Q28CU0 Leucine-rich repeat-containing protein 23 8.77e-09 3.15e-06 3.44e-09
1. PB Q6DHB1 Dynein axonemal light chain 1 5.17e-09 1.61e-22 0.028
1. PB Q9DAK8 Leucine-rich repeat-containing protein 51 0.00e+00 6.85e-86 1.98e-123
1. PB Q6FV04 U2 small nuclear ribonucleoprotein A' 1.24e-09 1.62e-02 0.017
1. PB Q6C417 U2 small nuclear ribonucleoprotein A' 2.86e-11 2.07e-21 2.19e-06
1. PB Q8T888 Dynein axonemal light chain 1 5.45e-09 2.54e-24 0.001
1. PB B6CZ45 Leucine-rich repeat-containing protein 51 0.00e+00 1.96e-107 6.85e-137
1. PB B6CZ61 Leucine-rich repeat-containing protein 51 0.00e+00 5.90e-93 2.40e-126
1. PB Q96E66 Leucine-rich repeat-containing protein 51 0 3.74e-144 4.28e-142
1. PB Q08963 U2 small nuclear ribonucleoprotein A' 2.44e-09 5.17e-07 1.64e-05
1. PB B6CZ54 Leucine-rich repeat-containing protein 51 0.00e+00 1.96e-107 6.85e-137
1. PB Q5A449 U2 small nuclear ribonucleoprotein A' 2.04e-09 1.79e-02 5.39e-06
1. PB Q32KP2 Leucine-rich repeat-containing protein 23 6.01e-09 4.89e-08 4.11e-07
1. PB B6CZ40 Leucine-rich repeat-containing protein 51 0.00e+00 4.84e-125 2.71e-140
1. PB O35125 Leucine-rich repeat-containing protein 23 3.17e-09 5.26e-10 8.99e-07
1. PB Q53EV4 Leucine-rich repeat-containing protein 23 1.05e-06 1.91e-10 6.99e-06
2. P P11745 Ran GTPase-activating protein 1 2.89e-03 1.27e-02 NA
2. P Q9Y546 Leucine-rich repeat-containing protein 42 3.41e-03 1.02e-02 NA
2. P Q65YW8 Tsukushi-A 2.13e-03 4.46e-04 NA
2. P Q641R9 Dynein axonemal light chain 1 7.06e-09 7.67e-23 NA
2. P Q7XNY1 Plant intracellular Ras-group-related LRR protein 1 1.61e-03 2.43e-07 NA
2. P Q6QMY6 Tsukushi 1.55e-04 8.83e-06 NA
2. P B9F655 Plant intracellular Ras-group-related LRR protein 7 2.12e-04 2.13e-06 NA
2. P Q01730 Ras suppressor protein 1 4.40e-04 8.97e-13 NA
2. P Q8WUA8 Tsukushi 1.62e-04 2.92e-04 NA
2. P Q7Z4L9 Protein phosphatase 1 regulatory subunit 42 1.22e-06 3.20e-07 NA
2. P P22194 Protein phosphatase 1 regulatory subunit SDS22 3.14e-07 9.80e-06 NA
2. P Q9UUG2 Uncharacterized leucine-rich repeat-containing protein C926.06c 4.69e-04 5.01e-04 NA
2. P Q32L08 Protein AMN1 homolog 6.09e-04 1.17e-02 NA
2. P Q9D1G5 Leucine-rich repeat-containing protein 57 8.77e-05 1.63e-05 NA
2. P Q5FVI3 Leucine-rich repeat-containing protein 57 1.44e-04 7.02e-05 NA
2. P Q8N456 Leucine-rich repeat-containing protein 18 2.34e-05 2.59e-10 NA
2. P Q6GQN5 Protein phosphatase 1 regulatory subunit 42 2.62e-05 4.75e-04 NA
2. P Q99983 Osteomodulin 4.31e-04 3.18e-05 NA
2. P Q8N9N7 Leucine-rich repeat-containing protein 57 8.49e-05 6.28e-05 NA
2. P A6NIK2 Leucine-rich repeat-containing protein 10B 5.55e-04 2.21e-04 NA
2. P Q9CQ76 Nephrocan 3.37e-03 4.44e-03 NA
2. P Q2HJ90 Leucine-rich repeat-containing protein 42 3.50e-03 4.05e-02 NA
2. P Q96DD0 Leucine-rich repeat-containing protein 39 2.47e-03 1.52e-06 NA
2. P Q28G94 Dynein axonemal light chain 1 5.03e-09 7.67e-23 NA
