Summary

Q96F63

Homolog: Q9DBT3.
Function: Coiled-coil domain-containing protein 97.

Statistics

Total GO Annotation: 59
Unique PROST Go: 59
Unique BLAST Go: 0

Total Homologs: 28
Unique PROST Homologs: 26
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q9DBT3 (Coiled-coil domain-containing protein 97) with a FATCAT P-Value: 0.0 and RMSD of 1.64 angstrom. The sequence alignment identity is 82.5%.
Structural alignment shown in left. Query protein Q96F63 colored as red in alignment, homolog Q9DBT3 colored as blue. Query protein Q96F63 is also shown in right top, homolog Q9DBT3 showed in right bottom. They are colored based on secondary structures. 

  Q96F63 MEAVATA--TAAKEPDK-GCIEPGPGHWGELSRTPVPSKPQDKVEAAEATPVALDSDTSG---AENAAVSAMLHAVAASRLPVCSQQQGEPDLTEHEKVA 94
  Q9DBT3 MEAVAAAEVTERK-PDNDG-VEPRVVHWGELSQTPIPSGPQEK-ETAERTP---DIPNSGSSQAESPAVSAMLHAIAASHLPVCSQQQGEPDLTEPEKVA 94

  Q96F63 ILAQLYHEKPLVFLERFRTGLREEHLACFGHVRGDHRADFYCAEVARQGTARPRTLRTRLRNRRYAALRELIQGGEYFSDEQMRFRAPLLYEQYIGQYLT 194
  Q9DBT3 ILGQLYHKKPLVFLERFRTGLREEHLACFGHLRGDHRADFYCAEVARQGTARPRTLRTRLRNRRYAALRELIQGGEYFSDEQMRFRAPLLYEQYIGQYLT 194

  Q96F63 QEELSARTPTHQPPKPGSPGRPACPLSNLLLQSYEERELQQRLLQQQEEEEACLEEEEEEEDSDEEDQRSGKDSEAWVPDSEERLILREEFTSRMHQRFL 294
  Q9DBT3 QEELNARTAAPQAPRSGSPGTPAYPLSDLLFQSYQERELQQKLLQQQEEEEACF---EEEEDSDEEDQRSDKDSEAWVPDSEERLILREEFTSRMHQRFL 291

  Q96F63 DGKDGDFDYSTVDDNPDFDNLDIVARDEEERYFDEEEPEDAPSPELDGD 343
  Q9DBT3 DGKDGGFDYSTVDDNPDFDNLDIVARDEEDRYFDEEEPEDVSSAELGGD 340

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0042797 tRNA transcription by RNA polymerase III
2. P GO:0036120 cellular response to platelet-derived growth factor stimulus
2. P GO:0045132 meiotic chromosome segregation
2. P GO:0006342
2. P GO:0003682 chromatin binding
2. P GO:1990314 cellular response to insulin-like growth factor stimulus
2. P GO:0045600 positive regulation of fat cell differentiation
2. P GO:0031298 replication fork protection complex
2. P GO:0006383 transcription by RNA polymerase III
2. P GO:0006359 regulation of transcription by RNA polymerase III
2. P GO:0008283 cell population proliferation
2. P GO:0000470 maturation of LSU-rRNA
2. P GO:0006281 DNA repair
2. P GO:0006384 transcription initiation from RNA polymerase III promoter
2. P GO:0005666 RNA polymerase III complex
2. P GO:0009880 embryonic pattern specification
2. P GO:0000076 DNA replication checkpoint signaling
2. P GO:0000373 Group II intron splicing
2. P GO:0030424 axon
2. P GO:0035329 hippo signaling
2. P GO:0048478 replication fork protection
2. P GO:0043111 replication fork arrest
2. P GO:0030317 flagellated sperm motility
2. P GO:0045089 positive regulation of innate immune response
2. P GO:0032728 positive regulation of interferon-beta production
2. P GO:0070847 core mediator complex
2. P GO:0051321 meiotic cell cycle
2. P GO:0030426 growth cone
2. P GO:0030425 dendrite
2. P GO:0015031 protein transport
2. P GO:0038203 TORC2 signaling
2. P GO:0051123 RNA polymerase II preinitiation complex assembly
2. P GO:0003899 DNA-directed 5'-3' RNA polymerase activity
2. P GO:0005634 nucleus
2. P GO:0006975 DNA damage induced protein phosphorylation
2. P GO:0006306 DNA methylation
2. P GO:0000460 maturation of 5.8S rRNA
2. P GO:0007064 mitotic sister chromatid cohesion
2. P GO:0032502 developmental process
2. P GO:0031234 extrinsic component of cytoplasmic side of plasma membrane
2. P GO:0009791 post-embryonic development
2. P GO:0043570 maintenance of DNA repeat elements
2. P GO:0034087 establishment of mitotic sister chromatid cohesion
2. P GO:0032869 cellular response to insulin stimulus
2. P GO:0061053 somite development
2. P GO:0016604 nuclear body
2. P GO:0071902 positive regulation of protein serine/threonine kinase activity
2. P GO:0042734 presynaptic membrane
2. P GO:0043204 perikaryon
2. P GO:0071364 cellular response to epidermal growth factor stimulus
2. P GO:0060037 pharyngeal system development
2. P GO:0045211 postsynaptic membrane
2. P GO:0071480 cellular response to gamma radiation
2. P GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding
2. P GO:0021552 midbrain-hindbrain boundary structural organization
2. P GO:0051607 defense response to virus
2. P GO:0005669 transcription factor TFIID complex
2. P GO:0002244 hematopoietic progenitor cell differentiation
2. P GO:0005654 nucleoplasm

