Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
B6CZ45
(Leucine-rich repeat-containing protein 51) with a FATCAT P-Value: 0.0 and RMSD of 1.41 angstrom. The sequence alignment identity is 97.4%.
Structural alignment shown in left. Query protein Q96E66 colored as red in alignment, homolog B6CZ45 colored as blue.
Query protein Q96E66 is also shown in right top, homolog B6CZ45 showed in right bottom. They are colored based on secondary structures.
Q96E66 MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSLTQSLWLNNNVLNDLRDFNQVASQLLEHPENLAWIDLSFNDLTSIDPVLTT 100 B6CZ45 MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSLTQSLWLNNNVLNDLRDFNQVASQLLEHPENLAWIDLSFNDLTSIDPVLTT 100 Q96E66 FFNLSVLYLHGNSIQRLGEVNKLAVLPRLRSLTLHGNPMEEEKGYRQYVLCTLSRITTFDFSGVTKADRTTAEVWKRMNIKPKKAWTKQNTL 192 B6CZ45 FFNLSVLYLHGNSIQHLGEVNKLAVLPRLRSLTLHGNPMEEEKGYRQYVLCTLPHITTFDFSGVTKADRTTAEVWKRMNIKPKKARIKQNTL 192
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0043014 | alpha-tubulin binding |
| 1. PB | GO:0036158 | outer dynein arm assembly |
| 1. PB | GO:0030286 | dynein complex |
| 1. PB | GO:0005815 | microtubule organizing center |
| 1. PB | GO:0002177 | manchette |
| 1. PB | GO:0030620 | U2 snRNA binding |
| 1. PB | GO:0042995 | cell projection |
| 1. PB | GO:0015630 | microtubule cytoskeleton |
| 1. PB | GO:0000398 | mRNA splicing, via spliceosome |
| 1. PB | GO:0045504 | dynein heavy chain binding |
| 1. PB | GO:0005874 | microtubule |
| 1. PB | GO:0005681 | spliceosomal complex |
| 1. PB | GO:0071004 | U2-type prespliceosome |
| 1. PB | GO:0031514 | motile cilium |
| 1. PB | GO:0005686 | U2 snRNP |
| 1. PB | GO:0036157 | outer dynein arm |
| 1. PB | GO:0070840 | dynein complex binding |
| 2. P | GO:0021540 | corpus callosum morphogenesis |
| 2. P | GO:0021766 | hippocampus development |
| 2. P | GO:0034142 | toll-like receptor 4 signaling pathway |
| 2. P | GO:0021960 | anterior commissure morphogenesis |
| 2. P | GO:1901970 | positive regulation of mitotic sister chromatid separation |
| 2. P | GO:0030500 | regulation of bone mineralization |
| 2. P | GO:0070848 | response to growth factor |
| 2. P | GO:0007601 | visual perception |
| 2. P | GO:0060122 | inner ear receptor cell stereocilium organization |
| 2. P | GO:0043202 | lysosomal lumen |
| 2. P | GO:0051216 | cartilage development |
| 2. P | GO:0006404 | RNA import into nucleus |
| 2. P | GO:0007023 | post-chaperonin tubulin folding pathway |
| 2. P | GO:0032914 | positive regulation of transforming growth factor beta1 production |
| 2. P | GO:0005796 | Golgi lumen |
| 2. P | GO:0002718 | regulation of cytokine production involved in immune response |
| 2. P | GO:0072357 | PTW/PP1 phosphatase complex |
| 2. P | GO:0019834 | phospholipase A2 inhibitor activity |
| 2. P | GO:0030017 | sarcomere |
| 2. P | GO:2000179 | positive regulation of neural precursor cell proliferation |
| 2. P | GO:1904761 | negative regulation of myofibroblast differentiation |
| 2. P | GO:0051457 | maintenance of protein location in nucleus |
| 2. P | GO:0031430 | M band |
| 2. P | GO:0030021 | extracellular matrix structural constituent conferring compression resistance |
| 2. P | GO:0023052 | signaling |
