Results | PROST

Summary

Q96FK6

Homolog: P23232.
Function: Guanine nucleotide-binding protein subunit beta.

Statistics

Total GO Annotation: 518
Unique PROST Go: 304
Unique BLAST Go: 147

Total Homologs: 767
Unique PROST Homologs: 571
Unique BLAST Homologs: 154

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was P23232 (Guanine nucleotide-binding protein subunit beta) with a FATCAT P-Value: 0.0 and RMSD of 2.80 angstrom. The sequence alignment identity is 22.7%.
Structural alignment shown in left. Query protein Q96FK6 colored as red in alignment, homolog P23232 colored as blue. Query protein Q96FK6 is also shown in right top, homolog P23232 showed in right bottom. They are colored based on secondary structures.

  Q96FK6 ----MEKIE---EQFAN-LH-IVKC----SL--GTK--EPTYLLG-ID--TSKTVQAG---K----------ENLVAVLCSN-GSIRIYDKERLN-V--- 62
  P23232 MTSELEALRQETEQLKNQIREARKAAADTTLAMATANVEP---VGRIQMRTRRTLR-GHLAKIYAMHWASDSRNLVS--ASQDGKLIVWDGYTTNKVHAI 94

  Q96FK6 -LRE---FS-GY-P-GLLN-----GVRFANSCDSVYSACT-DGTVKCWDARVAREKPVQLFKGYPSNIFISFDINCNDHIICAGTEKVDDDALLV-FWDA 148
  P23232 PLRSSWVMTCAYAPSG--NYVACGGL--DNIC-SIYSLKTREGNV-----RVSRELPGH--TGY---------LSC-----C---RFIDDNQIVTSSGD- 164

  Q96FK6 RMNSQ--NLST----TKDSLGAYSETHSDDVTQVRFHPSNPNM--VVSGSSDGLVNVFDINIDNEEDALVTTC-NSISSVSCIGWSGKGY-KQIYCMTH- 237
  P23232 -MTCALWNIETGNQIT--SFGG----HTGDVMSLSLA---PDMRTFVSGACDASAKLFDI-----RDGI---CKQTFT----------GHESDINAITYF 236

  Q96FK6 DEGFYWWDLNHLDTDEPVTRLNIQDVREVVNMKEDALDYLIGGLY-HEKTDTLHVIGGT----NK-GRIHL-----MNCSM--------SGLTHVTSLQG 318
  P23232 PNGFAF----ATGSDDATCRL--FDIRA---------DQEI-GMYSH---DNI-ICGITSVAFSKSGRLLLGGYDDFNCNVWDVLKQERAGV-----L-A 310

  Q96FK6 GHAATVRSFCWNVQDD--SLLTGGEDAQLLLWKPGAIEKTFTKKESMKIASSVHQRVRVHSNDSYKRRKKQ 387
  P23232 GHDNRVS--CLGVTEDGMAVATGSWDSFLKIWN-------------------------------------- 341

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
1. PB	GO:0005765	lysosomal membrane
1. PB	GO:0051301	cell division
1. PB	GO:0051020	GTPase binding
1. PB	GO:0005847	mRNA cleavage and polyadenylation specificity factor complex
1. PB	GO:0000122	negative regulation of transcription by RNA polymerase II
1. PB	GO:0032040	small-subunit processome
1. PB	GO:0097361	CIA complex
1. PB	GO:0005654	nucleoplasm
1. PB	GO:0030127	COPII vesicle coat
1. PB	GO:0046662	regulation of oviposition
1. PB	GO:0030308	negative regulation of cell growth
1. PB	GO:0042800	histone methyltransferase activity (H3-K4 specific)
1. PB	GO:0006378	mRNA polyadenylation
1. PB	GO:0005053	peroxisome matrix targeting signal-2 binding
1. PB	GO:0030331	estrogen receptor binding
1. PB	GO:0006325	chromatin organization
1. PB	GO:0090696	post-embryonic plant organ development
1. PB	GO:0010026	trichome differentiation
1. PB	GO:0033186	CAF-1 complex
1. PB	GO:0042393	histone binding
1. PB	GO:0001650	fibrillar center
1. PB	GO:0051568	histone H3-K4 methylation
1. PB	GO:0016581	NuRD complex
1. PB	GO:0061700	GATOR2 complex
1. PB	GO:0008380	RNA splicing
1. PB	GO:0035861	site of double-strand break
1. PB	GO:0016567	protein ubiquitination
1. PB	GO:0005198	structural molecule activity
1. PB	GO:0005834	heterotrimeric G-protein complex
1. PB	GO:1903775	regulation of DNA double-strand break processing
1. PB	GO:0005886	plasma membrane
1. PB	GO:0032008	positive regulation of TOR signaling
1. PB	GO:0048545	response to steroid hormone
1. PB	GO:0044666	MLL3/4 complex
1. PB	GO:0032991	protein-containing complex
1. PB	GO:0010506	regulation of autophagy
1. PB	GO:0070370	cellular heat acclimation
1. PB	GO:0040013	negative regulation of locomotion
1. PB	GO:0015031	protein transport
1. PB	GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
1. PB	GO:0007186	G protein-coupled receptor signaling pathway
1. PB	GO:0035098	ESC/E(Z) complex
1. PB	GO:0000375	RNA splicing, via transesterification reactions
1. PB	GO:0005634	nucleus
1. PB	GO:0005829	cytosol
1. PB	GO:0006914	autophagy
1. PB	GO:0006364	rRNA processing
1. PB	GO:0000123	histone acetyltransferase complex
1. PB	GO:0031682	G-protein gamma-subunit binding
1. PB	GO:2001173	regulation of histone H2B conserved C-terminal lysine ubiquitination
1. PB	GO:0034198	cellular response to amino acid starvation
1. PB	GO:0080008	Cul4-RING E3 ubiquitin ligase complex
1. PB	GO:0000118	histone deacetylase complex
1. PB	GO:0090594	inflammatory response to wounding
1. PB	GO:0048188	Set1C/COMPASS complex
1. PB	GO:0044297	cell body
1. PB	GO:0090110	COPII-coated vesicle cargo loading
1. PB	GO:0000776	kinetochore
1. PB	GO:0090114	COPII-coated vesicle budding
1. PB	GO:0005730	nucleolus
1. PB	GO:2000653	regulation of genetic imprinting
1. PB	GO:0072344	rescue of stalled ribosome
1. PB	GO:0031464	Cul4A-RING E3 ubiquitin ligase complex
1. PB	GO:0080135	regulation of cellular response to stress
1. PB	GO:0035097	histone methyltransferase complex
1. PB	GO:0007059	chromosome segregation
1. PB	GO:0031080	nuclear pore outer ring
2. P	GO:0006336	DNA replication-independent chromatin assembly
2. P	GO:0031932	TORC2 complex
2. P	GO:0043029	T cell homeostasis
2. P	GO:1990147	talin binding
2. P	GO:0007094	mitotic spindle assembly checkpoint signaling
2. P	GO:0043614	multi-eIF complex
2. P	GO:0000422	autophagy of mitochondrion
2. P	GO:0031497	chromatin assembly
2. P	GO:1902610	response to N-phenylthiourea
2. P	GO:0048156	tau protein binding
2. P	GO:0009524	phragmoplast
2. P	GO:0006338	chromatin remodeling
2. P	GO:0006379	mRNA cleavage
2. P	GO:0008327	methyl-CpG binding
2. P	GO:0071353	cellular response to interleukin-4
2. P	GO:0032045	guanyl-nucleotide exchange factor complex
2. P	GO:0003743	translation initiation factor activity
2. P	GO:1905861	intranuclear rod assembly
2. P	GO:0000159	protein phosphatase type 2A complex
2. P	GO:0032796	uropod organization
2. P	GO:0010812	negative regulation of cell-substrate adhesion
2. P	GO:0051321	meiotic cell cycle
2. P	GO:0044877	protein-containing complex binding
2. P	GO:0010969	regulation of pheromone-dependent signal transduction involved in conjugation with cellular fusion
2. P	GO:0033698	Rpd3L complex
2. P	GO:0009855	determination of bilateral symmetry
2. P	GO:0000972	transcription-dependent tethering of RNA polymerase II gene DNA at nuclear periphery
2. P	GO:0120293	dynein axonemal particle
2. P	GO:1903463	regulation of mitotic cell cycle DNA replication
2. P	GO:0001673	male germ cell nucleus
2. P	GO:0097431	mitotic spindle pole
2. P	GO:0032956	regulation of actin cytoskeleton organization
2. P	GO:0045504	dynein heavy chain binding
2. P	GO:0001674	female germ cell nucleus
2. P	GO:0006413	translational initiation
2. P	GO:0005677	chromatin silencing complex
2. P	GO:0000012	single strand break repair
2. P	GO:0022618	ribonucleoprotein complex assembly
2. P	GO:0006283	transcription-coupled nucleotide-excision repair
2. P	GO:0006342
2. P	GO:0006397	mRNA processing
2. P	GO:0071540	eukaryotic translation initiation factor 3 complex, eIF3e
2. P	GO:0016571	histone methylation
2. P	GO:0006335	DNA replication-dependent chromatin assembly
2. P	GO:0005782	peroxisomal matrix
2. P	GO:0030036	actin cytoskeleton organization
2. P	GO:0016282	eukaryotic 43S preinitiation complex
2. P	GO:0090148	membrane fission
2. P	GO:0007283	spermatogenesis
2. P	GO:0042826	histone deacetylase binding
2. P	GO:0000109	nucleotide-excision repair complex
2. P	GO:0097428	protein maturation by iron-sulfur cluster transfer
2. P	GO:0061586	positive regulation of transcription by transcription factor localization
2. P	GO:0040035	hermaphrodite genitalia development
2. P	GO:0019898	extrinsic component of membrane
2. P	GO:0061739	protein lipidation involved in autophagosome assembly
2. P	GO:0009792	embryo development ending in birth or egg hatching
2. P	GO:0000407	phagophore assembly site
2. P	GO:0031931	TORC1 complex
2. P	GO:1904263	positive regulation of TORC1 signaling
2. P	GO:0061802	anterior cell cortex
2. P	GO:0006348
2. P	GO:0030864	cortical actin cytoskeleton
2. P	GO:0048477	oogenesis
2. P	GO:0051895	negative regulation of focal adhesion assembly
2. P	GO:0045138	nematode male tail tip morphogenesis
2. P	GO:0051169	nuclear transport
2. P	GO:0010314	phosphatidylinositol-5-phosphate binding
2. P	GO:1990298	bub1-bub3 complex
2. P	GO:0016589	NURF complex
2. P	GO:0036126	sperm flagellum
2. P	GO:2000280	regulation of root development
2. P	GO:0007015	actin filament organization
2. P	GO:0044665	MLL1/2 complex
2. P	GO:0098789	pre-mRNA cleavage required for polyadenylation
2. P	GO:0008608	attachment of spindle microtubules to kinetochore
2. P	GO:0032426	stereocilium tip
2. P	GO:0004402	histone acetyltransferase activity
2. P	GO:0050870	positive regulation of T cell activation
2. P	GO:0061803	posterior cell cortex
2. P	GO:0036284	tubulobulbar complex
2. P	GO:0010632	regulation of epithelial cell migration
2. P	GO:0043521	regulation of myosin II filament disassembly
2. P	GO:0036158	outer dynein arm assembly
2. P	GO:0043130	ubiquitin binding
2. P	GO:0072357	PTW/PP1 phosphatase complex
2. P	GO:0010154	fruit development
2. P	GO:0032036	myosin heavy chain binding
2. P	GO:0031589	cell-substrate adhesion
2. P	GO:0000209	protein polyubiquitination
2. P	GO:0042273	ribosomal large subunit biogenesis
2. P	GO:1900024	regulation of substrate adhesion-dependent cell spreading
2. P	GO:1904811	positive regulation of dense core granule transport
2. P	GO:0009968	negative regulation of signal transduction
2. P	GO:0048527	lateral root development
2. P	GO:0019888	protein phosphatase regulator activity
2. P	GO:0048383	mesectoderm development
2. P	GO:0001891	phagocytic cup
2. P	GO:0045014	carbon catabolite repression of transcription by glucose
2. P	GO:1901981	phosphatidylinositol phosphate binding
2. P	GO:0070912	Ddb1-Ckn1 complex
2. P	GO:1905301	regulation of macropinocytosis
2. P	GO:0140499	negative regulation of mitotic spindle assembly checkpoint signaling
2. P	GO:0031101	fin regeneration
2. P	GO:0051015	actin filament binding
2. P	GO:0046784	viral mRNA export from host cell nucleus
2. P	GO:0003682	chromatin binding
2. P	GO:0009960	endosperm development
2. P	GO:0048203	vesicle targeting, trans-Golgi to endosome
2. P	GO:2000394	positive regulation of lamellipodium morphogenesis
2. P	GO:1900091	regulation of raffinose biosynthetic process
2. P	GO:0003785	actin monomer binding
2. P	GO:0097750	endosome membrane tubulation