2. P O64566 Plant intracellular Ras-group-related LRR protein 6 1.15e-03 2.14e-04 NA
2. P Q5U201 Protein AMN1 homolog 5.48e-04 2.51e-02 NA
2. P Q8K3W2 Leucine-rich repeat-containing protein 10 2.71e-04 3.32e-07 NA
2. P P51885 Lumican 3.20e-03 2.49e-02 NA
2. P Q8IY45 Protein AMN1 homolog 6.54e-04 4.71e-03 NA
2. P O93233 Phospholipase A2 inhibitor 2.64e-05 1.72e-02 NA
2. P Q5G5D8 Plant intracellular Ras-group-related LRR protein 7 1.52e-03 7.16e-04 NA
2. P P51884 Lumican 1.78e-03 2.40e-02 NA
2. P A6NM36 Leucine-rich repeat-containing protein 30 1.82e-05 1.04e-05 NA
2. P Q8CI70 Leucine-rich repeat-containing protein 20 2.95e-05 9.11e-13 NA
2. P O77742 Osteomodulin 4.71e-03 2.84e-05 NA
2. P Q5E9C0 Ras suppressor protein 1 5.40e-06 9.76e-12 NA
2. P B8JKV0 Protein AMN1 homolog 1.71e-03 4.37e-02 NA
2. P Q66HD6 Leucine-rich repeat-containing protein 18 2.72e-05 1.67e-11 NA
2. P Q6INV3 Leucine-rich repeat-containing protein 57 2.15e-03 3.80e-05 NA
2. P Q8BGI7 Leucine-rich repeat-containing protein 39 5.79e-03 2.34e-07 NA
2. P Q8TCA0 Leucine-rich repeat-containing protein 20 2.66e-05 7.34e-15 NA
2. P P51886 Lumican 2.40e-03 1.22e-02 NA
2. P Q9CQ07 Leucine-rich repeat-containing protein 18 3.40e-05 3.20e-11 NA
2. P F1R6I3 Leucine-rich repeat-containing protein 39 3.96e-03 4.40e-07 NA
2. P P71451 Internalin C 6.77e-05 2.92e-03 NA
2. P Q55CN0 Tubulin-specific chaperone E 1.36e-05 1.47e-06 NA
2. P C0STK7 Phospholipase A2 inhibitor beta NA 1.22e-02 NA
2. P Q8RWE5 Plant intracellular Ras-group-related LRR protein 8 6.01e-04 8.46e-05 NA
2. P Q05A62 Dynein axonemal light chain 1 7.45e-09 3.71e-27 NA
2. P A0A096MJZ0 Dynein axonemal light chain 1 1.57e-10 5.85e-25 NA
2. P Q5M7S9 Tsukushi 1.39e-04 4.13e-02 NA
2. P Q3UV48 Leucine-rich repeat-containing protein 30 1.85e-05 5.26e-03 NA
2. P A8JHD7 Dynein regulatory complex subunit 6 8.00e-03 6.04e-03 NA
2. P Q5BKY1 Leucine-rich repeat-containing protein 10 5.70e-04 1.24e-06 NA
2. P Q24K06 Leucine-rich repeat-containing protein 10 5.46e-04 2.12e-07 NA
2. P O35103 Osteomodulin 4.20e-04 1.15e-05 NA
2. P P36047 Protein phosphatase 1 regulatory subunit SDS22 7.47e-04 3.10e-03 NA
2. P Q755D2 U2 small nuclear ribonucleoprotein A' 2.22e-09 1.09e-07 NA
2. P Q65Z91 Tsukushi 2.12e-03 3.39e-04 NA
2. P Q3UGP9 Leucine-rich repeat-containing protein 58 7.97e-04 7.06e-03 NA
2. P Q3ZC49 Leucine-rich repeat-containing protein 39 5.29e-03 3.89e-08 NA
2. P Q5R8X9 Protein AMN1 homolog 5.16e-04 2.25e-02 NA
2. P P45969 Protein phosphatase 1 regulatory subunit SDS22 homolog 5.01e-08 2.43e-03 NA
2. P Q4R803 Protein phosphatase 1 regulatory subunit 42 3.76e-06 2.01e-03 NA
2. P Q4V8D9 Leucine-rich repeat-containing protein 34 7.41e-03 6.64e-05 NA
2. P Q2KID4 Dynein axonemal light chain 1 7.04e-09 1.25e-23 NA
2. P Q0P4D1 Protein AMN1 homolog 1.42e-03 1.86e-02 NA
2. P Q96CX6 Leucine-rich repeat-containing protein 58 8.97e-04 5.98e-03 NA
