Results | PROST

Summary

Q96FV0

Homolog: Q6AXZ2.
Function: Leucine-rich repeat-containing protein 46.

Statistics

Total GO Annotation: 305
Unique PROST Go: 119
Unique BLAST Go: 119

Total Homologs: 254
Unique PROST Homologs: 113
Unique BLAST Homologs: 98

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q6AXZ2 (Leucine-rich repeat-containing protein 46) with a FATCAT P-Value: 2e-15 and RMSD of 3.12 angstrom. The sequence alignment identity is 71.3%.
Structural alignment shown in left. Query protein Q96FV0 colored as red in alignment, homolog Q6AXZ2 colored as blue. Query protein Q96FV0 is also shown in right top, homolog Q6AXZ2 showed in right bottom. They are colored based on secondary structures.

  Q96FV0 MSG----GKSA-QGPEEGGVCITEALITKRNLTFPEDGELSEKMFHTLDELQTVRLDREGITTIRNLEGLQNLHSLYLQGNKIQQIENLACIPSLRFLSL 95
  Q6AXZ2 MPGDKQEAKNATQKTEE-GVHITEALITKRNLTFPEDEDLSEKMFHTLDDLETVRLDGEGITCIGNLERLRNIHSLYLQSNKIQRIENLACITSLRFLSL 99

  Q96FV0 AGNQIRQVENLLDLPCLQFLDLSENLIETLKLDEFPQSLLILNLSGNSCTNQDGYRELVTEALPLLLDLDGQPVVERWISDEEDEASSD--EEFPELSGP 193
  Q6AXZ2 AGNQIRHVENLLDLQYLQFLDLSENLIETLKLDELPQSLLILNLCGNPCTNQDGYRKMVIGALPLLLDLDKQPILERWTSDEEDK-SSDEEEEFPELNGP 198

  Q96FV0 FCSERGFLKELEQELSRHREHRQQTALTEHLLRMEMQPTLTDLPLLPGVPMAGDSSPSATPAQGEETVPEAVSSPQASSPTKKPCSLIPRGHQSSFWGRK 293
  Q6AXZ2 FCAERGFFKDLEQELHQHQERRQQAALTEHLSRMETQPVLTDLPLLPAVPMAGDCSPAVTEEPGKEAAPKATSSTQMASSSKKQ---VPRNQKGSVQARK 295