2. P	GO:0034719	SMN-Sm protein complex
2. P	GO:0042102	positive regulation of T cell proliferation
2. P	GO:0060528	secretory columnal luminar epithelial cell differentiation involved in prostate glandular acinus development
2. P	GO:0036265	RNA (guanine-N7)-methylation
2. P	GO:0034497	protein localization to phagophore assembly site
2. P	GO:0106004	tRNA (guanine-N7)-methylation
2. P	GO:0005776	autophagosome
2. P	GO:0098792	xenophagy
2. P	GO:0005840	ribosome
2. P	GO:1990567	DPS complex
2. P	GO:0045495	pole plasm
2. P	GO:0010118	stomatal movement
2. P	GO:0010633	negative regulation of epithelial cell migration
2. P	GO:0006606	protein import into nucleus
2. P	GO:0032797	SMN complex
2. P	GO:0001845	phagolysosome assembly
2. P	GO:0032221	Rpd3S/Clr6-CII complex
2. P	GO:0016050	vesicle organization
2. P	GO:0017166	vinculin binding
2. P	GO:0010674	negative regulation of transcription from RNA polymerase II promoter involved in meiotic cell cycle
2. P	GO:0017183	peptidyl-diphthamide biosynthetic process from peptidyl-histidine
2. P	GO:0071407	cellular response to organic cyclic compound
2. P	GO:0070176	DRM complex
2. P	GO:0032266	phosphatidylinositol-3-phosphate binding
2. P	GO:0007315	pole plasm assembly
2. P	GO:0005635	nuclear envelope
2. P	GO:1990942	mitotic metaphase chromosome recapture
2. P	GO:0005858	axonemal dynein complex
2. P	GO:0031152	aggregation involved in sorocarp development
2. P	GO:2000728	regulation of mRNA export from nucleus in response to heat stress
2. P	GO:0034314	Arp2/3 complex-mediated actin nucleation
2. P	GO:0032258	cytoplasm to vacuole transport by the Cvt pathway
2. P	GO:0005768	endosome
2. P	GO:0006098	pentose-phosphate shunt
2. P	GO:0048873	homeostasis of number of cells within a tissue
2. P	GO:0051028	mRNA transport
2. P	GO:0030374	nuclear receptor coactivator activity
2. P	GO:0010214	seed coat development
2. P	GO:0003380	establishment or maintenance of cytoskeleton polarity involved in gastrulation
2. P	GO:0007080	mitotic metaphase plate congression
2. P	GO:0000346	transcription export complex
2. P	GO:0036195	muscle cell projection membrane
2. P	GO:0045503	dynein light chain binding
2. P	GO:0005643	nuclear pore
2. P	GO:1990893	mitotic chromosome centromere condensation
2. P	GO:0010008	endosome membrane
2. P	GO:0038202	TORC1 signaling
2. P	GO:0140285	endosome fission
2. P	GO:0006406	mRNA export from nucleus
2. P	GO:0070734	histone H3-K27 methylation
2. P	GO:0003093	regulation of glomerular filtration
2. P	GO:0033290	eukaryotic 48S preinitiation complex
2. P	GO:0017057	6-phosphogluconolactonase activity
2. P	GO:0001825	blastocyst formation
2. P	GO:0061502	early endosome to recycling endosome transport
2. P	GO:0008430	selenium binding
2. P	GO:1902440	protein localization to mitotic spindle pole body
2. P	GO:0030687	preribosome, large subunit precursor
2. P	GO:0038203	TORC2 signaling
2. P	GO:0009991	response to extracellular stimulus
2. P	GO:1900027	regulation of ruffle assembly
2. P	GO:0000329	fungal-type vacuole membrane
2. P	GO:0016070	RNA metabolic process
2. P	GO:0032781	positive regulation of ATP-dependent activity
2. P	GO:0034709	methylosome
2. P	GO:0072593	reactive oxygen species metabolic process
2. P	GO:0043278	response to morphine
2. P	GO:0030838	positive regulation of actin filament polymerization
2. P	GO:0034399	nuclear periphery
2. P	GO:0005246	calcium channel regulator activity
2. P	GO:0140627	ubiquitin-dependent protein catabolic process via the C-end degron rule pathway
2. P	GO:0000176	nuclear exosome (RNase complex)
2. P	GO:0016558	protein import into peroxisome matrix
2. P	GO:0016226	iron-sulfur cluster assembly
2. P	GO:0051893	regulation of focal adhesion assembly
2. P	GO:0009867	jasmonic acid mediated signaling pathway
2. P	GO:0005737	cytoplasm
2. P	GO:0005774	vacuolar membrane
2. P	GO:0005884	actin filament
2. P	GO:0051315	attachment of mitotic spindle microtubules to kinetochore
2. P	GO:0070273	phosphatidylinositol-4-phosphate binding
2. P	GO:0030595	leukocyte chemotaxis
2. P	GO:0035859	Seh1-associated complex
2. P	GO:0000387	spliceosomal snRNP assembly
2. P	GO:0080025	phosphatidylinositol-3,5-bisphosphate binding
2. P	GO:0006405	RNA export from nucleus
2. P	GO:0043320	natural killer cell degranulation
2. P	GO:0030277	maintenance of gastrointestinal epithelium
2. P	GO:0006333	chromatin assembly or disassembly
2. P	GO:0036157	outer dynein arm
2. P	GO:0003341	cilium movement
2. P	GO:1990810	microtubule anchoring at mitotic spindle pole body
2. P	GO:0001403	invasive growth in response to glucose limitation
2. P	GO:0043078	polar nucleus
2. P	GO:0043527	tRNA methyltransferase complex
2. P	GO:0033597	mitotic checkpoint complex
2. P	GO:0001732	formation of cytoplasmic translation initiation complex
2. P	GO:1905392	plant organ morphogenesis
2. P	GO:0060770	negative regulation of epithelial cell proliferation involved in prostate gland development
2. P	GO:0030488	tRNA methylation
2. P	GO:1900088	regulation of inositol biosynthetic process
2. P	GO:0051664	nuclear pore localization
2. P	GO:0031939	obsolete negative regulation of chromatin silencing at telomere
2. P	GO:0062078	TSC1-TSC2 complex binding
2. P	GO:0048794	swim bladder development
2. P	GO:0009845	seed germination
2. P	GO:0005856	cytoskeleton
2. P	GO:0000380	alternative mRNA splicing, via spliceosome
2. P	GO:0031339	negative regulation of vesicle fusion
2. P	GO:0002183	cytoplasmic translational initiation
2. P	GO:0060236	regulation of mitotic spindle organization
2. P	GO:0061365	positive regulation of triglyceride lipase activity
2. P	GO:0006999	nuclear pore organization
2. P	GO:0097729	9+2 motile cilium
2. P	GO:1904594	regulation of termination of RNA polymerase II transcription
2. P	GO:0070262	peptidyl-serine dephosphorylation
2. P	GO:0051983	regulation of chromosome segregation
2. P	GO:0050918	positive chemotaxis
2. P	GO:1903341	regulation of meiotic DNA double-strand break formation
2. P	GO:0034501	protein localization to kinetochore
2. P	GO:0015629	actin cytoskeleton
2. P	GO:0030670	phagocytic vesicle membrane
2. P	GO:0071541	eukaryotic translation initiation factor 3 complex, eIF3m
2. P	GO:0070286	axonemal dynein complex assembly
2. P	GO:0032527	protein exit from endoplasmic reticulum
2. P	GO:0051865	protein autoubiquitination
2. P	GO:0051721	protein phosphatase 2A binding
2. P	GO:0010762	regulation of fibroblast migration
2. P	GO:1990811	MWP complex
2. P	GO:0048920	posterior lateral line neuromast primordium migration
2. P	GO:0030027	lamellipodium
2. P	GO:0043539	protein serine/threonine kinase activator activity
2. P	GO:0009267	cellular response to starvation
2. P	GO:0034727	piecemeal microautophagy of the nucleus
2. P	GO:0034514	mitochondrial unfolded protein response
2. P	GO:0031507	heterochromatin assembly
2. P	GO:1990447	U2 snRNP binding
2. P	GO:0051126	negative regulation of actin nucleation
2. P	GO:0000147	actin cortical patch assembly
2. P	GO:0006497	protein lipidation
2. P	GO:1900025	negative regulation of substrate adhesion-dependent cell spreading
2. P	GO:0008092	cytoskeletal protein binding
2. P	GO:0016600	flotillin complex
2. P	GO:0060465	pharynx development
2. P	GO:0000445	THO complex part of transcription export complex
2. P	GO:0000045	autophagosome assembly
2. P	GO:1990756	ubiquitin ligase-substrate adaptor activity
2. P	GO:0001772	immunological synapse
2. P	GO:0070210	Rpd3L-Expanded complex
2. P	GO:0043548	phosphatidylinositol 3-kinase binding
2. P	GO:0000070	mitotic sister chromatid segregation
2. P	GO:1903138	negative regulation of cell wall integrity MAPK cascade
2. P	GO:0006909	phagocytosis
2. P	GO:0030182	neuron differentiation
2. P	GO:0000920	septum digestion after cytokinesis
2. P	GO:0000347	THO complex
2. P	GO:0034045	phagophore assembly site membrane
2. P	GO:0005852	eukaryotic translation initiation factor 3 complex
2. P	GO:0010973	positive regulation of division septum assembly
2. P	GO:0010458	exit from mitosis
2. P	GO:0106143	tRNA (m7G46) methyltransferase complex
2. P	GO:0097680	double-strand break repair via classical nonhomologous end joining
2. P	GO:0043087	regulation of GTPase activity
2. P	GO:0009411	response to UV
2. P	GO:1905281	positive regulation of retrograde transport, endosome to Golgi
2. P	GO:0009723	response to ethylene
2. P	GO:0038180	nerve growth factor signaling pathway
2. P	GO:0080182	histone H3-K4 trimethylation
2. P	GO:0045739	positive regulation of DNA repair
2. P	GO:0000781	chromosome, telomeric region
2. P	GO:0031929	TOR signaling
2. P	GO:0030968	endoplasmic reticulum unfolded protein response
2. P	GO:0034629
2. P	GO:1904951	positive regulation of establishment of protein localization
2. P	GO:0046872	metal ion binding
2. P	GO:0061685	diphthine methylesterase activity
2. P	GO:0044387	negative regulation of protein kinase activity by regulation of protein phosphorylation
2. P	GO:0010224	response to UV-B
2. P	GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway
2. P	GO:0005885	Arp2/3 protein complex
2. P	GO:0043666	regulation of phosphoprotein phosphatase activity
2. P	GO:0006349	regulation of gene expression by genomic imprinting
2. P	GO:0045335	phagocytic vesicle
2. P	GO:0043653	mitochondrial fragmentation involved in apoptotic process
2. P	GO:1904950	negative regulation of establishment of protein localization
2. P	GO:0008064	regulation of actin polymerization or depolymerization
2. P	GO:1901796	regulation of signal transduction by p53 class mediator
2. P	GO:0002188	translation reinitiation
2. P	GO:0051279	regulation of release of sequestered calcium ion into cytosol
2. P	GO:0044804	autophagy of nucleus
2. P	GO:0010231	maintenance of seed dormancy
3. B	GO:2001125	negative regulation of translational frameshifting
3. B	GO:1902510	regulation of apoptotic DNA fragmentation
3. B	GO:0010449	root meristem growth
3. B	GO:0035266	meristem growth
3. B	GO:0034450	ubiquitin-ubiquitin ligase activity
3. B	GO:0000244	spliceosomal tri-snRNP complex assembly
3. B	GO:0008610	lipid biosynthetic process
3. B	GO:0005874	microtubule
3. B	GO:0032794	GTPase activating protein binding
3. B	GO:0000245	spliceosomal complex assembly
3. B	GO:0008283	cell population proliferation
3. B	GO:0005080	protein kinase C binding
3. B	GO:0001666	response to hypoxia