| 2. P | GO:0007021 | tubulin complex assembly |
| 2. P | GO:0000054 | ribosomal subunit export from nucleus |
| 2. P | GO:0031012 | extracellular matrix |
| 2. P | GO:0005518 | collagen binding |
| 2. P | GO:0031146 | SCF-dependent proteasomal ubiquitin-dependent protein catabolic process |
| 2. P | GO:0055008 | cardiac muscle tissue morphogenesis |
| 2. P | GO:0072542 | protein phosphatase activator activity |
| 2. P | GO:0010468 | regulation of gene expression |
| 2. P | GO:0003431 | growth plate cartilage chondrocyte development |
| 2. P | GO:0043010 | camera-type eye development |
| 2. P | GO:0005615 | extracellular space |
| 2. P | GO:0007155 | cell adhesion |
| 2. P | GO:0007165 | signal transduction |
| 2. P | GO:0004722 | protein serine/threonine phosphatase activity |
| 2. P | GO:0033344 | cholesterol efflux |
| 2. P | GO:0055013 | cardiac muscle cell development |
| 2. P | GO:0090009 | primitive streak formation |
| 2. P | GO:0006407 | rRNA export from nucleus |
| 2. P | GO:0042632 | cholesterol homeostasis |
| 2. P | GO:0010977 | negative regulation of neuron projection development |
| 2. P | GO:0030178 | negative regulation of Wnt signaling pathway |
| 2. P | GO:0070062 | extracellular exosome |
| 2. P | GO:0060047 | heart contraction |
| 2. P | GO:0097009 | energy homeostasis |
| 2. P | GO:0046696 | lipopolysaccharide receptor complex |
| 2. P | GO:0036122 | BMP binding |
| 2. P | GO:0010921 | regulation of phosphatase activity |
| 2. P | GO:0050431 | transforming growth factor beta binding |
| 2. P | GO:0019005 | SCF ubiquitin ligase complex |
| 2. P | GO:0008203 | cholesterol metabolic process |
| 2. P | GO:0021670 | lateral ventricle development |
| 2. P | GO:0043231 | intracellular membrane-bounded organelle |
| 2. P | GO:0005583 | fibrillar collagen trimer |
| 2. P | GO:0042635 | positive regulation of hair cycle |
| 2. P | GO:0005925 | focal adhesion |
| 2. P | GO:0051393 | alpha-actinin binding |
| 2. P | GO:0098868 | bone growth |
| 2. P | GO:0030199 | collagen fibril organization |
| 2. P | GO:0005813 | centrosome |
| 2. P | GO:0061073 | ciliary body morphogenesis |
| 2. P | GO:0006409 | tRNA export from nucleus |
| 2. P | GO:0003779 | actin binding |
| 2. P | GO:0062023 | collagen-containing extracellular matrix |
| 2. P | GO:0032911 | negative regulation of transforming growth factor beta1 production |
| 2. P | GO:0005856 | cytoskeleton |
| 2. P | GO:0010811 | positive regulation of cell-substrate adhesion |
| 2. P | GO:0042060 | wound healing |
| 2. P | GO:0030512 | negative regulation of transforming growth factor beta receptor signaling pathway |
| 2. P | GO:0015631 | tubulin binding |
| 2. P | GO:0000164 | protein phosphatase type 1 complex |
| 2. P | GO:0046600 | negative regulation of centriole replication |
| 2. P | GO:0014070 | response to organic cyclic compound |
| 2. P | GO:0005614 | interstitial matrix |
| 2. P | GO:0004865 | protein serine/threonine phosphatase inhibitor activity |
| 2. P | GO:0043547 | positive regulation of GTPase activity |
| 3. B | GO:0030014 | CCR4-NOT complex |
| 3. B | GO:0035082 | axoneme assembly |
| 3. B | GO:0090651 | apical cytoplasm |