  Q96FV0 GARAATAPKASVAEAPSTTKTTAKRSKK 321
  Q6AXZ2 GALAATASKTSLAAAPSMTKSTNKRGTK 323

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
1. PB	GO:0098978	glutamatergic synapse
1. PB	GO:0009994	oocyte differentiation
1. PB	GO:0035082	axoneme assembly
1. PB	GO:0005815	microtubule organizing center
1. PB	GO:0051963	regulation of synapse assembly
1. PB	GO:0008528	G protein-coupled peptide receptor activity
1. PB	GO:2001013	epithelial cell proliferation involved in renal tubule morphogenesis
1. PB	GO:0003341	cilium movement
1. PB	GO:0097113	AMPA glutamate receptor clustering
1. PB	GO:0003305	cell migration involved in heart jogging
1. PB	GO:0070286	axonemal dynein complex assembly
1. PB	GO:0003314	heart rudiment morphogenesis
1. PB	GO:0071910	determination of liver left/right asymmetry
1. PB	GO:0036158	outer dynein arm assembly
1. PB	GO:0010921	regulation of phosphatase activity
1. PB	GO:0030324	lung development
1. PB	GO:0042769	obsolete DNA damage response, detection of DNA damage
1. PB	GO:0010378	temperature compensation of the circadian clock
1. PB	GO:1903818	positive regulation of voltage-gated potassium channel activity
1. PB	GO:0032281	AMPA glutamate receptor complex
1. PB	GO:0060271	cilium assembly
1. PB	GO:0090263	positive regulation of canonical Wnt signaling pathway
1. PB	GO:0001947	heart looping
1. PB	GO:2000155	positive regulation of cilium-dependent cell motility
1. PB	GO:0070840	dynein complex binding
1. PB	GO:0060285	cilium-dependent cell motility
1. PB	GO:0031514	motile cilium
1. PB	GO:0002224	toll-like receptor signaling pathway
1. PB	GO:0051965	positive regulation of synapse assembly
1. PB	GO:0060972	left/right pattern formation
1. PB	GO:0000389	mRNA 3'-splice site recognition
1. PB	GO:1901629	regulation of presynaptic membrane organization
1. PB	GO:0003356	regulation of cilium beat frequency
1. PB	GO:0045433	male courtship behavior, veined wing generated song production
1. PB	GO:0005813	centrosome
1. PB	GO:0002177	manchette
1. PB	GO:0015630	microtubule cytoskeleton
1. PB	GO:0009755	hormone-mediated signaling pathway
1. PB	GO:0030030	cell projection organization
1. PB	GO:0036159	inner dynein arm assembly
1. PB	GO:0071907	determination of digestive tract left/right asymmetry
1. PB	GO:0006913	nucleocytoplasmic transport
1. PB	GO:0031012	extracellular matrix
1. PB	GO:0008201	heparin binding
1. PB	GO:0044458	motile cilium assembly
1. PB	GO:0003779	actin binding
1. PB	GO:0007190	activation of adenylate cyclase activity
1. PB	GO:0040022	feminization of hermaphroditic germ-line
1. PB	GO:0036064	ciliary basal body
1. PB	GO:0016500	protein-hormone receptor activity
1. PB	GO:0072578	neurotransmitter-gated ion channel clustering
1. PB	GO:0004888	transmembrane signaling receptor activity
1. PB	GO:0005929	cilium
1. PB	GO:0005930	axoneme
1. PB	GO:0032588	trans-Golgi network membrane
1. PB	GO:0035469	determination of pancreatic left/right asymmetry
1. PB	GO:0015631	tubulin binding
1. PB	GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway
1. PB	GO:0048495	Roundabout binding
1. PB	GO:0030620	U2 snRNA binding
1. PB	GO:0043395	heparan sulfate proteoglycan binding
1. PB	GO:0003146	heart jogging
1. PB	GO:0005615	extracellular space
1. PB	GO:0051729	germline cell cycle switching, mitotic to meiotic cell cycle
1. PB	GO:0099061	integral component of postsynaptic density membrane
1. PB	GO:1901224	positive regulation of NIK/NF-kappaB signaling
1. PB	GO:0050808	synapse organization
2. P	GO:0050772	positive regulation of axonogenesis
2. P	GO:0016055	Wnt signaling pathway
2. P	GO:0043198	dendritic shaft
2. P	GO:0038131	neuregulin receptor activity
2. P	GO:0032922	circadian regulation of gene expression
2. P	GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules
2. P	GO:0005686	U2 snRNP