3. B	GO:0010942	positive regulation of cell death
3. B	GO:0006884	cell volume homeostasis
3. B	GO:0000132	establishment of mitotic spindle orientation
3. B	GO:0051510	regulation of unidimensional cell growth
3. B	GO:0043966	histone H3 acetylation
3. B	GO:0051013	microtubule severing
3. B	GO:0007029	endoplasmic reticulum organization
3. B	GO:0000447	endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
3. B	GO:1901386	negative regulation of voltage-gated calcium channel activity
3. B	GO:0036269	swimming behavior
3. B	GO:0000389	mRNA 3'-splice site recognition
3. B	GO:0048359	mucilage metabolic process involved in seed coat development
3. B	GO:0031117	positive regulation of microtubule depolymerization
3. B	GO:0010272	response to silver ion
3. B	GO:0010212	response to ionizing radiation
3. B	GO:2000234	positive regulation of rRNA processing
3. B	GO:0010498	proteasomal protein catabolic process
3. B	GO:0008017	microtubule binding
3. B	GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport
3. B	GO:0004842	ubiquitin-protein transferase activity
3. B	GO:0001826	inner cell mass cell differentiation
3. B	GO:0055082	cellular chemical homeostasis
3. B	GO:0000480	endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
3. B	GO:0046283	anthocyanin-containing compound metabolic process
3. B	GO:0030914
3. B	GO:0000152	nuclear ubiquitin ligase complex
3. B	GO:0045722	positive regulation of gluconeogenesis
3. B	GO:0005669	transcription factor TFIID complex
3. B	GO:0033276	transcription factor TFTC complex
3. B	GO:0010968	regulation of microtubule nucleation
3. B	GO:0007019	microtubule depolymerization
3. B	GO:0001895	retina homeostasis
3. B	GO:0110136	protein-RNA complex remodeling
3. B	GO:1904672	regulation of somatic stem cell population maintenance
3. B	GO:0070534	protein K63-linked ubiquitination
3. B	GO:0061630	ubiquitin protein ligase activity
3. B	GO:0005524	ATP binding
3. B	GO:0043981	histone H4-K5 acetylation
3. B	GO:0007634	optokinetic behavior
3. B	GO:0071217	cellular response to external biotic stimulus
3. B	GO:0000922	spindle pole
3. B	GO:1901000	regulation of response to salt stress
3. B	GO:0010073	meristem maintenance
3. B	GO:0098793	presynapse
3. B	GO:0001501	skeletal system development
3. B	GO:0009647	skotomorphogenesis
3. B	GO:0070840	dynein complex binding
3. B	GO:0007212	dopamine receptor signaling pathway
3. B	GO:0000348	mRNA branch site recognition
3. B	GO:0031139	positive regulation of conjugation with cellular fusion
3. B	GO:0030030	cell projection organization
3. B	GO:0036464	cytoplasmic ribonucleoprotein granule
3. B	GO:2001268	negative regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway
3. B	GO:0071013	catalytic step 2 spliceosome
3. B	GO:0060590	ATPase regulator activity
3. B	GO:1902660	negative regulation of glucose mediated signaling pathway
3. B	GO:0090181	regulation of cholesterol metabolic process
3. B	GO:0051571	positive regulation of histone H3-K4 methylation
3. B	GO:0008635	activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c
3. B	GO:0071006	U2-type catalytic step 1 spliceosome
3. B	GO:0005671	obsolete Ada2/Gcn5/Ada3 transcription activator complex
3. B	GO:1902183	regulation of shoot apical meristem development
3. B	GO:0048026	positive regulation of mRNA splicing, via spliceosome
3. B	GO:1902773	GTPase activator complex
3. B	GO:0043984	histone H4-K16 acetylation
3. B	GO:0043547	positive regulation of GTPase activity
3. B	GO:0045666	positive regulation of neuron differentiation
3. B	GO:0045717	negative regulation of fatty acid biosynthetic process
3. B	GO:0051087	chaperone binding
3. B	GO:0006367	transcription initiation from RNA polymerase II promoter
3. B	GO:0006886	intracellular protein transport
3. B	GO:0048711	positive regulation of astrocyte differentiation
3. B	GO:0000349	generation of catalytic spliceosome for first transesterification step
3. B	GO:0005819	spindle
3. B	GO:0009909	regulation of flower development
3. B	GO:0009611	response to wounding
3. B	GO:0005773	vacuole
3. B	GO:0007026	negative regulation of microtubule depolymerization
3. B	GO:0009944	polarity specification of adaxial/abaxial axis
3. B	GO:0010305	leaf vascular tissue pattern formation
3. B	GO:0006303	double-strand break repair via nonhomologous end joining
3. B	GO:0000472	endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
3. B	GO:0010393	galacturonan metabolic process
3. B	GO:0007099	centriole replication
3. B	GO:0036064	ciliary basal body
3. B	GO:0030686	90S preribosome
3. B	GO:0008361	regulation of cell size
3. B	GO:0043122	regulation of I-kappaB kinase/NF-kappaB signaling
3. B	GO:0070971	endoplasmic reticulum exit site
3. B	GO:0005789	endoplasmic reticulum membrane
3. B	GO:0035064	methylated histone binding
3. B	GO:0034247	snoRNA splicing
3. B	GO:0005681	spliceosomal complex
3. B	GO:0034613	cellular protein localization
3. B	GO:0051012	microtubule sliding
3. B	GO:0034388	Pwp2p-containing subcomplex of 90S preribosome
3. B	GO:1903725	regulation of phospholipid metabolic process
3. B	GO:0045598	regulation of fat cell differentiation
3. B	GO:0030507	spectrin binding
3. B	GO:0000398	mRNA splicing, via spliceosome
3. B	GO:0080001	mucilage extrusion from seed coat
3. B	GO:0004857	enzyme inhibitor activity
3. B	GO:0071339	MLL1 complex
3. B	GO:0005814	centriole
3. B	GO:0045943	positive regulation of transcription by RNA polymerase I
3. B	GO:0009908	flower development
3. B	GO:0007079	mitotic chromosome movement towards spindle pole
3. B	GO:0009641	shade avoidance
3. B	GO:0032350	regulation of hormone metabolic process
3. B	GO:0051512	positive regulation of unidimensional cell growth
3. B	GO:0060271	cilium assembly
3. B	GO:0000393	spliceosomal conformational changes to generate catalytic conformation
3. B	GO:0071007	U2-type catalytic step 2 spliceosome
3. B	GO:0010659	cardiac muscle cell apoptotic process
3. B	GO:0031175	neuron projection development
3. B	GO:0005875	microtubule associated complex
3. B	GO:0005813	centrosome
3. B	GO:0043293	apoptosome
3. B	GO:0015630	microtubule cytoskeleton
3. B	GO:0005811	lipid droplet
3. B	GO:0043051	regulation of pharyngeal pumping
3. B	GO:0008352	katanin complex
3. B	GO:0090207	regulation of triglyceride metabolic process
3. B	GO:0016607	nuclear speck
3. B	GO:0012507	ER to Golgi transport vesicle membrane
3. B	GO:0000974	Prp19 complex
3. B	GO:0098654	CENP-A recruiting complex
3. B	GO:0010906	regulation of glucose metabolic process
3. B	GO:0051572	negative regulation of histone H3-K4 methylation
3. B	GO:0000077	DNA damage checkpoint signaling
3. B	GO:0048366	leaf development
3. B	GO:0005662	DNA replication factor A complex
3. B	GO:2000024	regulation of leaf development
3. B	GO:0043982	histone H4-K8 acetylation

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	Q9D7H2	WD repeat-containing protein 5B	0.00e+00	4.26e-02	0.007
1. PB	Q5FVP5	WD repeat-containing protein 89	0.00e+00	1.09e-87	0.0
1. PB	Q71UF4	Histone-binding protein RBBP7	3.35e-11	1.22e-02	0.007
1. PB	Q16576	Histone-binding protein RBBP7	1.82e-11	1.22e-02	0.007
1. PB	Q4R304	Histone-binding protein RBBP7	3.23e-11	1.22e-02	0.007
1. PB	Q5R4T8	DDB1- and CUL4-associated factor 13	1.22e-15	5.07e-09	0.005
1. PB	Q5RE95	WD repeat-containing protein 5B	0.00e+00	1.75e-02	0.007
1. PB	Q96FK6	WD repeat-containing protein 89	0	3.64e-139	0.0
1. PB	Q4V8C4	WD repeat-containing protein 5B	0.00e+00	3.34e-02	0.001
1. PB	Q86VZ2	WD repeat-containing protein 5B	0.00e+00	3.13e-03	0.013
1. PB	Q60973	Histone-binding protein RBBP7	2.59e-11	1.64e-02	0.007
1. PB	Q5BLX8	WD repeat domain-containing protein 83	0.00e+00	1.81e-06	6.50e-06
1. PB	Q5JTN6	WD repeat-containing protein 38	1.11e-16	1.75e-03	0.023
1. PB	Q7ZYQ6	DDB1- and CUL4-associated factor 13	2.22e-15	1.03e-09	0.027
1. PB	Q54SD4	Probable histone-binding protein rbbD	1.55e-15	5.09e-05	2.05e-05
1. PB	P17343	Guanine nucleotide-binding protein subunit beta-1	0.00e+00	1.94e-03	0.003
1. PB	Q61ZF6	Guanine nucleotide-binding protein subunit beta-1	0.00e+00	1.94e-03	0.003
1. PB	Q54LT8	Serine-threonine kinase receptor-associated protein	0.00e+00	2.15e-04	0.044
1. PB	Q6PAC3	DDB1- and CUL4-associated factor 13	9.99e-16	4.94e-10	0.023
1. PB	Q9Y7T2	Uncharacterized WD repeat-containing protein C63.06	0.00e+00	1.09e-12	2.09e-12
1. PB	Q3SWX8	Histone-binding protein RBBP7	3.60e-11	1.77e-02	0.007
1. PB	Q9I8G9	Histone-binding protein RBBP7	3.46e-11	5.12e-03	0.043
1. PB	P78798	Peroxisomal targeting signal 2 receptor	0.00e+00	7.46e-03	9.24e-07
1. PB	Q944S2	WD repeat-containing protein GTS1	3.33e-16	1.54e-23	5.83e-25
1. PB	Q6DH44	WD repeat domain-containing protein 83	0.00e+00	6.76e-08	5.41e-05
1. PB	Q7S7N3	Histone acetyltransferase type B subunit 2	8.59e-11	3.19e-02	0.006
1. PB	Q4P553	Histone acetyltransferase type B subunit 2	3.22e-15	3.40e-03	0.003
1. PB	Q54QU5	WD repeat-containing protein 89 homolog	0.00e+00	5.24e-29	1.81e-32
1. PB	Q9D0R9	WD repeat-containing protein 89	0.00e+00	4.72e-81	0.0
1. PB	Q5XGI5	WD repeat domain-containing protein 83	0.00e+00	5.03e-08	5.02e-05
1. PB	P53962	Uncharacterized WD repeat-containing protein YNL035C	8.49e-14	8.43e-24	1.44e-16
1. PB	Q9DAJ4	WD repeat domain-containing protein 83	0.00e+00	3.11e-06	6.27e-06
1. PB	O22467	Histone-binding protein MSI1	2.42e-11	1.13e-04	0.002
1. PB	Q7PS24	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	4.90e-02	0.002
1. PB	Q5ZLK1	DDB1- and CUL4-associated factor 13	1.33e-15	1.71e-08	0.009
1. PB	Q9M2Z2	COMPASS-like H3K4 histone methylase component WDR5A	0.00e+00	2.94e-04	7.40e-04
1. PB	Q6CGP9	Polyadenylation factor subunit 2	3.80e-09	5.17e-03	0.010
1. PB	Q5RBZ3	WD repeat-containing protein 89	0.00e+00	1.86e-121	0.0
1. PB	Q3ZBK1	WD repeat-containing protein 89	0.00e+00	3.71e-73	0.0
1. PB	Q803X4	DDB1- and CUL4-associated factor 13	2.44e-15	2.14e-09	2.61e-06
1. PB	Q9BRX9	WD repeat domain-containing protein 83	0.00e+00	1.21e-07	6.16e-06
1. PB	Q9NV06	DDB1- and CUL4-associated factor 13	1.44e-15	5.20e-09	0.007
2. P	B4KGX9	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	1.77e-04	NA
2. P	Q9U1Q0	EARP-interacting protein 1	7.42e-08	2.02e-04	NA
2. P	Q58E77	WD repeat-containing protein 82-B	0.00e+00	3.34e-09	NA
2. P	Q10G81	Histone-binding protein MSI1 homolog	1.91e-10	2.00e-03	NA
2. P	Q6BUJ2	Ribosome biogenesis protein NSA1	2.63e-08	1.44e-09	NA