| 3. B | GO:0035904 | aorta development |
| 3. B | GO:0061512 | protein localization to cilium |
| 3. B | GO:0070286 | axonemal dynein complex assembly |
| 3. B | GO:0003351 | epithelial cilium movement involved in extracellular fluid movement |
| 3. B | GO:0000175 | 3'-5'-exoribonuclease activity |
| 3. B | GO:0010378 | temperature compensation of the circadian clock |
| 3. B | GO:0055037 | recycling endosome |
| 3. B | GO:0090660 | cerebrospinal fluid circulation |
| 3. B | GO:0045171 | intercellular bridge |
| 3. B | GO:0001947 | heart looping |
| 3. B | GO:2000155 | positive regulation of cilium-dependent cell motility |
| 3. B | GO:0033365 | protein localization to organelle |
| 3. B | GO:0016601 | Rac protein signal transduction |
| 3. B | GO:0006006 | glucose metabolic process |
| 3. B | GO:0000389 | mRNA 3'-splice site recognition |
| 3. B | GO:0005178 | integrin binding |
| 3. B | GO:0071907 | determination of digestive tract left/right asymmetry |
| 3. B | GO:0097733 | photoreceptor cell cilium |
| 3. B | GO:0036064 | ciliary basal body |
| 3. B | GO:0008092 | cytoskeletal protein binding |
| 3. B | GO:0005929 | cilium |
| 3. B | GO:0005930 | axoneme |
| 3. B | GO:0090543 | Flemming body |
| 3. B | GO:0120103 | centriolar subdistal appendage |
| 3. B | GO:0035469 | determination of pancreatic left/right asymmetry |
| 3. B | GO:0120293 | dynein axonemal particle |
| 3. B | GO:0007010 | cytoskeleton organization |
| 3. B | GO:0003146 | heart jogging |
| 3. B | GO:0048243 | norepinephrine secretion |
| 3. B | GO:0032228 | regulation of synaptic transmission, GABAergic |
| 3. B | GO:0097431 | mitotic spindle pole |
| 3. B | GO:0003281 | ventricular septum development |
| 3. B | GO:0007268 | chemical synaptic transmission |
| 3. B | GO:0060294 | cilium movement involved in cell motility |
| 3. B | GO:0048132 | female germ-line stem cell asymmetric division |
| 3. B | GO:0043393 | regulation of protein binding |
| 3. B | GO:0030336 | negative regulation of cell migration |
| 3. B | GO:0005524 | ATP binding |
| 3. B | GO:0001750 | photoreceptor outer segment |
| 3. B | GO:0000289 | nuclear-transcribed mRNA poly(A) tail shortening |
| 3. B | GO:0003341 | cilium movement |
| 3. B | GO:0004535 | poly(A)-specific ribonuclease activity |
| 3. B | GO:0008217 | regulation of blood pressure |
| 3. B | GO:0071910 | determination of liver left/right asymmetry |
| 3. B | GO:0048793 | pronephros development |
| 3. B | GO:0030036 | actin cytoskeleton organization |
| 3. B | GO:0060027 | convergent extension involved in gastrulation |
| 3. B | GO:0001822 | kidney development |
| 3. B | GO:0003305 | cell migration involved in heart jogging |
| 3. B | GO:0003314 | heart rudiment morphogenesis |
| 3. B | GO:0005769 | early endosome |
| 3. B | GO:0003143 | embryonic heart tube morphogenesis |
| 3. B | GO:0007283 | spermatogenesis |
| 3. B | GO:0030324 | lung development |
| 3. B | GO:0072687 | meiotic spindle |
| 3. B | GO:0061458 | reproductive system development |
| 3. B | GO:0004385 | guanylate kinase activity |
| 3. B | GO:0042769 | obsolete DNA damage response, detection of DNA damage |
| 3. B | GO:0035091 | phosphatidylinositol binding |