2. P	GO:0045121	membrane raft
2. P	GO:0048874	host-mediated regulation of intestinal microbiota composition
2. P	GO:0030539	male genitalia development
2. P	GO:0007409	axonogenesis
2. P	GO:0085032	modulation by symbiont of host I-kappaB kinase/NF-kappaB cascade
2. P	GO:0030517	negative regulation of axon extension
2. P	GO:0043069	negative regulation of programmed cell death
2. P	GO:0015459	potassium channel regulator activity
2. P	GO:0044877	protein-containing complex binding
2. P	GO:0099054	presynapse assembly
2. P	GO:0042127	regulation of cell population proliferation
2. P	GO:0035025	positive regulation of Rho protein signal transduction
2. P	GO:0004842	ubiquitin-protein transferase activity
2. P	GO:0008330	protein tyrosine/threonine phosphatase activity
2. P	GO:0046849	bone remodeling
2. P	GO:1990030	pericellular basket
2. P	GO:0001942	hair follicle development
2. P	GO:0007165	signal transduction
2. P	GO:0050919	negative chemotaxis
2. P	GO:1901381	positive regulation of potassium ion transmembrane transport
2. P	GO:0072282	metanephric nephron tubule morphogenesis
2. P	GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules
2. P	GO:0007420	brain development
2. P	GO:0052083	suppression by symbiont of host cell-mediated immune response
2. P	GO:0010977	negative regulation of neuron projection development
2. P	GO:0030318	melanocyte differentiation
2. P	GO:0001750	photoreceptor outer segment
2. P	GO:0046822	regulation of nucleocytoplasmic transport
2. P	GO:0106030	neuron projection fasciculation
2. P	GO:0008076	voltage-gated potassium channel complex
2. P	GO:1990523	bone regeneration
2. P	GO:1990723	cytoplasmic periphery of the nuclear pore complex
2. P	GO:0007283	spermatogenesis
2. P	GO:0098793	presynapse
2. P	GO:0043025	neuronal cell body
2. P	GO:0038023	signaling receptor activity
2. P	GO:0044164	host cell cytosol
2. P	GO:1905573	ganglioside GM1 binding
2. P	GO:0005783	endoplasmic reticulum
2. P	GO:0071005	U2-type precatalytic spliceosome
2. P	GO:0001649	osteoblast differentiation
2. P	GO:0048565	digestive tract development
2. P	GO:1905576	ganglioside GT1b binding
2. P	GO:0071013	catalytic step 2 spliceosome
2. P	GO:0120163	negative regulation of cold-induced thermogenesis
2. P	GO:1905232	cellular response to L-glutamate
2. P	GO:0030282	bone mineralization
2. P	GO:0022038	corpus callosum development
2. P	GO:0044074	negative regulation by symbiont of host translation
2. P	GO:0048839	inner ear development
2. P	GO:0043547	positive regulation of GTPase activity
2. P	GO:0007411	axon guidance
2. P	GO:0034122	negative regulation of toll-like receptor signaling pathway
2. P	GO:0030177	positive regulation of Wnt signaling pathway
2. P	GO:1902004	positive regulation of amyloid-beta formation
2. P	GO:0021888	hypothalamus gonadotrophin-releasing hormone neuron development
2. P	GO:0044314	protein K27-linked ubiquitination
2. P	GO:0044295	axonal growth cone
2. P	GO:0005887	integral component of plasma membrane
2. P	GO:0016363	nuclear matrix
2. P	GO:0051865	protein autoubiquitination
2. P	GO:0043486	histone exchange
2. P	GO:0071014	post-mRNA release spliceosomal complex
2. P	GO:0010165	response to X-ray
2. P	GO:0030425	dendrite
2. P	GO:0090190	positive regulation of branching involved in ureteric bud morphogenesis
2. P	GO:0097733	photoreceptor cell cilium
2. P	GO:0007166	cell surface receptor signaling pathway
2. P	GO:0016604	nuclear body
2. P	GO:0046826	negative regulation of protein export from nucleus
2. P	GO:0007010	cytoskeleton organization
2. P	GO:0072202	cell differentiation involved in metanephros development
2. P	GO:0019212	phosphatase inhibitor activity
2. P	GO:0043204	perikaryon
2. P	GO:0001817	regulation of cytokine production
2. P	GO:0007155	cell adhesion