2. P	Q8AVS9	DDB1- and CUL4-associated factor 10	6.38e-14	5.82e-03	NA
2. P	Q6BIA1	Autophagy-related protein 21	3.13e-04	1.68e-04	NA
2. P	B0BNA7	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	3.80e-06	NA
2. P	A4RDD7	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	1.31e-05	NA
2. P	Q9XWH0	Mitotic checkpoint protein bub-3	7.99e-15	8.95e-08	NA
2. P	B5VG60	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit TRM82	1.44e-11	9.07e-03	NA
2. P	Q29HG9	Protein LST8 homolog	5.55e-16	3.31e-02	NA
2. P	A4QNE6	Dynein axonemal assembly factor 10	2.22e-16	4.08e-06	NA
2. P	Q9BQA1	Methylosome protein 50	4.44e-16	6.09e-05	NA
2. P	P0CS51	Protein transport protein SEC13	1.89e-12	4.92e-03	NA
2. P	Q9UT39	Uncharacterized WD repeat-containing protein C824.04	2.22e-16	6.33e-10	NA
2. P	Q6DRF9	WD repeat-containing protein 55	1.72e-09	2.30e-04	NA
2. P	Q9W1J3	Gastrulation defective protein 1 homolog	3.91e-05	2.52e-02	NA
2. P	O89053	Coronin-1A	2.61e-09	3.92e-02	NA
2. P	Q5AQ62	WD repeat-containing protein JIP5	3.40e-06	3.53e-07	NA
2. P	Q75AV4	Polyadenylation factor subunit 2	9.43e-12	5.26e-05	NA
2. P	Q8BFQ4	WD repeat-containing protein 82	0.00e+00	6.76e-08	NA
2. P	Q9R0Q6	Actin-related protein 2/3 complex subunit 1A	1.19e-14	7.65e-04	NA
2. P	P93563	Guanine nucleotide-binding protein subunit beta	0.00e+00	6.43e-03	NA
2. P	Q2GTM8	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	8.88e-05	NA
2. P	Q0CRF8	WD repeat-containing protein jip5	1.66e-10	2.17e-07	NA
2. P	Q7PP77	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	1.77e-03	NA
2. P	A1D3I2	Probable cytosolic iron-sulfur protein assembly protein 1	1.40e-09	3.64e-03	NA
2. P	Q9FHK8	Autophagy-related protein 18e	4.72e-07	3.28e-04	NA
2. P	Q9LJN8	Mitotic checkpoint protein BUB3.1	1.08e-14	9.06e-10	NA
2. P	Q7RXH4	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	1.57e-06	NA
2. P	Q2U6D5	Autophagy-related protein 18	2.42e-10	2.18e-02	NA
2. P	P0CS32	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	2.25e-02	NA
2. P	G0S2X1	Nucleoporin NUP37	2.30e-05	6.76e-03	NA
2. P	B4MY77	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	6.82e-04	NA
2. P	P0CS30	Probable cytosolic iron-sulfur protein assembly protein 1	2.99e-14	4.87e-03	NA
2. P	Q6FJ73	Probable cytosolic iron-sulfur protein assembly protein 1	0.00e+00	1.83e-04	NA
2. P	Q1DZQ0	Protein transport protein SEC13	1.94e-12	4.07e-03	NA
2. P	Q6FNV4	Protein transport protein SEC13-1	4.46e-13	2.48e-03	NA
2. P	Q9SJW6	Actin-related protein 2/3 complex subunit 1B	2.13e-14	3.93e-05	NA
2. P	Q5M7K4	Histone-binding protein RBBP4	3.43e-11	1.91e-02	NA
2. P	O74763	Uncharacterized WD repeat-containing protein C17D11.08	6.28e-07	2.23e-04	NA
2. P	Q9BVC4	Target of rapamycin complex subunit LST8	8.88e-16	9.32e-07	NA
2. P	Q6CEI9	SVP1-like protein 2	1.31e-08	1.20e-02	NA
2. P	A1L3L9	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform	4.00e-12	9.29e-06	NA
2. P	P36876	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform	2.86e-12	5.71e-03	NA
2. P	Q12021	Radiation-sensitive protein 28	6.81e-08	4.45e-05	NA
2. P	Q758M2	WD repeat-containing protein JIP5	1.01e-07	4.13e-06	NA
2. P	Q40507	Guanine nucleotide-binding protein subunit beta	0.00e+00	1.23e-02	NA
2. P	P41318	Target of rapamycin complex subunit LST8	0.00e+00	2.25e-02	NA
2. P	P40217	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	1.05e-04	NA
2. P	F4I241	Mitotic checkpoint protein BUB3.3	8.66e-15	9.47e-09	NA
2. P	A8WVX8	Eukaryotic translation initiation factor 3 subunit I	1.11e-16	2.64e-05	NA
2. P	Q9NWT1	p21-activated protein kinase-interacting protein 1	2.33e-10	2.20e-02	NA
2. P	Q59RH5	Histone acetyltransferase type B subunit 2	6.66e-16	1.36e-03	NA
2. P	Q6UXN9	WD repeat-containing protein 82	0.00e+00	6.76e-08	NA
2. P	Q5FW06	DDB1- and CUL4-associated factor 10	2.13e-13	1.54e-03	NA
2. P	O74865	Diphthine methyltransferase	4.44e-16	1.31e-06	NA
2. P	Q875D4	WD repeat-containing protein JIP5	8.40e-09	4.84e-08	NA
2. P	Q8R3E3	WD repeat domain phosphoinositide-interacting protein 1	8.79e-08	2.80e-03	NA
2. P	A5DSU5	WD repeat-containing protein JIP5	1.74e-06	1.09e-04	NA
2. P	Q6CI08	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	5.94e-03	NA
2. P	Q5XFW8	Protein SEC13 homolog	5.65e-10	2.52e-02	NA
2. P	C8ZG43	Protein SWT21	3.42e-12	1.40e-02	NA
2. P	Q24572	Chromatin assembly factor 1 p55 subunit	3.11e-15	2.02e-02	NA
2. P	Q9GZS0	Dynein axonemal intermediate chain 2	4.04e-13	1.35e-04	NA
2. P	A2RAG5	Autophagy-related protein 18	2.73e-10	1.77e-02	NA
2. P	Q12363	Transcriptional modulator WTM1	1.05e-12	2.25e-06	NA
2. P	Q4P6E2	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	1.59e-06	NA
2. P	O74453	Shk1 kinase-binding protein 15	1.33e-09	3.46e-04	NA
2. P	O88656	Actin-related protein 2/3 complex subunit 1B	7.66e-15	1.27e-05	NA
2. P	Q9Y4P8	WD repeat domain phosphoinositide-interacting protein 2	7.58e-07	5.52e-04	NA
2. P	O59894	Peroxisomal targeting signal 2 receptor	8.88e-16	6.29e-05	NA
2. P	P40055	U3 small nucleolar RNA-associated protein 7	2.02e-08	1.54e-05	NA
2. P	Q9Y484	WD repeat domain phosphoinositide-interacting protein 4	1.61e-08	4.13e-06	NA
2. P	Q9FKT5	THO complex subunit 3	4.44e-16	6.54e-04	NA
2. P	B4GSH1	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	5.95e-04	NA
2. P	A8WGE3	Coronin-2B	2.32e-07	1.52e-04	NA
2. P	B4L6T9	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wuho	9.30e-10	1.67e-05	NA
2. P	Q00362	Protein phosphatase PP2A regulatory subunit B	2.57e-04	1.03e-02	NA
2. P	Q965S8	Eukaryotic translation initiation factor 3 subunit I	1.11e-16	3.04e-06	NA
2. P	O59762	Guanine nucleotide-binding protein negative regulator 1	1.11e-14	3.15e-06	NA
2. P	A5DGL8	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	1.18e-05	NA
2. P	Q86MP3	Ectopic P granules protein 6	4.57e-08	2.49e-07	NA
2. P	Q3SWS8	mRNA export factor	2.33e-14	1.16e-04	NA
2. P	Q6FU05	Ribosome biogenesis protein NSA1	2.66e-08	2.00e-11	NA
2. P	Q6CVN2	WD repeat-containing protein JIP5	8.52e-07	2.93e-05	NA
2. P	B3MC74	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	9.53e-04	NA
2. P	Q9HAV0	Guanine nucleotide-binding protein subunit beta-4	0.00e+00	3.40e-03	NA
2. P	P63151	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform	3.41e-12	5.82e-03	NA
2. P	Q4R4J2	Coronin-1A	2.79e-09	2.79e-02	NA
2. P	P54313	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2	0.00e+00	2.74e-02	NA
2. P	A5DNK9	Pre-rRNA-processing protein IPI3	1.27e-08	1.12e-06	NA
2. P	Q96P53	WD repeat and FYVE domain-containing protein 2	5.11e-07	2.90e-02	NA
2. P	Q8AVH1	Histone-binding protein RBBP7	2.66e-15	1.42e-02	NA
2. P	A8NZM5	WD repeat-containing protein JIP5	1.64e-10	4.11e-03	NA
2. P	Q4R3J7	DDB1- and CUL4-associated factor 12	5.48e-12	3.37e-02	NA
2. P	Q02887	Autophagy-related protein 21	3.24e-04	7.02e-06	NA
2. P	Q5ZKU8	p21-activated protein kinase-interacting protein 1-like	1.04e-08	9.91e-03	NA
2. P	Q8VE80	THO complex subunit 3	1.11e-16	4.28e-03	NA
2. P	C7GTF9	Protein SWT21	1.53e-12	9.81e-03	NA
2. P	Q6C2S3	WD repeat-containing protein JIP5	1.33e-10	2.48e-09	NA
2. P	Q0CW30	Autophagy-related protein 18	3.58e-10	2.77e-02	NA
2. P	Q29RH4	THO complex subunit 3	1.11e-16	1.70e-03	NA
2. P	B5VQM2	Protein SWT21	2.00e-12	4.63e-03	NA
2. P	Q86A97	EARP-interacting protein homolog	3.22e-07	6.82e-03	NA
2. P	A1CQL6	Probable cytosolic iron-sulfur protein assembly protein 1	1.15e-09	1.28e-02	NA
2. P	Q5U4D9	THO complex subunit 6 homolog	1.13e-10	1.05e-02	NA
2. P	Q5RE10	EARP and GARP complex-interacting protein 1	9.98e-14	1.82e-02	NA
2. P	Q29090	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform (Fragment)	7.52e-12	3.54e-02	NA
2. P	Q9WV32	Actin-related protein 2/3 complex subunit 1B	7.22e-15	4.24e-04	NA
2. P	Q9LT47	Polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM	2.22e-16	3.11e-07	NA
2. P	P40077	Protein DSE1	5.18e-10	4.76e-04	NA
2. P	A8WVD2	Nucleoporin SEH1	6.58e-12	1.95e-08	NA
2. P	Q66HC9	Dynein axonemal intermediate chain 2	4.69e-13	3.01e-03	NA
2. P	Q4P4N1	Autophagy-related protein 18	3.62e-07	4.76e-04	NA
2. P	Q6BIR1	Protein transport protein SEC13	1.02e-12	1.12e-02	NA
2. P	Q2GMF6	WD repeat-containing protein JIP5	1.37e-10	5.24e-07	NA
2. P	Q9QZD9	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	8.46e-06	NA
2. P	Q6NUD0	Methylosome protein 50	3.33e-16	1.70e-04	NA
2. P	Q8VZY6	Polycomb group protein FIE2	5.55e-16	2.64e-04	NA
2. P	Q55AR8	U5 small nuclear ribonucleoprotein 40 kDa protein	2.22e-16	6.54e-06	NA
2. P	Q55DA2	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	0.00e+00	4.92e-03	NA
2. P	A2AC93	Dynein axonemal intermediate chain 2	4.86e-13	1.86e-02	NA
2. P	Q5R9T6	WD repeat-containing protein 55	1.92e-11	2.20e-08	NA
2. P	O80990	Protein CIA1	0.00e+00	1.80e-02	NA
2. P	Q1JP79	Actin-related protein 2/3 complex subunit 1A	1.70e-14	6.76e-03	NA
2. P	Q8W1K8	Protein Mut11	0.00e+00	3.72e-03	NA
2. P	Q91ZN1	Coronin-1A	2.16e-09	4.64e-02	NA
2. P	Q75C99	Histone acetyltransferase type B subunit 2	2.00e-15	2.69e-02	NA
2. P	A2QPG3	WD repeat-containing protein jip5	2.03e-10	2.28e-07	NA
2. P	Q6DIY3	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform	2.95e-12	2.16e-02	NA
2. P	B4N0L0	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	3.39e-04	NA
2. P	P93398	Guanine nucleotide-binding protein subunit beta-2	0.00e+00	1.93e-02	NA
2. P	Q7ZUX3	WD repeat domain phosphoinositide-interacting protein 4	1.69e-08	1.88e-05	NA
2. P	A8QBF3	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	7.04e-04	NA
2. P	Q5ZL16	WD repeat domain phosphoinositide-interacting protein 3	1.74e-12	8.17e-06	NA
2. P	Q9Y825	Uncharacterized WD repeat-containing protein C25H1.06	6.66e-16	9.91e-03	NA
2. P	P53136	Ribosome biogenesis protein NSA1	1.31e-07	1.13e-06	NA
2. P	Q75C26	Probable cytosolic iron-sulfur protein assembly protein 1	0.00e+00	1.70e-02	NA
2. P	Q5XIG8	Serine-threonine kinase receptor-associated protein	1.41e-12	4.43e-09	NA
2. P	Q9P7W4	F-box/WD repeat-containing protein pof10	3.05e-05	2.09e-04	NA
2. P	Q5FVA9	mRNA export factor	2.08e-14	3.85e-07	NA
2. P	Q9CR39	WD repeat domain phosphoinositide-interacting protein 3	1.89e-12	1.77e-06	NA
2. P	Q00006	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform (Fragment)	3.15e-06	1.49e-02	NA
2. P	Q96WW0	Uncharacterized WD repeat-containing protein C32H8.09	2.07e-05	1.99e-02	NA
2. P	O45933	Nucleoporin SEH1	6.90e-12	5.20e-05	NA