| 3. B | GO:0060287 | epithelial cilium movement involved in determination of left/right asymmetry |
| 3. B | GO:0032391 | photoreceptor connecting cilium |
| 3. B | GO:0060271 | cilium assembly |
| 3. B | GO:0030317 | flagellated sperm motility |
| 3. B | GO:0060285 | cilium-dependent cell motility |
| 3. B | GO:0030532 | small nuclear ribonucleoprotein complex |
| 3. B | GO:0071007 | U2-type catalytic step 2 spliceosome |
| 3. B | GO:0060972 | left/right pattern formation |
| 3. B | GO:0120229 | protein localization to motile cilium |
| 3. B | GO:0071005 | U2-type precatalytic spliceosome |
| 3. B | GO:0045433 | male courtship behavior, veined wing generated song production |
| 3. B | GO:0003356 | regulation of cilium beat frequency |
| 3. B | GO:0007368 | determination of left/right symmetry |
| 3. B | GO:0005829 | cytosol |
| 3. B | GO:0030030 | cell projection organization |
| 3. B | GO:0036159 | inner dynein arm assembly |
| 3. B | GO:0003279 | cardiac septum development |
| 3. B | GO:0090619 | meiotic spindle pole |
| 3. B | GO:0000932 | P-body |
| 3. B | GO:0061371 | determination of heart left/right asymmetry |
| 3. B | GO:0051493 | regulation of cytoskeleton organization |
| 3. B | GO:0045202 | synapse |
| 3. B | GO:0044458 | motile cilium assembly |
| 3. B | GO:0051649 | establishment of localization in cell |
| 3. B | GO:0071013 | catalytic step 2 spliceosome |
| 3. B | GO:0040022 | feminization of hermaphroditic germ-line |
| 3. B | GO:0001669 | acrosomal vesicle |
| 3. B | GO:0016607 | nuclear speck |
| 3. B | GO:0007224 | smoothened signaling pathway |
| 3. B | GO:0030015 | CCR4-NOT core complex |
| 3. B | GO:0060976 | coronary vasculature development |
| 3. B | GO:0051729 | germline cell cycle switching, mitotic to meiotic cell cycle |
| 3. B | GO:0008584 | male gonad development |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q4LDG9 | Dynein axonemal light chain 1 | 6.36e-09 | 8.86e-26 | 0.048 |
| 1. PB | Q5EAD8 | Leucine-rich repeat-containing protein 51 | 0.00e+00 | 7.72e-91 | 1.65e-126 |
| 1. PB | Q9XHH2 | Dynein axonemal light chain 1 | 1.92e-11 | 3.54e-28 | 1.05e-06 |
| 1. PB | Q28CU0 | Leucine-rich repeat-containing protein 23 | 8.77e-09 | 3.15e-06 | 3.44e-09 |
| 1. PB | Q6DHB1 | Dynein axonemal light chain 1 | 5.17e-09 | 1.61e-22 | 0.028 |
| 1. PB | Q9DAK8 | Leucine-rich repeat-containing protein 51 | 0.00e+00 | 6.85e-86 | 1.98e-123 |
| 1. PB | Q6FV04 | U2 small nuclear ribonucleoprotein A' | 1.24e-09 | 1.62e-02 | 0.017 |
| 1. PB | Q6C417 | U2 small nuclear ribonucleoprotein A' | 2.86e-11 | 2.07e-21 | 2.19e-06 |
| 1. PB | Q8T888 | Dynein axonemal light chain 1 | 5.45e-09 | 2.54e-24 | 0.001 |
| 1. PB | B6CZ45 | Leucine-rich repeat-containing protein 51 | 0.00e+00 | 1.96e-107 | 6.85e-137 |
| 1. PB | B6CZ61 | Leucine-rich repeat-containing protein 51 | 0.00e+00 | 5.90e-93 | 2.40e-126 |
| 1. PB | Q96E66 | Leucine-rich repeat-containing protein 51 | 0 | 3.74e-144 | 4.28e-142 |
| 1. PB | Q08963 | U2 small nuclear ribonucleoprotein A' | 2.44e-09 | 5.17e-07 | 1.64e-05 |
| 1. PB | B6CZ54 | Leucine-rich repeat-containing protein 51 | 0.00e+00 | 1.96e-107 | 6.85e-137 |