2. P Q05443 Lumican 2.73e-03 1.06e-02 NA
2. P Q15404 Ras suppressor protein 1 5.10e-06 3.59e-12 NA
2. P Q9DAM1 Leucine-rich repeat-containing protein 34 8.23e-03 5.94e-05 NA
2. P D3ZXS4 Leucine-rich repeat-containing protein 39 4.85e-03 6.74e-08 NA
2. P Q9Z1S7 Osteomodulin 4.15e-04 1.43e-06 NA
2. P Q8CBR6 Tsukushi 1.70e-04 1.01e-04 NA
2. P Q8VDB8 Leucine-rich repeat-containing protein 2 6.63e-03 1.43e-04 NA
3. B Q8IYG6 Leucine-rich repeat-containing protein 56 7.83e-05 NA 5.77e-05
3. B Q5BGW9 U2 small nuclear ribonucleoprotein A' 1.21e-09 NA 0.014
3. B B3DH20 Dynein axonemal assembly factor 11 2.36e-07 NA 1.59e-07
3. B B4GT53 Dynein axonemal assembly factor 1 homolog 9.87e-03 NA 6.07e-04
3. B A1CIJ6 CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 1.06e-02 NA 2.74e-04
3. B P43333 U2 small nuclear ribonucleoprotein A' 1.89e-11 NA 4.53e-05
3. B Q91YK0 Leucine-rich repeat-containing protein 49 2.19e-04 NA 2.32e-05
3. B Q3V0M2 Leucine-rich repeat-containing protein 36 7.48e-05 NA 0.007
3. B O88978 Dynein axonemal assembly factor 11 2.96e-07 NA 9.38e-05
3. B A0JM56 Leucine-rich repeat-containing protein 9 1.85e-02 NA 3.41e-04
3. B Q4WQG5 CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 2.44e-02 NA 0.004
3. B Q7S9P4 U2 small nuclear ribonucleoprotein A' 7.64e-11 NA 0.001
3. B Q2UUI3 CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 1.85e-02 NA 8.13e-04
3. B Q4G017 Nischarin 3.41e-03 NA 0.001
3. B Q387Y5 Leucine-rich repeat-containing protein 56 homolog 6.65e-03 NA 0.034
3. B Q4R6X9 Dynein regulatory complex subunit 3 1.71e-05 NA 9.13e-07
3. B Q8CDN9 Leucine-rich repeat-containing protein 9 2.06e-03 NA 2.55e-08
3. B B6D5P1 Dynein axonemal assembly factor 1 1.02e-05 NA 0.008
3. B Q9BLB6 Probable U2 small nuclear ribonucleoprotein A' 1.71e-10 NA 9.75e-06
3. B Q86X45 Dynein axonemal assembly factor 11 2.81e-07 NA 0.006
3. B Q6NRC9 Leucine-rich repeat and coiled-coil domain-containing protein 1 3.78e-02 NA 8.98e-04
3. B Q4P5F9 U2 small nuclear ribonucleoprotein A' 1.18e-10 NA 0.003
3. B Q7Z7A1 Centriolin 4.02e-02 NA 0.020
3. B Q4WV66 U2 small nuclear ribonucleoprotein A' 1.70e-10 NA 3.65e-04
3. B P57784 U2 small nuclear ribonucleoprotein A' 4.41e-11 NA 7.45e-04
3. B Q9V4Q8 Probable U2 small nuclear ribonucleoprotein A' 7.15e-11 NA 1.91e-04
3. B Q8K375 Leucine-rich repeat-containing protein 56 7.76e-05 NA 5.64e-04
3. B Q7PK92 Dynein axonemal assembly factor 1 homolog 3.39e-03 NA 9.88e-06
3. B Q8R2R5 Leucine-rich repeat-containing protein 61 2.40e-07 NA 0.034
3. B Q28FY0 Dynein axonemal assembly factor 11 3.21e-07 NA 3.55e-07
3. B Q3SYS4 Dynein axonemal assembly factor 1 1.99e-04 NA 0.010
3. B Q9Y2I1 Nischarin 4.52e-03 NA 0.004
3. B Q9VR52 Protein tilB 4.16e-08 NA 6.64e-04
3. B Q5XI54 Dynein regulatory complex subunit 3 4.65e-05 NA 4.14e-08
3. B Q9NJE9 Dynein axonemal assembly factor 11 9.62e-06 NA 0.002