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q9DBT3 Coiled-coil domain-containing protein 97 0.00e+00 6.21e-72 1.45e-166
1. PB Q96F63 Coiled-coil domain-containing protein 97 0 4.11e-142 0.0
2. P Q59X26 Chromosome segregation in meiosis protein 3 2.39e-01 3.33e-02 NA
2. P Q6FLB8 Mediator of RNA polymerase II transcription subunit 4 2.06e-02 3.28e-04 NA
2. P Q8R0C0 DNA-directed RNA polymerase III subunit RPC7-like 1.66e-01 3.04e-03 NA
2. P Q84N48 CRS2-associated factor 2, chloroplastic 7.00e-01 2.73e-02 NA
2. P Q1JQE2 Probable RNA polymerase II nuclear localization protein SLC7A6OS 8.28e-01 3.30e-02 NA
2. P P46936 Transcriptional coactivator YAP1 4.18e-01 2.67e-02 NA
2. P O15318 DNA-directed RNA polymerase III subunit RPC7 6.07e-01 1.39e-03 NA
2. P A1C8Y9 Chromosome segregation in meiosis protein 3 4.08e-01 5.81e-03 NA
2. P P17890 DNA-directed RNA polymerase III subunit RPC7 4.39e-01 4.35e-05 NA
2. P Q04659 Chromosome segregation in meiosis protein 3 5.12e-02 4.95e-03 NA
2. P Q9D3R9 Transcription initiation factor TFIID subunit 7-like 1.47e-01 5.10e-03 NA
2. P O13951 RNA polymerase II nuclear localization protein iwr1 4.78e-01 4.18e-02 NA
2. P Q9D5V6 Synapse-associated protein 1 6.03e-03 1.41e-02 NA
2. P Q9VFE6 RRP15-like protein 1.08e-01 1.72e-02 NA
2. P Q9BT43 DNA-directed RNA polymerase III subunit RPC7-like 5.01e-01 2.00e-03 NA
2. P Q75DC6 Chromosome segregation in meiosis protein 3 3.99e-02 2.38e-02 NA
2. P Q8GYP3 RNA-directed DNA methylation 4 3.62e-01 4.94e-06 NA
2. P A5DDH8 Chromosome segregation in meiosis protein 3 1.12e-01 6.32e-05 NA
2. P Q6NXY9 DNA-directed RNA polymerase III subunit RPC7 4.43e-01 1.22e-04 NA
2. P Q8WZJ8 DNA-directed RNA polymerase III subunit rpc31 5.78e-01 8.13e-06 NA
2. P Q5U3I2 Probable RNA polymerase II nuclear localization protein SLC7A6OS 9.26e-01 6.04e-04 NA
2. P Q28GL6 Probable RNA polymerase II nuclear localization protein SLC7A6OS 6.29e-01 1.70e-02 NA
2. P Q96A49 Synapse-associated protein 1 5.80e-03 4.06e-02 NA
2. P Q924S9 Protein ripply3 8.97e-01 2.97e-02 NA
2. P Q296J6 RRP15-like protein 1.19e-01 4.46e-02 NA
2. P Q1RMR0 DNA-directed RNA polymerase III subunit RPC7-like 3.97e-01 4.40e-05 NA