| 1. PB | Q5A449 | U2 small nuclear ribonucleoprotein A' | 2.04e-09 | 1.79e-02 | 5.39e-06 |
| 1. PB | Q32KP2 | Leucine-rich repeat-containing protein 23 | 6.01e-09 | 4.89e-08 | 4.11e-07 |
| 1. PB | B6CZ40 | Leucine-rich repeat-containing protein 51 | 0.00e+00 | 4.84e-125 | 2.71e-140 |
| 1. PB | O35125 | Leucine-rich repeat-containing protein 23 | 3.17e-09 | 5.26e-10 | 8.99e-07 |
| 1. PB | Q53EV4 | Leucine-rich repeat-containing protein 23 | 1.05e-06 | 1.91e-10 | 6.99e-06 |
| 2. P | P11745 | Ran GTPase-activating protein 1 | 2.89e-03 | 1.27e-02 | NA |
| 2. P | Q9Y546 | Leucine-rich repeat-containing protein 42 | 3.41e-03 | 1.02e-02 | NA |
| 2. P | Q65YW8 | Tsukushi-A | 2.13e-03 | 4.46e-04 | NA |
| 2. P | Q641R9 | Dynein axonemal light chain 1 | 7.06e-09 | 7.67e-23 | NA |
| 2. P | Q7XNY1 | Plant intracellular Ras-group-related LRR protein 1 | 1.61e-03 | 2.43e-07 | NA |
| 2. P | Q6QMY6 | Tsukushi | 1.55e-04 | 8.83e-06 | NA |
| 2. P | B9F655 | Plant intracellular Ras-group-related LRR protein 7 | 2.12e-04 | 2.13e-06 | NA |
| 2. P | Q01730 | Ras suppressor protein 1 | 4.40e-04 | 8.97e-13 | NA |
| 2. P | Q8WUA8 | Tsukushi | 1.62e-04 | 2.92e-04 | NA |
| 2. P | Q7Z4L9 | Protein phosphatase 1 regulatory subunit 42 | 1.22e-06 | 3.20e-07 | NA |
| 2. P | P22194 | Protein phosphatase 1 regulatory subunit SDS22 | 3.14e-07 | 9.80e-06 | NA |
| 2. P | Q9UUG2 | Uncharacterized leucine-rich repeat-containing protein C926.06c | 4.69e-04 | 5.01e-04 | NA |
| 2. P | Q32L08 | Protein AMN1 homolog | 6.09e-04 | 1.17e-02 | NA |
| 2. P | Q9D1G5 | Leucine-rich repeat-containing protein 57 | 8.77e-05 | 1.63e-05 | NA |
| 2. P | Q5FVI3 | Leucine-rich repeat-containing protein 57 | 1.44e-04 | 7.02e-05 | NA |
| 2. P | Q8N456 | Leucine-rich repeat-containing protein 18 | 2.34e-05 | 2.59e-10 | NA |
| 2. P | Q6GQN5 | Protein phosphatase 1 regulatory subunit 42 | 2.62e-05 | 4.75e-04 | NA |
| 2. P | Q99983 | Osteomodulin | 4.31e-04 | 3.18e-05 | NA |
| 2. P | Q8N9N7 | Leucine-rich repeat-containing protein 57 | 8.49e-05 | 6.28e-05 | NA |
| 2. P | A6NIK2 | Leucine-rich repeat-containing protein 10B | 5.55e-04 | 2.21e-04 | NA |
| 2. P | Q9CQ76 | Nephrocan | 3.37e-03 | 4.44e-03 | NA |
| 2. P | Q2HJ90 | Leucine-rich repeat-containing protein 42 | 3.50e-03 | 4.05e-02 | NA |
| 2. P | Q96DD0 | Leucine-rich repeat-containing protein 39 | 2.47e-03 | 1.52e-06 | NA |
| 2. P | Q28G94 | Dynein axonemal light chain 1 | 5.03e-09 | 7.67e-23 | NA |
| 2. P | O64566 | Plant intracellular Ras-group-related LRR protein 6 | 1.15e-03 | 2.14e-04 | NA |
| 2. P | Q5U201 | Protein AMN1 homolog | 5.48e-04 | 2.51e-02 | NA |
| 2. P | Q8K3W2 | Leucine-rich repeat-containing protein 10 | 2.71e-04 | 3.32e-07 | NA |
| 2. P | P51885 | Lumican | 3.20e-03 | 2.49e-02 | NA |
| 2. P | Q8IY45 | Protein AMN1 homolog | 6.54e-04 | 4.71e-03 | NA |
| 2. P | O93233 | Phospholipase A2 inhibitor | 2.64e-05 | 1.72e-02 | NA |
| 2. P | Q5G5D8 | Plant intracellular Ras-group-related LRR protein 7 | 1.52e-03 | 7.16e-04 | NA |
| 2. P | P51884 | Lumican | 1.78e-03 | 2.40e-02 | NA |
| 2. P | A6NM36 | Leucine-rich repeat-containing protein 30 | 1.82e-05 | 1.04e-05 | NA |
| 2. P | Q8CI70 | Leucine-rich repeat-containing protein 20 | 2.95e-05 | 9.11e-13 | NA |