2. P	A6ZMK5	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	1.05e-04	NA
2. P	P90917	Probable histone-binding protein rba-1	3.00e-15	3.99e-03	NA
2. P	Q16K15	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	5.33e-03	NA
2. P	Q68F45	WD repeat domain phosphoinositide-interacting protein 3	1.13e-12	1.62e-04	NA
2. P	Q9VTV1	THO complex subunit 6	1.81e-10	1.71e-04	NA
2. P	Q96MX6	Dynein axonemal assembly factor 10	5.55e-16	1.58e-08	NA
2. P	C5DUI6	ASTRA-associated protein 1	2.94e-12	5.17e-03	NA
2. P	Q13216	DNA excision repair protein ERCC-8	4.27e-12	4.18e-14	NA
2. P	B4HRQ6	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	1.60e-03	NA
2. P	Q7RZF5	Protein transport protein sec13	4.12e-12	4.97e-03	NA
2. P	A8XJ40	Protein SEC13 homolog	3.23e-13	1.90e-06	NA
2. P	P90916	Probable histone-binding protein lin-53	3.27e-11	1.92e-03	NA
2. P	A5DVY3	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	2.61e-05	NA
2. P	Q9Y4P3	Transducin beta-like protein 2	2.31e-13	1.51e-05	NA
2. P	Q569D5	Methanethiol oxidase	3.13e-07	1.49e-02	NA
2. P	F4IIK6	Non-functional target of rapamycin complex subunit LST8-2	2.22e-16	2.62e-02	NA
2. P	Q9ULV4	Coronin-1C	3.72e-09	1.52e-02	NA
2. P	Q5E9A4	mRNA export factor	2.22e-14	3.21e-04	NA
2. P	Q75AQ4	SVP1-like protein 2	1.50e-07	4.28e-03	NA
2. P	Q17CH9	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wuho	7.98e-13	4.36e-03	NA
2. P	Q54Q99	Serine/threonine-protein phosphatase 2A regulatory subunit phr2AB	1.26e-10	8.64e-03	NA
2. P	Q29L19	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	5.95e-04	NA
2. P	A7TH19	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	3.55e-05	NA
2. P	A6ZYC3	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit TRM82	1.41e-11	3.04e-02	NA
2. P	Q5A2T0	Ribosome biogenesis protein NSA1	3.01e-12	1.73e-15	NA
2. P	Q7ZTY4	Histone-binding protein RBBP7	1.55e-15	4.32e-03	NA
2. P	Q9LYK6	Protein ANTHESIS POMOTING FACTOR 1	1.11e-16	5.05e-07	NA
2. P	O96622	Actin-related protein 2/3 complex subunit 1	1.65e-14	3.00e-08	NA
2. P	O93377	Histone-binding protein RBBP4-A	3.61e-11	2.72e-02	NA
2. P	Q4R6D2	mRNA export factor	2.70e-14	7.65e-04	NA
2. P	A1DE24	Autophagy-related protein 18	4.60e-07	4.99e-02	NA
2. P	Q9R099	Transducin beta-like protein 2	1.85e-13	1.03e-06	NA
2. P	Q9DB94	WD repeat-containing protein 53	4.44e-16	1.52e-04	NA
2. P	Q6BSL7	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	6.15e-05	NA
2. P	A6ZX45	WD repeat-containing protein JIP5	1.37e-07	2.44e-08	NA
2. P	O43684	Mitotic checkpoint protein BUB3	1.04e-10	5.56e-09	NA
2. P	Q08706	Guanine nucleotide-binding protein subunit beta	0.00e+00	1.58e-02	NA
2. P	Q09028	Histone-binding protein RBBP4	3.88e-11	1.23e-02	NA
2. P	Q32KQ2	WD repeat-containing protein 53	6.66e-16	6.38e-07	NA
2. P	O13856	Uncharacterized WD repeat-containing protein C1A6.02	2.75e-11	1.73e-13	NA
2. P	P57081	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4	8.25e-10	3.42e-06	NA
2. P	B4NW98	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	1.07e-03	NA
2. P	P41838	Poly(A)+ RNA export protein	7.33e-15	6.62e-07	NA
2. P	B5DMC9	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wuho	3.36e-09	2.15e-05	NA
2. P	Q6BUX9	SVP1-like protein 2	2.74e-07	2.61e-03	NA
2. P	P38328	Actin-related protein 2/3 complex subunit 1	2.45e-13	1.55e-06	NA
2. P	Q6BK34	Histone acetyltransferase type B subunit 2	6.66e-16	2.56e-04	NA
2. P	O94698	Ribosome biogenesis protein nsa1	4.60e-11	2.56e-10	NA
2. P	Q61Y48	Probable histone-binding protein lin-53	3.41e-11	9.07e-03	NA
2. P	P39108	Peroxisomal targeting signal 2 receptor	7.77e-16	1.26e-04	NA
2. P	Q5R654	Histone-binding protein RBBP7	3.17e-11	9.07e-03	NA
2. P	Q8GYD7	Autophagy-related protein 18c	2.08e-06	1.81e-03	NA
2. P	B3MRC6	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wuho	1.71e-12	2.64e-02	NA
2. P	Q0WPK3	Autophagy-related protein 18d	2.92e-06	1.01e-05	NA
2. P	Q6P3H7	Histone-binding protein RBBP4	2.50e-11	2.87e-02	NA
2. P	Q759L2	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	6.22e-05	NA
2. P	A7E3S5	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4	1.68e-13	2.11e-03	NA
2. P	Q5ZMV7	WD repeat-containing protein 82	0.00e+00	1.03e-07	NA
2. P	Q5E959	Serine-threonine kinase receptor-associated protein	1.44e-10	6.53e-09	NA
2. P	Q10282	Guanine nucleotide-binding protein subunit beta	0.00e+00	1.46e-03	NA
2. P	Q5ZL33	Serine-threonine kinase receptor-associated protein	1.52e-10	1.83e-08	NA
2. P	Q9DCJ1	Target of rapamycin complex subunit LST8	8.88e-16	1.52e-07	NA
2. P	Q10281	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	7.60e-03	NA
2. P	Q9Z2K5	Target of rapamycin complex subunit LST8	8.88e-16	1.46e-08	NA
2. P	P40066	mRNA export factor GLE2	2.17e-10	1.08e-03	NA
2. P	Q9VPH8	Retinoblastoma-binding protein 5 homolog	3.85e-09	4.81e-02	NA
2. P	P49177	Guanine nucleotide-binding protein subunit beta	0.00e+00	1.34e-03	NA
2. P	Q1DR81	Probable cytosolic iron-sulfur protein assembly protein 1	5.58e-14	5.12e-03	NA
2. P	Q2YDS1	DNA damage-binding protein 2	1.68e-11	6.22e-05	NA
2. P	Q5MNZ9	WD repeat domain phosphoinositide-interacting protein 1	1.37e-06	1.54e-05	NA
2. P	P54614	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform	1.51e-11	2.13e-03	NA
2. P	Q5EA99	p21-activated protein kinase-interacting protein 1	7.14e-09	1.55e-02	NA
2. P	Q8VCG3	WD repeat-containing protein 74	2.07e-10	7.68e-08	NA
2. P	A5DX41	Ribosome biogenesis protein NSA1	1.06e-10	5.30e-08	NA
2. P	Q4QR85	Methylosome protein 50	3.33e-16	2.29e-03	NA
2. P	Q7S4F7	WD repeat-containing protein jip5	2.29e-10	9.67e-07	NA
2. P	A6ZWF0	Autophagy-related protein 21	1.28e-04	3.17e-05	NA
2. P	Q0CHM0	Protein transport protein sec13	3.51e-12	6.82e-04	NA
2. P	Q7ZV55	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	8.04e-05	NA
2. P	Q8H1Q8	Autophagy-related protein 18b	1.24e-11	1.49e-04	NA
2. P	B4MA12	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wuho	1.34e-09	3.35e-04	NA
2. P	P93339	Guanine nucleotide-binding protein subunit beta	NA	1.40e-02	NA
2. P	O94394	Uncharacterized WD repeat-containing protein C126.01c	1.95e-11	1.65e-02	NA
2. P	A8PZI1	WD repeat-containing protein JIP5	3.59e-10	3.48e-07	NA
2. P	Q8BH44	Coronin-2B	4.06e-09	1.09e-03	NA
2. P	Q1JQB2	Mitotic checkpoint protein BUB3	4.55e-15	4.09e-09	NA
2. P	P57380	6-phosphogluconolactonase	1.10e-09	3.47e-02	NA
2. P	Q0TZA1	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit TRM82	3.21e-10	2.67e-02	NA
2. P	Q54E33	Dynein axonemal assembly factor 10	9.99e-16	4.38e-02	NA
2. P	Q6RFH5	WD repeat-containing protein 74	3.66e-10	2.96e-08	NA
2. P	Q5U2Y0	WD repeat domain phosphoinositide-interacting protein 4	2.72e-07	6.49e-03	NA
2. P	P26308	Guanine nucleotide-binding protein subunit beta-1	0.00e+00	7.68e-03	NA
2. P	O94620	Pre-mRNA-splicing factor cwf17	1.11e-16	7.77e-05	NA
2. P	B4JWS7	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wuho	7.67e-10	4.66e-04	NA
2. P	O22466	WD-40 repeat-containing protein MSI1	1.55e-15	6.18e-03	NA
2. P	Q59WJ4	Polyadenylation factor subunit 2	3.34e-14	2.73e-04	NA
2. P	Q5AG86	Probable cytosolic iron-sulfur protein assembly protein 1	7.77e-16	2.79e-02	NA
2. P	Q6FNJ1	Pre-rRNA-processing protein IPI3	2.54e-07	1.43e-03	NA
2. P	Q5QA93	SVP1-like protein 2	1.84e-08	9.92e-05	NA
2. P	Q6FXI8	Histone acetyltransferase type B subunit 2	3.28e-11	3.31e-04	NA
2. P	A3LNW3	Protein transport protein SEC13	1.49e-12	1.90e-03	NA
2. P	Q3MHH0	DDB1- and CUL4-associated factor 12	4.95e-12	4.55e-02	NA
2. P	Q1HPW4	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	5.71e-03	NA
2. P	A5DEK6	WD repeat-containing protein JIP5	4.46e-09	1.14e-05	NA
2. P	Q7K1Y4	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	2.36e-03	NA
2. P	A5DKC4	Ribosome biogenesis protein NSA1	3.74e-09	3.26e-11	NA
2. P	Q5RAN6	Nucleoporin SEH1	1.23e-09	1.70e-04	NA
2. P	Q9LV27	Target of rapamycin complex subunit LST8-1	0.00e+00	3.91e-03	NA
2. P	Q2UBM4	WD repeat-containing protein jip5	8.69e-09	4.66e-08	NA
2. P	A2QHM1	Protein transport protein sec13	1.74e-12	4.82e-03	NA
2. P	Q54NA2	Autophagy-related protein 18	8.20e-08	1.99e-07	NA
2. P	Q0V320	Eukaryotic translation initiation factor 3 subunit I	1.11e-16	1.13e-05	NA
2. P	A6SJ85	Autophagy-related protein 18	8.78e-06	1.02e-02	NA
2. P	C9STX5	ASTRA-associated protein 1	1.52e-13	1.19e-02	NA
2. P	Q58CQ2	Actin-related protein 2/3 complex subunit 1B	8.10e-15	3.07e-04	NA
2. P	Q93ZG3	WD repeat-containing protein ATCSA-1	2.52e-10	6.85e-08	NA
2. P	Q66JG1	DNA damage-binding protein 2	6.32e-11	8.32e-04	NA
2. P	B3NXQ7	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wuho	4.34e-06	5.22e-03	NA
2. P	Q9BTV6	Diphthine methyltransferase	1.25e-07	1.46e-04	NA
2. P	A4R7U3	Probable cytosolic iron-sulfur protein assembly protein 1	5.73e-14	2.14e-02	NA
2. P	Q6BWJ5	WD repeat-containing protein JIP5	6.03e-06	1.06e-05	NA
2. P	A7ESR0	ASTRA-associated protein 1	1.01e-08	2.67e-02	NA
2. P	B4Q354	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	2.58e-03	NA
2. P	A1DMA6	WD repeat-containing protein jip5	1.14e-10	1.06e-07	NA
2. P	Q6P1F6	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform	3.09e-12	5.82e-03	NA
2. P	Q6CNC8	Protein DSE1	2.44e-07	2.43e-07	NA
2. P	Q5B563	Protein transport protein sec13	1.45e-12	6.27e-04	NA
2. P	Q9C1X0	Uncharacterized WD repeat-containing protein C713.05	0.00e+00	2.33e-06	NA
2. P	P53031	Protein phosphatase PP2A regulatory subunit B	2.95e-10	6.01e-04	NA
2. P	Q0CCS0	Probable cytosolic iron-sulfur protein assembly protein 1	2.55e-15	9.81e-03	NA
2. P	Q92176	Coronin-1A	2.58e-09	9.91e-03	NA
2. P	A4RGU7	WD repeat-containing protein JIP5	4.10e-10	3.13e-02	NA
2. P	Q6FL15	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	1.64e-04	NA
2. P	A3LVX0	Ribosome biogenesis protein NSA1	3.85e-07	3.39e-10	NA
2. P	Q6CKX3	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	8.31e-05	NA
2. P	Q9W328	Protein LST8 homolog	3.33e-16	8.88e-05	NA
2. P	Q561Y0	Dynein axonemal assembly factor 10	3.33e-16	7.68e-10	NA
2. P	Q40687	Guanine nucleotide-binding protein subunit beta	0.00e+00	2.31e-02	NA
2. P	Q9EP82	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4	9.09e-10	2.67e-02	NA
2. P	Q6P315	Histone-binding protein RBBP7	2.33e-15	1.30e-02	NA
2. P	Q6PA72	Target of rapamycin complex subunit lst8	1.55e-15	7.67e-07	NA
2. P	Q5AI22	Autophagy-related protein 21	1.05e-03	2.20e-05	NA
2. P	Q6DCV0	WD repeat domain phosphoinositide-interacting protein 4	1.69e-08	1.58e-03	NA