2. P	GO:0072224	metanephric glomerulus development
2. P	GO:0005681	spliceosomal complex
2. P	GO:0071004	U2-type prespliceosome
2. P	GO:0023041	neuronal signal transduction
2. P	GO:0038008	TRAF-mediated signal transduction
2. P	GO:0031362	anchored component of external side of plasma membrane
2. P	GO:0042393	histone binding
2. P	GO:0048471	perinuclear region of cytoplasm
2. P	GO:0000398	mRNA splicing, via spliceosome
2. P	GO:0052170	suppression by symbiont of host innate immune response
2. P	GO:0048681	negative regulation of axon regeneration
2. P	GO:0042981	regulation of apoptotic process
2. P	GO:0032391	photoreceptor connecting cilium
2. P	GO:0046579	positive regulation of Ras protein signal transduction
2. P	GO:0030532	small nuclear ribonucleoprotein complex
2. P	GO:0071007	U2-type catalytic step 2 spliceosome
2. P	GO:0000812	Swr1 complex
2. P	GO:0031102	neuron projection regeneration
2. P	GO:0061290	canonical Wnt signaling pathway involved in metanephric kidney development
2. P	GO:0007186	G protein-coupled receptor signaling pathway
2. P	GO:0032809	neuronal cell body membrane
2. P	GO:0007413	axonal fasciculation
2. P	GO:0042552	myelination
2. P	GO:0050673	epithelial cell proliferation
2. P	GO:0001818	negative regulation of cytokine production
2. P	GO:0007224	smoothened signaling pathway
2. P	GO:0042645	mitochondrial nucleoid
2. P	GO:0048683	regulation of collateral sprouting of intact axon in response to injury
2. P	GO:0050727	regulation of inflammatory response
2. P	GO:0036335	intestinal stem cell homeostasis
2. P	GO:0035374	chondroitin sulfate binding
2. P	GO:1904117	cellular response to vasopressin
2. P	GO:0035239	tube morphogenesis
2. P	GO:0010976	positive regulation of neuron projection development
2. P	GO:0005635	nuclear envelope
2. P	GO:0005654	nucleoplasm
3. B	GO:1901970	positive regulation of mitotic sister chromatid separation
3. B	GO:0005874	microtubule
3. B	GO:0035904	aorta development
3. B	GO:0032755	positive regulation of interleukin-6 production
3. B	GO:0044409	entry into host
3. B	GO:0003351	epithelial cilium movement involved in extracellular fluid movement
3. B	GO:0055037	recycling endosome
3. B	GO:0035307	positive regulation of protein dephosphorylation
3. B	GO:0034451	centriolar satellite
3. B	GO:0060026	convergent extension
3. B	GO:0045171	intercellular bridge
3. B	GO:0007605	sensory perception of sound
3. B	GO:0042567	insulin-like growth factor ternary complex
3. B	GO:0005576	extracellular region
3. B	GO:0032729	positive regulation of interferon-gamma production
3. B	GO:0061809	NAD+ nucleotidase, cyclic ADP-ribose generating
3. B	GO:0072542	protein phosphatase activator activity
3. B	GO:1901673	regulation of mitotic spindle assembly
3. B	GO:1902018	negative regulation of cilium assembly
3. B	GO:0090543	Flemming body
3. B	GO:0120103	centriolar subdistal appendage
3. B	GO:0120293	dynein axonemal particle
3. B	GO:0032228	regulation of synaptic transmission, GABAergic
3. B	GO:0097431	mitotic spindle pole
3. B	GO:0004663	Rab geranylgeranyltransferase activity
3. B	GO:0045504	dynein heavy chain binding
3. B	GO:0007268	chemical synaptic transmission
3. B	GO:0007059	chromosome segregation
3. B	GO:0071378	cellular response to growth hormone stimulus
3. B	GO:0048132	female germ-line stem cell asymmetric division
3. B	GO:0030336	negative regulation of cell migration
3. B	GO:0005524	ATP binding
3. B	GO:0071260	cellular response to mechanical stimulus
3. B	GO:0036157	outer dynein arm
3. B	GO:0042995	cell projection
3. B	GO:0060384	innervation
3. B	GO:0048793	pronephros development
3. B	GO:0008217	regulation of blood pressure
3. B	GO:0030036	actin cytoskeleton organization
3. B	GO:0022405	hair cycle process
3. B	GO:0004385	guanylate kinase activity