| 2. P | O77742 | Osteomodulin | 4.71e-03 | 2.84e-05 | NA |
| 2. P | Q5E9C0 | Ras suppressor protein 1 | 5.40e-06 | 9.76e-12 | NA |
| 2. P | B8JKV0 | Protein AMN1 homolog | 1.71e-03 | 4.37e-02 | NA |
| 2. P | Q66HD6 | Leucine-rich repeat-containing protein 18 | 2.72e-05 | 1.67e-11 | NA |
| 2. P | Q6INV3 | Leucine-rich repeat-containing protein 57 | 2.15e-03 | 3.80e-05 | NA |
| 2. P | Q8BGI7 | Leucine-rich repeat-containing protein 39 | 5.79e-03 | 2.34e-07 | NA |
| 2. P | Q8TCA0 | Leucine-rich repeat-containing protein 20 | 2.66e-05 | 7.34e-15 | NA |
| 2. P | P51886 | Lumican | 2.40e-03 | 1.22e-02 | NA |
| 2. P | Q9CQ07 | Leucine-rich repeat-containing protein 18 | 3.40e-05 | 3.20e-11 | NA |
| 2. P | F1R6I3 | Leucine-rich repeat-containing protein 39 | 3.96e-03 | 4.40e-07 | NA |
| 2. P | P71451 | Internalin C | 6.77e-05 | 2.92e-03 | NA |
| 2. P | Q55CN0 | Tubulin-specific chaperone E | 1.36e-05 | 1.47e-06 | NA |
| 2. P | C0STK7 | Phospholipase A2 inhibitor beta | NA | 1.22e-02 | NA |
| 2. P | Q8RWE5 | Plant intracellular Ras-group-related LRR protein 8 | 6.01e-04 | 8.46e-05 | NA |
| 2. P | Q05A62 | Dynein axonemal light chain 1 | 7.45e-09 | 3.71e-27 | NA |
| 2. P | A0A096MJZ0 | Dynein axonemal light chain 1 | 1.57e-10 | 5.85e-25 | NA |
| 2. P | Q5M7S9 | Tsukushi | 1.39e-04 | 4.13e-02 | NA |
| 2. P | Q3UV48 | Leucine-rich repeat-containing protein 30 | 1.85e-05 | 5.26e-03 | NA |
| 2. P | A8JHD7 | Dynein regulatory complex subunit 6 | 8.00e-03 | 6.04e-03 | NA |
| 2. P | Q5BKY1 | Leucine-rich repeat-containing protein 10 | 5.70e-04 | 1.24e-06 | NA |
| 2. P | Q24K06 | Leucine-rich repeat-containing protein 10 | 5.46e-04 | 2.12e-07 | NA |
| 2. P | O35103 | Osteomodulin | 4.20e-04 | 1.15e-05 | NA |
| 2. P | P36047 | Protein phosphatase 1 regulatory subunit SDS22 | 7.47e-04 | 3.10e-03 | NA |
| 2. P | Q755D2 | U2 small nuclear ribonucleoprotein A' | 2.22e-09 | 1.09e-07 | NA |
| 2. P | Q65Z91 | Tsukushi | 2.12e-03 | 3.39e-04 | NA |
| 2. P | Q3UGP9 | Leucine-rich repeat-containing protein 58 | 7.97e-04 | 7.06e-03 | NA |
| 2. P | Q3ZC49 | Leucine-rich repeat-containing protein 39 | 5.29e-03 | 3.89e-08 | NA |
| 2. P | Q5R8X9 | Protein AMN1 homolog | 5.16e-04 | 2.25e-02 | NA |
| 2. P | P45969 | Protein phosphatase 1 regulatory subunit SDS22 homolog | 5.01e-08 | 2.43e-03 | NA |
| 2. P | Q4R803 | Protein phosphatase 1 regulatory subunit 42 | 3.76e-06 | 2.01e-03 | NA |
| 2. P | Q4V8D9 | Leucine-rich repeat-containing protein 34 | 7.41e-03 | 6.64e-05 | NA |
| 2. P | Q2KID4 | Dynein axonemal light chain 1 | 7.04e-09 | 1.25e-23 | NA |
| 2. P | Q0P4D1 | Protein AMN1 homolog | 1.42e-03 | 1.86e-02 | NA |
| 2. P | Q96CX6 | Leucine-rich repeat-containing protein 58 | 8.97e-04 | 5.98e-03 | NA |
| 2. P | Q05443 | Lumican | 2.73e-03 | 1.06e-02 | NA |
| 2. P | Q15404 | Ras suppressor protein 1 | 5.10e-06 | 3.59e-12 | NA |
| 2. P | Q9DAM1 | Leucine-rich repeat-containing protein 34 | 8.23e-03 | 5.94e-05 | NA |
| 2. P | D3ZXS4 | Leucine-rich repeat-containing protein 39 | 4.85e-03 | 6.74e-08 | NA |
| 2. P | Q9Z1S7 | Osteomodulin | 4.15e-04 | 1.43e-06 | NA |
| 2. P | Q8CBR6 | Tsukushi | 1.70e-04 | 1.01e-04 | NA |