2. P	Q9XW12	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	0.00e+00	2.34e-03	NA
2. P	Q9UTN4	Polyadenylation factor subunit 2	1.00e-10	1.55e-02	NA
2. P	Q9H6Y2	WD repeat-containing protein 55	1.43e-11	1.83e-08	NA
2. P	Q5RB58	Mitotic checkpoint protein BUB3	1.05e-10	3.33e-08	NA
2. P	Q754U4	Ribosome biogenesis protein NSA1	1.87e-06	1.41e-08	NA
2. P	B4LJT7	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	1.56e-02	NA
2. P	O22469	WD-40 repeat-containing protein MSI3	5.87e-11	3.99e-06	NA
2. P	Q6BT42	Protein DSE1	6.19e-06	1.91e-02	NA
2. P	A6ZRQ0	Protein SWT21	1.41e-12	4.63e-03	NA
2. P	P23232	Guanine nucleotide-binding protein subunit beta	0.00e+00	2.23e-02	NA
2. P	Q80W47	WD repeat domain phosphoinositide-interacting protein 2	7.07e-07	1.37e-03	NA
2. P	P26449	Cell cycle arrest protein BUB3	6.79e-14	1.07e-11	NA
2. P	P27133	Coronin-A	1.81e-09	3.32e-05	NA
2. P	Q6BP03	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit TRM82	1.62e-07	3.57e-04	NA
2. P	P36408	Guanine nucleotide-binding protein subunit beta	0.00e+00	1.01e-03	NA
2. P	Q75D34	Autophagy-related protein 21	4.04e-06	9.50e-06	NA
2. P	B3MVL6	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	2.27e-03	NA
2. P	A6RUL1	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	4.77e-03	NA
2. P	Q6CKH7	Ribosome biogenesis protein NSA1	1.31e-07	1.95e-08	NA
2. P	B7QKS1	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	0.00e+00	4.25e-05	NA
2. P	B4KTK4	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	4.63e-03	NA
2. P	Q6FN70	Protein DSE1	3.05e-07	2.89e-06	NA
2. P	Q6TMK6	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	NA	2.64e-02	NA
2. P	B7LJZ2	6-phosphogluconolactonase	2.10e-09	1.74e-02	NA
2. P	P53873	Protein SWT21	1.51e-12	4.63e-03	NA
2. P	Q9FH32	Autophagy-related protein 18f	1.69e-05	3.50e-02	NA
2. P	Q96EE3	Nucleoporin SEH1	1.06e-09	4.24e-04	NA
2. P	Q66J51	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	1.77e-03	NA
2. P	Q7ZWU5	WD repeat domain phosphoinositide-interacting protein 2	2.62e-08	2.36e-05	NA
2. P	Q6CBI8	Probable cytosolic iron-sulfur protein assembly protein 1	1.11e-16	2.38e-02	NA
2. P	S8ASK6	WD40 repeat protein poxJ	NA	5.24e-04	NA
2. P	Q93VR9	Protein SEH1	5.86e-12	4.66e-04	NA
2. P	P0CS50	Protein transport protein SEC13	2.20e-12	4.92e-03	NA
2. P	Q0D2F4	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform	1.28e-11	1.35e-02	NA
2. P	Q7Z5U6	WD repeat-containing protein 53	1.22e-15	5.44e-05	NA
2. P	P38332	Diphthine methyltransferase	1.12e-13	9.84e-06	NA
2. P	Q9VLN1	WD repeat-containing protein 82	0.00e+00	9.44e-10	NA
2. P	O16466	Autophagy-related protein 18	3.46e-08	9.32e-07	NA
2. P	Q17QU5	Target of rapamycin complex subunit LST8	9.99e-16	1.31e-06	NA
2. P	O42860	Mitotic checkpoint protein bub3	4.44e-15	1.35e-08	NA
2. P	Q9USL1	Uncharacterized WD repeat-containing protein C18B5.10c	4.44e-16	9.59e-05	NA
2. P	B4LUA5	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	2.41e-03	NA
2. P	Q8BUB4	WD repeat and FYVE domain-containing protein 2	5.13e-07	3.01e-02	NA
2. P	Q5R7W0	WD repeat domain phosphoinositide-interacting protein 3	1.61e-12	6.73e-05	NA
2. P	B8MWR8	Probable cytosolic iron-sulfur protein assembly protein 1	7.33e-15	7.11e-04	NA
2. P	Q9WUM4	Coronin-1C	3.00e-07	2.36e-02	NA
2. P	Q1DKJ3	Autophagy-related protein 18	1.93e-07	1.25e-02	NA
2. P	Q6GL39	WD repeat-containing protein 82	0.00e+00	8.23e-10	NA
2. P	A7RM20	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	8.47e-03	NA
2. P	Q96J01	THO complex subunit 3	1.11e-16	4.41e-03	NA
2. P	Q8C570	mRNA export factor	2.44e-14	2.00e-03	NA
2. P	Q75BE7	ASTRA-associated protein 1	4.15e-12	1.67e-03	NA
2. P	P29829	Guanine nucleotide-binding protein subunit beta-2	0.00e+00	1.57e-04	NA
2. P	Q9XF57	Peroxisome biogenesis protein 7	0.00e+00	8.90e-03	NA
2. P	P49178	Guanine nucleotide-binding protein subunit beta	0.00e+00	1.64e-02	NA
2. P	Q54HW5	Guanine nucleotide-binding protein subunit beta-like protein 1 homolog	3.05e-14	2.94e-04	NA
2. P	P0CS28	Autophagy-related protein 18	1.04e-07	1.50e-03	NA
2. P	Q3Z422	6-phosphogluconolactonase	2.10e-09	3.16e-02	NA
2. P	Q6FJS0	Polyadenylation factor subunit 2	8.02e-12	6.75e-04	NA
2. P	Q6CSZ5	Protein transport protein SEC13	7.05e-13	3.81e-02	NA
2. P	Q5RF99	mRNA export factor	1.69e-14	3.39e-04	NA
2. P	Q8BGF3	Dynein axonemal assembly factor 10	3.33e-16	1.97e-06	NA
2. P	Q7K2X8	Nucleoporin seh1	3.09e-09	2.46e-07	NA
2. P	P36877	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform	1.71e-11	8.23e-03	NA
2. P	Q5U4Y8	Nucleoporin SEH1	9.88e-10	6.96e-05	NA
2. P	Q3UDP0	WD repeat-containing protein 41	7.60e-10	7.76e-07	NA
2. P	Q00005	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform	1.19e-11	2.77e-02	NA
2. P	A6RDW5	WD repeat-containing protein JIP5	1.64e-08	3.94e-11	NA
2. P	B4JW81	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	1.95e-04	NA
2. P	P78406	mRNA export factor	1.68e-14	3.39e-04	NA
2. P	Q6CEC9	Ribosome biogenesis protein NSA1	1.78e-08	1.16e-10	NA
2. P	P20484	Protein MAK11	7.43e-10	2.14e-08	NA
2. P	P50079	SVP1-like protein 2	9.12e-06	2.23e-05	NA
2. P	A5GFN6	mRNA export factor	2.32e-14	9.73e-04	NA
2. P	Q99296	Uncharacterized protein YLR149C	1.27e-02	2.29e-03	NA
2. P	Q5BH53	Autophagy-related protein 18	4.29e-07	3.36e-03	NA
2. P	Q91VM3	WD repeat domain phosphoinositide-interacting protein 4	1.99e-08	3.71e-06	NA
2. P	Q6BVZ3	Polyadenylation factor subunit 2	8.60e-11	4.86e-02	NA
2. P	Q6ZWR4	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform	1.59e-11	2.77e-02	NA
2. P	Q9W7I5	Histone-binding protein RBBP4	4.23e-11	1.05e-02	NA
2. P	A7YY75	Nucleoporin SEH1	2.00e-09	4.76e-05	NA
2. P	Q2UQ34	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	8.81e-03	NA
2. P	A0A1W5T363	WD40 repeat protein poxJ	NA	5.24e-04	NA
2. P	Q58DT8	WD repeat-containing protein 55	2.65e-09	5.11e-07	NA
2. P	Q6NQ88	Protein DAMAGED DNA-BINDING 2	1.43e-08	3.77e-04	NA
2. P	Q6ZJX0	Polycomb group protein FIE1	3.33e-16	1.95e-04	NA
2. P	Q75E79	Protein SWT21	4.49e-09	2.61e-03	NA
2. P	Q1DNW5	WD repeat-containing protein JIP5	1.69e-10	2.84e-09	NA
2. P	Q5GIS3	Guanine nucleotide-binding protein subunit beta	0.00e+00	3.40e-03	NA
2. P	Q324C4	6-phosphogluconolactonase	2.10e-09	1.62e-02	NA
2. P	B3NQR5	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	8.07e-03	NA
2. P	Q4WNA1	WD repeat-containing protein jip5	1.21e-08	1.23e-07	NA
2. P	A8IZG4	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	0.00e+00	2.69e-02	NA
2. P	P55735	Protein SEC13 homolog	1.84e-09	3.74e-02	NA
2. P	Q92747	Actin-related protein 2/3 complex subunit 1A	1.72e-14	1.20e-03	NA
2. P	O60137	Set1 complex component swd2	5.11e-15	9.73e-15	NA
2. P	Q5M7F6	Dynein axonemal assembly factor 10	2.22e-16	5.85e-07	NA
2. P	C5DD02	Protein SWT21	1.36e-08	2.00e-02	NA
2. P	Q640T2	WD repeat domain phosphoinositide-interacting protein 3	2.53e-12	4.60e-05	NA
2. P	Q6GNF1	Nucleoporin SEH1-B	2.04e-09	7.19e-05	NA
2. P	Q8R2U0	Nucleoporin SEH1	1.59e-09	1.79e-04	NA
2. P	Q54SA5	WD repeat-containing protein 55 homolog	3.18e-11	3.78e-02	NA
2. P	Q7ZWF0	mRNA export factor	2.22e-14	6.33e-04	NA
2. P	Q9C701	Mitotic checkpoint protein BUB3.2	1.09e-14	1.80e-07	NA
2. P	Q803V5	Target of rapamycin complex subunit lst8	7.77e-16	2.48e-06	NA
2. P	O02195	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	2.83e-03	NA
2. P	Q8GWR1	Aladin	1.73e-08	1.65e-02	NA
2. P	P31146	Coronin-1A	2.48e-09	2.20e-02	NA
2. P	Q54DM1	Mitotic checkpoint protein bub3	5.77e-15	1.35e-09	NA
2. P	A6ZU71	Ribosome biogenesis protein NSA1	1.40e-07	2.04e-07	NA
2. P	B8D985	6-phosphogluconolactonase	1.19e-09	2.33e-02	NA
2. P	Q8CFD5	DNA excision repair protein ERCC-8	6.32e-12	6.95e-15	NA
2. P	B3LP36	Protein SWT21	1.66e-12	4.63e-03	NA
2. P	P0CS31	Probable cytosolic iron-sulfur protein assembly protein 1	3.15e-14	4.87e-03	NA
2. P	Q8BGZ3	DDB1- and CUL4-associated factor 12	4.72e-12	1.15e-02	NA
2. P	O35353	Guanine nucleotide-binding protein subunit beta-4	0.00e+00	5.02e-03	NA
2. P	Q5IH81	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	1.44e-04	NA
2. P	Q6INH0	Histone-binding protein RBBP4-B	2.32e-11	3.01e-02	NA
2. P	C1BK83	Nucleoporin SEH1	1.38e-09	3.04e-04	NA
2. P	Q04199	Chromatin assembly factor 1 subunit p60	3.65e-10	1.79e-04	NA
2. P	Q29RZ9	Dynein axonemal assembly factor 10	4.44e-16	9.85e-09	NA
2. P	Q9YGY3	Mitotic checkpoint protein BUB3	5.66e-15	2.53e-08	NA
2. P	Q10099	Nucleoporin seh1	6.36e-13	7.08e-11	NA
2. P	B9WJ47	ASTRA-associated protein 1	2.33e-11	3.50e-02	NA
2. P	A8J3F6	Dynein axonemal assembly factor 10	2.22e-16	1.40e-10	NA
2. P	Q5ZHN3	WD repeat domain phosphoinositide-interacting protein 2	2.41e-08	3.57e-04	NA
2. P	Q9N4A7	Protein SEC13 homolog	9.60e-08	2.32e-04	NA
2. P	Q68FJ6	p21-activated protein kinase-interacting protein 1-like	2.00e-11	7.42e-04	NA
2. P	Q5F3R7	DDB1- and CUL4-associated factor 12	7.36e-12	3.67e-06	NA
2. P	Q6DJD8	Coronin-2B	1.27e-07	8.64e-03	NA
2. P	B8AP31	Guanine nucleotide-binding protein subunit beta	0.00e+00	1.56e-02	NA
2. P	Q06214	WD repeat-containing protein JIP5	1.41e-07	3.64e-08	NA
2. P	Q3MHL3	Histone-binding protein RBBP4	2.22e-15	1.23e-02	NA
2. P	Q6DCN1	WD repeat domain phosphoinositide-interacting protein 1	5.17e-08	1.01e-05	NA
2. P	A3LPR4	WD repeat-containing protein JIP5	2.69e-06	8.95e-08	NA
2. P	Q16960	Dynein intermediate chain 3, ciliary	5.91e-10	1.71e-05	NA
2. P	Q38942	Protein RAE1	2.66e-15	8.63e-09	NA
2. P	G0SEA3	mRNA export factor GLE2	2.55e-15	1.85e-03	NA
2. P	A7TL79	Protein SWT21	1.11e-08	1.69e-08	NA
2. P	Q5I0B4	Target of rapamycin complex subunit lst8	1.55e-15	1.36e-06	NA
2. P	P78774	Actin-related protein 2/3 complex subunit 1	6.25e-10	4.35e-05	NA
2. P	O74184	Target of rapamycin complex subunit wat1	0.00e+00	1.98e-04	NA
2. P	A7EF03	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	1.24e-02	NA
2. P	A7EGU0	WD repeat-containing protein jip5	4.47e-10	2.96e-07	NA
2. P	Q4QR00	Dynein axonemal intermediate chain 2	2.47e-13	3.97e-05	NA
2. P	Q9W2E7	Protein Rae1	6.00e-15	1.04e-05	NA
2. P	O80775	WD repeat-containing protein 55	6.83e-10	4.69e-07	NA
2. P	Q7ZUW6	WD repeat domain phosphoinositide-interacting protein 3	1.35e-12	4.04e-06	NA
2. P	A7TJL1	Ribosome biogenesis protein NSA1	7.36e-07	4.70e-05	NA
2. P	Q9CX97	WD repeat-containing protein 55	2.08e-09	5.44e-05	NA
2. P	Q99J09	Methylosome protein 50	2.22e-16	2.70e-04	NA