3. B	GO:0005520	insulin-like growth factor binding
3. B	GO:0035091	phosphatidylinositol binding
3. B	GO:0060287	epithelial cilium movement involved in determination of left/right asymmetry
3. B	GO:0055028	cortical microtubule
3. B	GO:0032728	positive regulation of interferon-beta production
3. B	GO:0120229	protein localization to motile cilium
3. B	GO:0042622	photoreceptor outer segment membrane
3. B	GO:1905606	regulation of presynapse assembly
3. B	GO:0090619	meiotic spindle pole
3. B	GO:0010102	lateral root morphogenesis
3. B	GO:0051649	establishment of localization in cell
3. B	GO:1905710	positive regulation of membrane permeability
3. B	GO:0032722	positive regulation of chemokine production
3. B	GO:0034154	toll-like receptor 7 signaling pathway
3. B	GO:0046600	negative regulation of centriole replication
3. B	GO:0060976	coronary vasculature development
3. B	GO:0003727	single-stranded RNA binding
3. B	GO:0001917	photoreceptor inner segment
3. B	GO:0099104	potassium channel activator activity
3. B	GO:0003402	planar cell polarity pathway involved in axis elongation
3. B	GO:0090651	apical cytoplasm
3. B	GO:0002064	epithelial cell development
3. B	GO:0099560	synaptic membrane adhesion
3. B	GO:0035150	regulation of tube size
3. B	GO:0035197	siRNA binding
3. B	GO:0009574	preprophase band
3. B	GO:0061512	protein localization to cilium
3. B	GO:0038187	pattern recognition receptor activity
3. B	GO:0032727	positive regulation of interferon-alpha production
3. B	GO:0007249	I-kappaB kinase/NF-kappaB signaling
3. B	GO:0071559	response to transforming growth factor beta
3. B	GO:0090660	cerebrospinal fluid circulation
3. B	GO:0034178	toll-like receptor 13 signaling pathway
3. B	GO:0035996	rhabdomere microvillus
3. B	GO:0016601	Rac protein signal transduction
3. B	GO:0005178	integrin binding
3. B	GO:0016028	rhabdomere
3. B	GO:0050135	NAD(P)+ nucleosidase activity
3. B	GO:0019888	protein phosphatase regulator activity
3. B	GO:0042052	rhabdomere development
3. B	GO:0008092	cytoskeletal protein binding
3. B	GO:0032757	positive regulation of interleukin-8 production
3. B	GO:0003401	axis elongation
3. B	GO:0048243	norepinephrine secretion
3. B	GO:0003281	ventricular septum development
3. B	GO:0036020	endolysosome membrane
3. B	GO:0043014	alpha-tubulin binding
3. B	GO:0030286	dynein complex
3. B	GO:0043393	regulation of protein binding
3. B	GO:0005814	centriole
3. B	GO:0060027	convergent extension involved in gastrulation
3. B	GO:0005618	cell wall
3. B	GO:0003143	embryonic heart tube morphogenesis
3. B	GO:0048935	peripheral nervous system neuron development
3. B	GO:0003279	cardiac septum development
3. B	GO:0061458	reproductive system development
3. B	GO:0098982	GABA-ergic synapse
3. B	GO:0001932	regulation of protein phosphorylation
3. B	GO:0032009	early phagosome
3. B	GO:0097475	motor neuron migration
3. B	GO:0007252	I-kappaB phosphorylation
3. B	GO:0030317	flagellated sperm motility
3. B	GO:0002755	MyD88-dependent toll-like receptor signaling pathway
3. B	GO:2000095	regulation of Wnt signaling pathway, planar cell polarity pathway
3. B	GO:0030199	collagen fibril organization
3. B	GO:0007368	determination of left/right symmetry
3. B	GO:0005829	cytosol
3. B	GO:0051493	regulation of cytoskeleton organization
3. B	GO:0032528	microvillus organization
3. B	GO:0099151	regulation of postsynaptic density assembly
3. B	GO:0005968	Rab-protein geranylgeranyltransferase complex
3. B	GO:0001669	acrosomal vesicle
3. B	GO:0062023	collagen-containing extracellular matrix
3. B	GO:0007181	transforming growth factor beta receptor complex assembly
3. B	GO:0060049	regulation of protein glycosylation
3. B	GO:0000164	protein phosphatase type 1 complex
3. B	GO:0032474	otolith morphogenesis
3. B	GO:0008584	male gonad development