| 2. P | Q8VDB8 | Leucine-rich repeat-containing protein 2 | 6.63e-03 | 1.43e-04 | NA |
| 3. B | Q8IYG6 | Leucine-rich repeat-containing protein 56 | 7.83e-05 | NA | 5.77e-05 |
| 3. B | Q5BGW9 | U2 small nuclear ribonucleoprotein A' | 1.21e-09 | NA | 0.014 |
| 3. B | B3DH20 | Dynein axonemal assembly factor 11 | 2.36e-07 | NA | 1.59e-07 |
| 3. B | B4GT53 | Dynein axonemal assembly factor 1 homolog | 9.87e-03 | NA | 6.07e-04 |
| 3. B | A1CIJ6 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 1.06e-02 | NA | 2.74e-04 |
| 3. B | P43333 | U2 small nuclear ribonucleoprotein A' | 1.89e-11 | NA | 4.53e-05 |
| 3. B | Q91YK0 | Leucine-rich repeat-containing protein 49 | 2.19e-04 | NA | 2.32e-05 |
| 3. B | Q3V0M2 | Leucine-rich repeat-containing protein 36 | 7.48e-05 | NA | 0.007 |
| 3. B | O88978 | Dynein axonemal assembly factor 11 | 2.96e-07 | NA | 9.38e-05 |
| 3. B | A0JM56 | Leucine-rich repeat-containing protein 9 | 1.85e-02 | NA | 3.41e-04 |
| 3. B | Q4WQG5 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 2.44e-02 | NA | 0.004 |
| 3. B | Q7S9P4 | U2 small nuclear ribonucleoprotein A' | 7.64e-11 | NA | 0.001 |
| 3. B | Q2UUI3 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 1.85e-02 | NA | 8.13e-04 |
| 3. B | Q4G017 | Nischarin | 3.41e-03 | NA | 0.001 |
| 3. B | Q387Y5 | Leucine-rich repeat-containing protein 56 homolog | 6.65e-03 | NA | 0.034 |
| 3. B | Q4R6X9 | Dynein regulatory complex subunit 3 | 1.71e-05 | NA | 9.13e-07 |
| 3. B | Q8CDN9 | Leucine-rich repeat-containing protein 9 | 2.06e-03 | NA | 2.55e-08 |
| 3. B | B6D5P1 | Dynein axonemal assembly factor 1 | 1.02e-05 | NA | 0.008 |
| 3. B | Q9BLB6 | Probable U2 small nuclear ribonucleoprotein A' | 1.71e-10 | NA | 9.75e-06 |
| 3. B | Q86X45 | Dynein axonemal assembly factor 11 | 2.81e-07 | NA | 0.006 |
| 3. B | Q6NRC9 | Leucine-rich repeat and coiled-coil domain-containing protein 1 | 3.78e-02 | NA | 8.98e-04 |
| 3. B | Q4P5F9 | U2 small nuclear ribonucleoprotein A' | 1.18e-10 | NA | 0.003 |
| 3. B | Q7Z7A1 | Centriolin | 4.02e-02 | NA | 0.020 |
| 3. B | Q4WV66 | U2 small nuclear ribonucleoprotein A' | 1.70e-10 | NA | 3.65e-04 |
| 3. B | P57784 | U2 small nuclear ribonucleoprotein A' | 4.41e-11 | NA | 7.45e-04 |
| 3. B | Q9V4Q8 | Probable U2 small nuclear ribonucleoprotein A' | 7.15e-11 | NA | 1.91e-04 |
| 3. B | Q8K375 | Leucine-rich repeat-containing protein 56 | 7.76e-05 | NA | 5.64e-04 |
| 3. B | Q7PK92 | Dynein axonemal assembly factor 1 homolog | 3.39e-03 | NA | 9.88e-06 |
| 3. B | Q8R2R5 | Leucine-rich repeat-containing protein 61 | 2.40e-07 | NA | 0.034 |
| 3. B | Q28FY0 | Dynein axonemal assembly factor 11 | 3.21e-07 | NA | 3.55e-07 |
| 3. B | Q3SYS4 | Dynein axonemal assembly factor 1 | 1.99e-04 | NA | 0.010 |
| 3. B | Q9Y2I1 | Nischarin | 4.52e-03 | NA | 0.004 |
| 3. B | Q9VR52 | Protein tilB | 4.16e-08 | NA | 6.64e-04 |
| 3. B | Q5XI54 | Dynein regulatory complex subunit 3 | 4.65e-05 | NA | 4.14e-08 |
| 3. B | Q9NJE9 | Dynein axonemal assembly factor 11 | 9.62e-06 | NA | 0.002 |
| 3. B | Q1RMR5 | Dynein axonemal assembly factor 11 | 3.79e-07 | NA | 1.44e-05 |
| 3. B | A2AL36 | Centriolin | 6.84e-02 | NA | 7.64e-04 |