2. P	A1L112	WD repeat-containing protein 55	2.12e-09	1.43e-07	NA
2. P	Q9P4X3	Probable U3 small nucleolar RNA-associated protein 7	2.14e-08	3.39e-04	NA
2. P	P0CS40	WD repeat-containing protein JIP5	1.24e-11	3.71e-07	NA
2. P	Q54UI3	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4	4.28e-06	1.62e-02	NA
2. P	P62880	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2	0.00e+00	2.74e-02	NA
2. P	B2ZZS9	WD repeat-containing protein 55	4.70e-11	3.89e-04	NA
2. P	A3LX18	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	3.67e-06	NA
2. P	Q5ZJL7	DNA damage-binding protein 2	8.99e-11	6.40e-04	NA
2. P	A7KAM8	Autophagy-related protein 18	2.65e-07	2.31e-02	NA
2. P	Q9WVA3	Mitotic checkpoint protein BUB3	4.66e-15	4.09e-09	NA
2. P	A1CE98	WD repeat-containing protein jip5	7.85e-09	4.31e-08	NA
2. P	Q99PD4	Actin-related protein 2/3 complex subunit 1A	1.05e-14	1.49e-03	NA
2. P	Q03774	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit TRM82	1.30e-06	1.69e-02	NA
2. P	Q2UPI0	Probable cytosolic iron-sulfur protein assembly protein 1	8.55e-15	7.11e-04	NA
2. P	A5DNM7	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit TRM82	1.22e-06	8.55e-03	NA
2. P	B2TVG3	6-phosphogluconolactonase	2.24e-09	1.59e-02	NA
2. P	P39984	Histone acetyltransferase type B subunit 2	2.00e-15	2.38e-03	NA
2. P	Q9D1M0	Protein SEC13 homolog	1.79e-09	3.60e-02	NA
2. P	P36104	COMPASS component SWD2	0.00e+00	1.50e-13	NA
2. P	B4NER4	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wuho	2.64e-08	5.76e-04	NA
2. P	A7RWD2	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	0.00e+00	9.91e-03	NA
2. P	Q60972	Histone-binding protein RBBP4	2.33e-15	1.23e-02	NA
2. P	Q6L4F8	Guanine nucleotide-binding protein subunit beta-like protein B	0.00e+00	1.84e-02	NA
2. P	B4GDM7	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	2.29e-03	NA
2. P	Q6CRJ7	Protein SWT21	2.09e-08	1.16e-06	NA
2. P	Q5VU92	DDB1- and CUL4-associated factor 12-like protein 1	3.50e-12	3.04e-03	NA
2. P	Q1DPU4	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	1.11e-02	NA
2. P	Q54D08	Protein LST8 homolog	0.00e+00	1.58e-03	NA
2. P	Q6TNS2	p21-activated protein kinase-interacting protein 1-like	1.06e-10	5.55e-06	NA
2. P	O74863	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit trm82	2.05e-12	1.49e-03	NA
2. P	O74340	Protein sof1	1.67e-15	1.21e-09	NA
2. P	Q9UT73	Uncharacterized WD repeat-containing protein C343.17c	3.20e-07	1.52e-07	NA
2. P	P0CS41	WD repeat-containing protein JIP5	8.26e-12	3.71e-07	NA
2. P	Q6FRU4	Autophagy-related protein 21	2.03e-05	4.11e-05	NA
2. P	P38123	COMPASS component SWD3	0.00e+00	7.90e-04	NA
2. P	Q7KWL3	DDB1- and CUL4-associated factor 13	1.89e-15	1.94e-10	NA
2. P	Q13347	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	8.07e-06	NA
2. P	A8X2U9	Putative selenium-binding protein	7.51e-06	4.07e-02	NA
2. P	Q6NY64	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform	3.11e-12	2.00e-02	NA
2. P	Q5B2Q3	WD repeat-containing protein jip5	1.19e-10	4.01e-10	NA
2. P	Q5MNZ6	WD repeat domain phosphoinositide-interacting protein 3	1.03e-12	2.79e-06	NA
2. P	Q5ABA6	Autophagy-related protein 18	4.38e-05	3.57e-03	NA
2. P	A8PWQ8	Probable cytosolic iron-sulfur protein assembly protein 1	3.31e-13	1.06e-02	NA
2. P	Q6FQG2	WD repeat-containing protein JIP5	1.23e-08	1.11e-04	NA
2. P	Q8NA23	WD repeat-containing protein 31	2.22e-16	4.26e-02	NA
2. P	Q9LK38	Selenium-binding protein 3	3.39e-07	3.22e-02	NA
2. P	Q9W415	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wuho	1.75e-12	8.15e-04	NA
2. P	Q9HAD4	WD repeat-containing protein 41	1.48e-09	3.85e-04	NA
2. P	P0CS29	Autophagy-related protein 18	1.39e-07	1.21e-03	NA
2. P	A6T6J6	6-phosphogluconolactonase	1.85e-09	2.02e-02	NA
2. P	Q7ZX64	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform	3.04e-12	4.42e-02	NA
2. P	C5DTN0	Protein SWT21	4.79e-09	8.98e-07	NA
2. P	Q567G2	WD repeat-containing protein 73	6.99e-13	2.23e-02	NA
2. P	P0CS33	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	2.25e-02	NA
2. P	Q3ZCC9	Protein SEC13 homolog	1.89e-09	4.15e-03	NA
2. P	P63150	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform	3.04e-12	5.82e-03	NA
2. P	Q5R4A2	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform	3.30e-08	2.77e-02	NA
2. P	A6RWR8	WD repeat-containing protein jip5	2.98e-10	2.37e-07	NA
2. P	Q4FZW5	Nucleoporin SEH1-A	1.72e-09	1.52e-04	NA
2. P	Q5QJC0	Autophagy-related protein 21	2.41e-10	1.74e-02	NA
2. P	Q9AYE4	Target of rapamycin complex subunit LST8	2.53e-12	1.18e-02	NA
2. P	Q9VIP8	Protein valois	1.53e-10	1.23e-02	NA
2. P	Q5R7R2	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	3.76e-06	NA
2. P	Q292E8	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	1.88e-03	NA
2. P	A7TTC8	Autophagy-related protein 21	4.77e-10	2.69e-06	NA
2. P	Q54BI5	WD repeat-containing protein 53 homolog	3.33e-16	5.26e-05	NA
2. P	B4I195	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	2.83e-03	NA
2. P	Q93454	mRNA export factor rae-1	1.91e-10	4.56e-04	NA
2. P	Q5RF92	Histone-binding protein RBBP4	2.97e-11	8.55e-03	NA
2. P	Q4R8L3	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform	1.42e-11	2.77e-02	NA
2. P	Q5E966	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	6.47e-06	NA
2. P	B0W8M5	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wuho	1.88e-09	3.01e-03	NA
2. P	P42841	Polyadenylation factor subunit 2	7.00e-12	5.76e-04	NA
2. P	Q03010	Transcriptional regulatory protein UME1	1.43e-08	7.73e-04	NA
2. P	Q5E9I7	Methylosome protein 50	2.22e-16	1.54e-03	NA
2. P	Q6CLZ2	Autophagy-related protein 21	2.11e-06	6.58e-05	NA
2. P	Q3KQ62	WD repeat domain-containing protein 83	0.00e+00	1.91e-07	NA
2. P	O15143	Actin-related protein 2/3 complex subunit 1B	7.99e-15	1.11e-02	NA
2. P	Q9Z1Z2	Serine-threonine kinase receptor-associated protein	1.72e-10	4.80e-09	NA
2. P	Q6TGU2	Nucleoporin SEH1	1.05e-09	4.11e-03	NA
2. P	Q6NV31	WD repeat-containing protein 82	0.00e+00	4.14e-07	NA
2. P	P62879	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2	0.00e+00	2.74e-02	NA
2. P	O14021	RbAp48-related WD40 repeat-containing protein prw1	8.22e-15	3.20e-03	NA
2. P	Q6CP71	Polyadenylation factor subunit 2	1.68e-11	6.32e-06	NA
2. P	P39706	COMPASS component SWD1	1.22e-11	3.53e-09	NA
2. P	O22468	WD-40 repeat-containing protein MSI2	2.11e-15	7.34e-04	NA
2. P	O42858	Set1 complex component swd1	4.01e-11	9.06e-10	NA
2. P	B0D442	WD repeat-containing protein JIP5	2.97e-10	1.73e-04	NA
2. P	Q58D06	WD repeat-containing protein 74	5.55e-10	4.99e-06	NA
2. P	A2QEV8	Eukaryotic translation initiation factor 3 subunit I	3.33e-16	4.81e-02	NA
2. P	Q9FFA7	WD repeat-containing protein RUP2	1.11e-15	2.91e-04	NA
2. P	Q4R7Z4	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform	2.72e-12	5.82e-03	NA
2. P	Q38821	Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform	8.45e-06	2.46e-03	NA
2. P	Q5EBE8	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	1.14e-03	NA
2. P	Q5AI86	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	5.76e-05	NA
2. P	P93397	Guanine nucleotide-binding protein subunit beta-1	0.00e+00	1.11e-02	NA
2. P	Q6PH57	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	0.00e+00	2.16e-02	NA
2. P	A7TH93	WD repeat-containing protein JIP5	1.37e-06	8.07e-03	NA
2. P	B5FZ19	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	5.07e-04	NA
2. P	Q7ZXD5	Actin-related protein 2/3 complex subunit 1B-A	6.33e-15	2.05e-03	NA
2. P	Q9Y3F4	Serine-threonine kinase receptor-associated protein	2.77e-10	6.44e-09	NA
2. P	O00628	Peroxisomal targeting signal 2 receptor	0.00e+00	4.47e-02	NA
2. P	Q5RBZ2	Methylosome protein 50	4.44e-16	3.17e-05	NA
2. P	B3N4C7	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	5.07e-03	NA
2. P	P33750	Protein SOF1	1.74e-14	2.11e-09	NA
2. P	Q5E9Q7	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform	1.46e-11	2.77e-02	NA
2. P	P29387	Guanine nucleotide-binding protein subunit beta-4	0.00e+00	4.92e-03	NA
2. P	Q5BIM8	DNA excision repair protein ERCC-8	9.91e-12	6.86e-12	NA
2. P	Q0V786	WD repeat-containing protein JIP5	1.16e-08	6.42e-08	NA
2. P	Q09309	Retinoblastoma-binding protein homolog 5	1.49e-09	1.61e-02	NA
2. P	B4QFZ8	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	3.43e-03	NA
2. P	B4PYR0	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wuho	6.74e-07	6.06e-03	NA
2. P	Q0U2J8	Autophagy-related protein 18	3.81e-10	1.24e-02	NA
2. P	B4JB43	Eukaryotic translation initiation factor 3 subunit I	0.00e+00	1.61e-04	NA
2. P	Q6AY57	WD repeat domain phosphoinositide-interacting protein 2	8.12e-07	1.01e-03	NA
2. P	P11017	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2	0.00e+00	2.74e-02	NA
2. P	B4P7Q3	Probable cytosolic iron-sulfur protein assembly protein Ciao1	0.00e+00	1.52e-03	NA
2. P	Q9USR0	DNA excision repair protein ckn1	3.36e-12	1.43e-14	NA
2. P	Q8X1F5	Autophagy-related protein 18	NA	1.35e-02	NA
2. P	Q9UQ03	Coronin-2B	3.37e-09	3.79e-03	NA
2. P	Q640J6	WD repeat-containing protein 82-A	0.00e+00	9.18e-10	NA
2. P	Q6NVS5	DDB1- and CUL4-associated factor 13	2.33e-15	1.42e-09	NA
2. P	A7EW77	Autophagy-related protein 18	7.64e-10	3.64e-03	NA
2. P	P53851	Protein TEX1	4.67e-10	1.04e-07	NA
2. P	Q6GNU1	Actin-related protein 2/3 complex subunit 1B-B	6.11e-15	5.58e-04	NA
2. P	O80856	Actin-related protein 2/3 complex subunit 1A	1.80e-14	2.53e-04	NA
2. P	Q6AY87	THO complex subunit 6 homolog	1.14e-10	4.38e-02	NA
2. P	O45040	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1	0.00e+00	2.72e-03	NA
2. P	Q23232	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit	2.26e-09	2.37e-04	NA
2. P	B3LGB9	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit TRM82	1.09e-06	9.07e-03	NA
3. B	Q1DX43	Protein transport protein SEC31	3.47e-05	NA	0.001
3. B	Q8YRI1	Uncharacterized WD repeat-containing protein alr3466	2.03e-04	NA	0.013
3. B	O42469	Transducin-like enhancer protein 1	2.90e-11	NA	0.047
3. B	Q8VEJ4	Notchless protein homolog 1	2.21e-09	NA	0.037
3. B	Q99KP6	Pre-mRNA-processing factor 19	9.66e-15	NA	0.030
3. B	O75529	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L	1.75e-08	NA	6.26e-04
3. B	Q54Z22	Nuclear pore complex protein nup43	2.37e-13	NA	3.61e-04
3. B	Q7ZX22	GATOR complex protein WDR24	1.65e-07	NA	0.011
3. B	O36030	Uncharacterized WD repeat-containing protein C4F10.18	1.11e-13	NA	7.07e-04
3. B	Q5EB92	WD repeat-containing protein 70	4.72e-05	NA	0.002