3. B Q1RMR5 Dynein axonemal assembly factor 11 3.79e-07 NA 1.44e-05
3. B A2AL36 Centriolin 6.84e-02 NA 7.64e-04
3. B B3NLX1 Dynein axonemal assembly factor 1 homolog 8.97e-03 NA 0.036
3. B Q1X8D7 Leucine-rich repeat-containing protein 36 5.79e-05 NA 0.003
3. B A8IVX2 Dynein regulatory complex subunit 3 2.19e-05 NA 2.02e-09
3. B Q29KL8 Dynein axonemal assembly factor 1 homolog 1.33e-02 NA 8.19e-04
3. B Q6ZRR7 Leucine-rich repeat-containing protein 9 2.19e-02 NA 3.35e-08
3. B A1CW67 CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 1.95e-02 NA 0.004
3. B Q4V8C9 Leucine-rich repeat-containing protein 56 8.29e-05 NA 2.16e-04
3. B Q09JZ4 Leucine-rich repeat-containing protein ODA7 2.24e-07 NA 4.33e-04
3. B B6D5P6 Dynein axonemal assembly factor 1 1.07e-05 NA 0.006
3. B O43822 Cilia- and flagella-associated protein 410 3.80e-09 NA 1.39e-05
3. B Q1EA11 CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 1.61e-02 NA 0.010
3. B Q0CT27 CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 1.21e-02 NA 0.001
3. B Q16RY9 Dynein axonemal assembly factor 1 homolog 1.16e-02 NA 2.78e-05
3. B Q0U7W4 CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 3.47e-03 NA 0.018
3. B A0A1L8G016 Dynein axonemal assembly factor 11 3.01e-07 NA 1.33e-07
3. B Q5B778 CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 1.20e-02 NA 0.038
3. B P09661 U2 small nuclear ribonucleoprotein A' 4.28e-11 NA 6.91e-04
3. B Q80TM9 Nischarin 6.53e-03 NA 1.44e-04
3. B Q9USX8 U2 small nuclear ribonucleoprotein A' 1.46e-10 NA 2.90e-05
3. B Q7ZY40 Acidic leucine-rich nuclear phosphoprotein 32 family member E 2.13e-08 NA 0.038
3. B Q9D5E4 Dynein regulatory complex subunit 3 2.38e-05 NA 1.05e-08
3. B Q6AYH9 Dynein axonemal assembly factor 1 1.21e-05 NA 0.001
3. B Q7ZV84 Dynein axonemal assembly factor 1 6.94e-05 NA 0.002
3. B Q4R8Y8 U2 small nuclear ribonucleoprotein A' 4.36e-11 NA 6.91e-04
3. B Q9D2H9 Dynein axonemal assembly factor 1 2.04e-06 NA 8.27e-04
3. B Q9H069 Dynein regulatory complex subunit 3 1.89e-05 NA 1.91e-05
3. B Q8C6G1 Cilia- and flagella-associated protein 410 2.72e-09 NA 4.04e-04
3. B P34390 Uncharacterized protein F09G8.5 4.13e-05 NA 2.33e-05
3. B Q8INT5 Dynein axonemal assembly factor 1 homolog 8.86e-03 NA 0.038
3. B Q96M69 Leucine-rich repeat and guanylate kinase domain-containing protein 2.04e-05 NA 0.002
3. B B4P6W7 Dynein axonemal assembly factor 1 homolog 1.05e-02 NA 0.040
3. B Q4R3F0 Protein tilB homolog 2.50e-07 NA 0.001
3. B Q8IUZ0 Leucine-rich repeat-containing protein 49 1.28e-05 NA 3.28e-04
3. B Q9D5S7 Leucine-rich repeat and guanylate kinase domain-containing protein 2.12e-05 NA 0.011
3. B B6D5P3 Dynein axonemal assembly factor 1 1.14e-05 NA 0.009
3. B Q8NEP3 Dynein axonemal assembly factor 1 4.01e-04 NA 0.001
3. B A6PVS8 Leucine-rich repeat and IQ domain-containing protein 3 5.74e-04 NA 0.009