| 3. B | B3NLX1 | Dynein axonemal assembly factor 1 homolog | 8.97e-03 | NA | 0.036 |
| 3. B | Q1X8D7 | Leucine-rich repeat-containing protein 36 | 5.79e-05 | NA | 0.003 |
| 3. B | A8IVX2 | Dynein regulatory complex subunit 3 | 2.19e-05 | NA | 2.02e-09 |
| 3. B | Q29KL8 | Dynein axonemal assembly factor 1 homolog | 1.33e-02 | NA | 8.19e-04 |
| 3. B | Q6ZRR7 | Leucine-rich repeat-containing protein 9 | 2.19e-02 | NA | 3.35e-08 |
| 3. B | A1CW67 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 1.95e-02 | NA | 0.004 |
| 3. B | Q4V8C9 | Leucine-rich repeat-containing protein 56 | 8.29e-05 | NA | 2.16e-04 |
| 3. B | Q09JZ4 | Leucine-rich repeat-containing protein ODA7 | 2.24e-07 | NA | 4.33e-04 |
| 3. B | B6D5P6 | Dynein axonemal assembly factor 1 | 1.07e-05 | NA | 0.006 |
| 3. B | O43822 | Cilia- and flagella-associated protein 410 | 3.80e-09 | NA | 1.39e-05 |
| 3. B | Q1EA11 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 1.61e-02 | NA | 0.010 |
| 3. B | Q0CT27 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 1.21e-02 | NA | 0.001 |
| 3. B | Q16RY9 | Dynein axonemal assembly factor 1 homolog | 1.16e-02 | NA | 2.78e-05 |
| 3. B | Q0U7W4 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 3.47e-03 | NA | 0.018 |
| 3. B | A0A1L8G016 | Dynein axonemal assembly factor 11 | 3.01e-07 | NA | 1.33e-07 |
| 3. B | Q5B778 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 1.20e-02 | NA | 0.038 |
| 3. B | P09661 | U2 small nuclear ribonucleoprotein A' | 4.28e-11 | NA | 6.91e-04 |
| 3. B | Q80TM9 | Nischarin | 6.53e-03 | NA | 1.44e-04 |
| 3. B | Q9USX8 | U2 small nuclear ribonucleoprotein A' | 1.46e-10 | NA | 2.90e-05 |
| 3. B | Q7ZY40 | Acidic leucine-rich nuclear phosphoprotein 32 family member E | 2.13e-08 | NA | 0.038 |
| 3. B | Q9D5E4 | Dynein regulatory complex subunit 3 | 2.38e-05 | NA | 1.05e-08 |
| 3. B | Q6AYH9 | Dynein axonemal assembly factor 1 | 1.21e-05 | NA | 0.001 |
| 3. B | Q7ZV84 | Dynein axonemal assembly factor 1 | 6.94e-05 | NA | 0.002 |
| 3. B | Q4R8Y8 | U2 small nuclear ribonucleoprotein A' | 4.36e-11 | NA | 6.91e-04 |
| 3. B | Q9D2H9 | Dynein axonemal assembly factor 1 | 2.04e-06 | NA | 8.27e-04 |
| 3. B | Q9H069 | Dynein regulatory complex subunit 3 | 1.89e-05 | NA | 1.91e-05 |
| 3. B | Q8C6G1 | Cilia- and flagella-associated protein 410 | 2.72e-09 | NA | 4.04e-04 |
| 3. B | P34390 | Uncharacterized protein F09G8.5 | 4.13e-05 | NA | 2.33e-05 |
| 3. B | Q8INT5 | Dynein axonemal assembly factor 1 homolog | 8.86e-03 | NA | 0.038 |
| 3. B | Q96M69 | Leucine-rich repeat and guanylate kinase domain-containing protein | 2.04e-05 | NA | 0.002 |
| 3. B | B4P6W7 | Dynein axonemal assembly factor 1 homolog | 1.05e-02 | NA | 0.040 |
| 3. B | Q4R3F0 | Protein tilB homolog | 2.50e-07 | NA | 0.001 |
| 3. B | Q8IUZ0 | Leucine-rich repeat-containing protein 49 | 1.28e-05 | NA | 3.28e-04 |
| 3. B | Q9D5S7 | Leucine-rich repeat and guanylate kinase domain-containing protein | 2.12e-05 | NA | 0.011 |
| 3. B | B6D5P3 | Dynein axonemal assembly factor 1 | 1.14e-05 | NA | 0.009 |
| 3. B | Q8NEP3 | Dynein axonemal assembly factor 1 | 4.01e-04 | NA | 0.001 |
| 3. B | A6PVS8 | Leucine-rich repeat and IQ domain-containing protein 3 | 5.74e-04 | NA | 0.009 |