3. B	A1L271	Guanine nucleotide-binding protein subunit beta-5a	1.11e-16	NA	0.047
3. B	Q8SRK1	Histone acetyltransferase type B subunit 2	1.22e-15	NA	0.001
3. B	Q8RXU6	WD repeat-containing protein PCN	6.94e-05	NA	0.003
3. B	Q4WEI5	Histone acetyltransferase type B subunit 2	6.11e-15	NA	1.53e-07
3. B	Q5ZMV9	GATOR complex protein WDR24	9.27e-06	NA	0.004
3. B	A5E6M3	Restriction of telomere capping protein 1	1.38e-04	NA	1.37e-04
3. B	P0CS49	Pre-mRNA-splicing factor PRP46	3.63e-14	NA	0.004
3. B	Q10051	Pre-mRNA-processing factor 19	2.66e-15	NA	7.11e-04
3. B	P61964	WD repeat-containing protein 5	0.00e+00	NA	0.016
3. B	O74855	Ribosome assembly protein 4	7.67e-14	NA	1.02e-04
3. B	P74442	Uncharacterized WD repeat-containing protein slr0143	1.60e-08	NA	0.009
3. B	O14053	U3 small nucleolar RNA-associated protein 21 homolog	6.55e-07	NA	0.003
3. B	Q6C7Q4	Histone acetyltransferase type B subunit 2	7.22e-15	NA	0.010
3. B	O94244	Histone acetyltransferase type B subunit 2	3.33e-15	NA	0.001
3. B	P0CS47	Polyadenylation factor subunit 2	7.75e-09	NA	0.038
3. B	Q7ZXZ2	U3 small nucleolar RNA-associated protein 15 homolog	5.54e-12	NA	0.004
3. B	Q96DI7	U5 small nuclear ribonucleoprotein 40 kDa protein	3.33e-16	NA	0.004
3. B	O14435	Guanine nucleotide-binding protein subunit beta	0.00e+00	NA	0.015
3. B	F4KB17	Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.3	4.07e-06	NA	0.003
3. B	Q2UA71	Histone acetyltransferase type B subunit 2	4.00e-15	NA	1.12e-06
3. B	A7MB12	U3 small nucleolar RNA-associated protein 15 homolog	1.42e-11	NA	0.008
3. B	Q6NX08	Ribosome biogenesis protein wdr12	1.35e-14	NA	0.034
3. B	Q9BVA0	Katanin p80 WD40 repeat-containing subunit B1	5.23e-09	NA	3.07e-04
3. B	Q80ZD0	Guanine nucleotide-binding protein subunit beta-5	1.11e-16	NA	0.003
3. B	P62881	Guanine nucleotide-binding protein subunit beta-5	4.44e-16	NA	0.003
3. B	A0A1P8AW69	Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.1	1.61e-05	NA	0.006
3. B	Q75BY3	Pre-mRNA-splicing factor PRP46	5.11e-15	NA	0.011
3. B	Q05946	U3 small nucleolar RNA-associated protein 13	1.71e-05	NA	0.018
3. B	P87141	Target of rapamycin complex 1 subunit mip1	4.29e-07	NA	0.020
3. B	C4YN69	Restriction of telomere capping protein 1	8.27e-05	NA	4.95e-04
3. B	Q91WQ5	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L	1.68e-08	NA	4.69e-04
3. B	Q2GVT8	Protein transport protein SEC31	2.57e-05	NA	0.001
3. B	Q6P2Y2	Dynein assembly factor with WDR repeat domains 1	9.66e-12	NA	0.005
3. B	Q0CYG9	Protein transport protein sec31	3.02e-04	NA	0.015
3. B	Q7T0P4	POC1 centriolar protein homolog A	2.64e-12	NA	0.002
3. B	P79147	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3	0.00e+00	NA	0.005
3. B	Q5AZM3	Protein transport protein sec31	3.69e-04	NA	3.98e-04
3. B	P40968	Pre-mRNA-processing factor 17	9.21e-15	NA	0.033
3. B	A8NEG8	Nuclear distribution protein PAC1	1.11e-16	NA	0.001
3. B	Q5ZMA2	Pre-mRNA-processing factor 19	7.87e-14	NA	0.015
3. B	Q6S7B0	Transcription initiation factor TFIID subunit 5	5.42e-08	NA	0.017
3. B	P49695	Probable serine/threonine-protein kinase PkwA	7.01e-12	NA	1.90e-06
3. B	P38968	Protein transport protein SEC31	9.18e-05	NA	5.43e-06
3. B	A5DTX3	Protein transport protein SEC31	5.73e-06	NA	2.21e-04
3. B	A8X8C6	WD repeat-containing protein tag-125	0.00e+00	NA	0.032
3. B	O74319	Transcription initiation factor TFIID subunit taf73	1.78e-08	NA	0.006
3. B	Q39190	Protein pleiotropic regulator PRL2	7.86e-14	NA	0.002
3. B	Q8NFH3	Nucleoporin Nup43	1.74e-07	NA	2.30e-04
3. B	P0CS48	Pre-mRNA-splicing factor PRP46	3.49e-14	NA	0.005
3. B	P61965	WD repeat-containing protein 5	0.00e+00	NA	0.016
3. B	Q8NHY2	E3 ubiquitin-protein ligase COP1	3.61e-12	NA	0.038
3. B	B9WN49	Restriction of telomere capping protein 1	7.17e-05	NA	0.002
3. B	Q8YV57	Uncharacterized WD repeat-containing protein all2124	5.12e-07	NA	0.049
3. B	Q7ZVL2	GATOR complex protein WDR24	3.73e-06	NA	0.004
3. B	Q498M4	WD repeat-containing protein 5	0.00e+00	NA	0.016
3. B	Q5M786	WD repeat-containing protein 5	0.00e+00	NA	0.018
3. B	Q80ZK9	WD and tetratricopeptide repeats protein 1	2.00e-05	NA	0.001
3. B	A3LNI7	Nuclear distribution protein PAC1	1.84e-08	NA	0.045
3. B	Q96MR6	Cilia- and flagella-associated protein 57	4.84e-04	NA	0.014
3. B	F6ZT52	POC1 centriolar protein homolog B	4.83e-10	NA	0.018
3. B	Q8K4P0	pre-mRNA 3' end processing protein WDR33	1.10e-05	NA	0.007
3. B	Q8CFJ9	GATOR complex protein WDR24	2.19e-06	NA	0.004
3. B	Q8TC44	POC1 centriolar protein homolog B	2.17e-11	NA	0.007
3. B	Q54KL5	WD repeat-containing protein 5 homolog	0.00e+00	NA	8.97e-04
3. B	Q3TWF6	WD repeat-containing protein 70	6.50e-05	NA	0.008
3. B	B3RNR8	Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog	0.00e+00	NA	0.012
3. B	P25635	Periodic tryptophan protein 2	1.35e-05	NA	0.015
3. B	A4RD35	Protein transport protein SEC31	3.11e-05	NA	0.010
3. B	Q8IZU2	WD repeat-containing protein 17	1.32e-04	NA	0.012
3. B	Q58D20	Notchless protein homolog 1	1.73e-09	NA	0.024
3. B	Q00808	Vegetative incompatibility protein HET-E-1	4.68e-06	NA	0.002
3. B	Q5ACL4	Restriction of telomere capping protein 1	6.94e-05	NA	4.90e-04
3. B	A1C6X5	Protein transport protein sec31	3.06e-04	NA	0.004
3. B	Q28DW0	Probable cytosolic iron-sulfur protein assembly protein ciao1	0.00e+00	NA	0.002
3. B	A5DB75	Protein transport protein SEC31	7.18e-05	NA	3.56e-07
3. B	Q04225	Ribosome assembly protein RRB1	5.52e-09	NA	6.51e-04
3. B	Q7ZVF0	POC1 centriolar protein homolog A	2.24e-10	NA	0.003
3. B	Q9FUY2	Transcriptional corepressor LEUNIG	7.75e-10	NA	0.010
3. B	Q8BHD1	POC1 centriolar protein homolog B	1.42e-11	NA	0.044
3. B	Q8H0T9	Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.4	6.09e-06	NA	0.016
3. B	A2RRU3	U3 small nucleolar RNA-associated protein 15 homolog	1.42e-11	NA	0.033
3. B	Q6NVM2	Katanin p80 WD40 repeat-containing subunit B1	6.58e-09	NA	4.42e-04
3. B	Q4V7Y7	Katanin p80 WD40 repeat-containing subunit B1	1.03e-08	NA	3.23e-04
3. B	P62882	Guanine nucleotide-binding protein subunit beta-5	1.11e-16	NA	0.002
3. B	Q5RD06	POC1 centriolar protein homolog B	1.08e-09	NA	0.002
3. B	Q5ZIU8	Katanin p80 WD40 repeat-containing subunit B1	2.91e-09	NA	5.70e-04
3. B	Q7TNG5	Echinoderm microtubule-associated protein-like 2	5.37e-06	NA	0.037
3. B	F4HTH8	Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.2	9.05e-06	NA	0.019
3. B	Q8TED0	U3 small nucleolar RNA-associated protein 15 homolog	9.70e-12	NA	0.010
3. B	P43254	E3 ubiquitin-protein ligase COP1	9.32e-12	NA	0.027
3. B	P0CS46	Polyadenylation factor subunit 2	8.11e-09	NA	0.036
3. B	Q9JMJ4	Pre-mRNA-processing factor 19	9.55e-15	NA	0.030
3. B	D3ZW91	POC1 centriolar protein homolog B	7.37e-12	NA	0.013
3. B	A3GFK8	Protein transport protein SEC31	7.09e-05	NA	9.38e-05
3. B	P13712	Chromatin assembly factor 1 subunit p50	5.55e-16	NA	0.019
3. B	P59235	Nucleoporin Nup43	3.45e-07	NA	1.30e-04
3. B	Q9C0J8	pre-mRNA 3' end processing protein WDR33	1.15e-05	NA	0.007
3. B	Q9EPV5	Apoptotic protease-activating factor 1	1.57e-06	NA	0.020
3. B	Q4V7Z1	POC1 centriolar protein homolog B	3.27e-12	NA	0.008
3. B	Q6NLV4	Flowering time control protein FY	1.25e-09	NA	0.020
3. B	O61585	Katanin p80 WD40 repeat-containing subunit B1	1.65e-08	NA	1.59e-08
3. B	Q6BRR2	Protein transport protein SEC31	6.63e-05	NA	1.32e-04
3. B	Q5S580	Protein transport protein SEC31	3.91e-05	NA	5.03e-04
3. B	Q5AAU3	Protein transport protein SEC31	8.32e-05	NA	0.001
3. B	P0CS37	Histone acetyltransferase type B subunit 2	2.55e-15	NA	2.39e-05
3. B	P46800	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	NA	0.001
3. B	Q61011	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3	0.00e+00	NA	0.004
3. B	Q5RDY7	Guanine nucleotide-binding protein subunit beta-5	1.11e-16	NA	0.003
3. B	Q6CKE8	Pre-mRNA-splicing factor PRP46	5.66e-15	NA	0.018
3. B	P20053	U4/U6 small nuclear ribonucleoprotein PRP4	2.22e-16	NA	3.52e-07
3. B	Q4I7L0	Histone acetyltransferase type B subunit 2	4.55e-15	NA	0.001
3. B	Q28I85	POC1 centriolar protein homolog A	9.07e-12	NA	0.020
3. B	O14775	Guanine nucleotide-binding protein subunit beta-5	5.55e-16	NA	0.003
3. B	Q5RF51	U5 small nuclear ribonucleoprotein 40 kDa protein	2.22e-16	NA	0.006
3. B	P25382	Ribosome assembly protein 4	1.02e-12	NA	0.007
3. B	Q8BG40	Katanin p80 WD40 repeat-containing subunit B1	2.94e-09	NA	2.69e-04
3. B	Q6PBY0	Guanine nucleotide-binding protein subunit beta-5b	3.33e-16	NA	0.017
3. B	A9V790	Lissencephaly-1 homolog	0.00e+00	NA	0.005
3. B	Q5FWQ6	Dynein assembly factor with WDR repeat domains 1	3.22e-15	NA	0.038
3. B	Q8N5D0	WD and tetratricopeptide repeats protein 1	1.76e-05	NA	0.001
3. B	Q9SY00	COMPASS-like H3K4 histone methylase component WDR5B	0.00e+00	NA	1.43e-04
3. B	Q55CT5	Protein transport protein SEC31	4.57e-05	NA	0.003
3. B	Q7ZUV2	Katanin p80 WD40 repeat-containing subunit B1	9.23e-09	NA	2.51e-04
3. B	Q6C709	Pre-mRNA-splicing factor PRP46	1.61e-14	NA	0.009
3. B	Q8SRB0	Guanine nucleotide-binding protein subunit beta-like protein	1.11e-16	NA	0.008
3. B	Q9UMS4	Pre-mRNA-processing factor 19	6.00e-15	NA	0.009
3. B	Q8C7V3	U3 small nucleolar RNA-associated protein 15 homolog	1.01e-10	NA	0.046
3. B	Q96S15	GATOR complex protein WDR24	2.13e-07	NA	0.007
3. B	Q6PNB6	Guanine nucleotide-binding protein subunit beta-5	1.11e-16	NA	0.003
3. B	P52287	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3	0.00e+00	NA	0.004
3. B	P16520	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3	0.00e+00	NA	0.004
3. B	Q9R1A8	E3 ubiquitin-protein ligase COP1	4.40e-12	NA	0.033
3. B	Q6PE01	U5 small nuclear ribonucleoprotein 40 kDa protein	2.22e-16	NA	0.010
3. B	Q5REE0	U3 small nucleolar RNA-associated protein 15 homolog	1.12e-11	NA	0.012
3. B	P87053	F-box/WD repeat-containing protein pof1	5.11e-09	NA	0.048
3. B	A2CEH0	POC1 centriolar protein homolog B	1.89e-11	NA	0.002
3. B	P38011	Guanine nucleotide-binding protein subunit beta-like protein	0.00e+00	NA	0.010
3. B	Q2KIG2	WD repeat-containing protein 5	0.00e+00	NA	0.015
3. B	Q54JS5	GATOR complex protein WDR24	1.94e-06	NA	0.012
3. B	P0CS36	Histone acetyltransferase type B subunit 2	2.00e-15	NA	2.39e-05
3. B	Q20636	Guanine nucleotide-binding protein subunit beta-2	1.11e-16	NA	0.009
3. B	Q94BQ3	Protein ALTERED SEED GERMINATION 2	4.53e-04	NA	0.034
3. B	Q2HJH6	U5 small nuclear ribonucleoprotein 40 kDa protein	2.22e-16	NA	0.007
3. B	Q08E38	Pre-mRNA-processing factor 19	7.99e-15	NA	0.027