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	Q8IYG6	Leucine-rich repeat-containing protein 56	8.64e-05	1.00e-16	0.040
1. PB	Q6AXZ2	Leucine-rich repeat-containing protein 46	2.00e-15	9.88e-68	3.56e-149
1. PB	P90920	Leucine-rich repeat-containing protein egg-6	3.37e-02	3.42e-03	0.009
1. PB	Q9DAP0	Leucine-rich repeat-containing protein 46	7.66e-15	9.34e-60	1.13e-137
1. PB	P43333	U2 small nuclear ribonucleoprotein A'	7.66e-09	6.43e-14	0.033
1. PB	Q8ILI6	Acidic leucine-rich nuclear phosphoprotein 32-related protein	2.22e-07	6.38e-06	0.022
1. PB	Q7Z4L9	Protein phosphatase 1 regulatory subunit 42	9.36e-06	7.83e-06	7.65e-04
1. PB	Q91YK0	Leucine-rich repeat-containing protein 49	6.87e-04	2.56e-04	1.06e-08
1. PB	A8IVX2	Dynein regulatory complex subunit 3	1.47e-06	1.09e-03	3.25e-10
1. PB	Q8R1Z4	Protein phosphatase 1 regulatory subunit 42	1.38e-06	5.60e-15	0.004
1. PB	B6D5P6	Dynein axonemal assembly factor 1	3.63e-03	7.73e-09	3.81e-12
1. PB	Q09JZ4	Leucine-rich repeat-containing protein ODA7	1.27e-03	1.73e-19	1.59e-07
1. PB	Q4V8C9	Leucine-rich repeat-containing protein 56	3.08e-04	4.33e-14	0.035
1. PB	O43822	Cilia- and flagella-associated protein 410	3.49e-03	1.65e-14	0.001
1. PB	Q28XE2	Acidic leucine-rich nuclear phosphoprotein 32 family member A	1.16e-06	6.55e-04	1.10e-07
1. PB	Q96FV0	Leucine-rich repeat-containing protein 46	0	8.37e-135	0.0
1. PB	Q6GQN5	Protein phosphatase 1 regulatory subunit 42	1.82e-05	8.58e-10	0.004
1. PB	Q4R6X9	Dynein regulatory complex subunit 3	8.02e-07	4.35e-04	1.10e-04
1. PB	Q5XI54	Dynein regulatory complex subunit 3	4.49e-06	4.90e-03	3.44e-05
1. PB	F1MT22	Leucine-rich repeat-containing G-protein coupled receptor 5	2.89e-02	1.42e-04	0.021
1. PB	B6D5P1	Dynein axonemal assembly factor 1	7.50e-04	1.99e-08	3.64e-12
1. PB	Q9D5E4	Dynein regulatory complex subunit 3	8.08e-07	5.12e-04	2.14e-04
1. PB	Q9BLB6	Probable U2 small nuclear ribonucleoprotein A'	6.45e-07	7.66e-18	0.015
1. PB	Q7ZV84	Dynein axonemal assembly factor 1	1.65e-05	6.86e-15	1.55e-04
1. PB	Q6AYH9	Dynein axonemal assembly factor 1	3.22e-04	4.10e-09	2.92e-12
1. PB	Q9D2H9	Dynein axonemal assembly factor 1	4.43e-04	4.48e-06	6.36e-12
1. PB	Q4R803	Protein phosphatase 1 regulatory subunit 42	4.70e-06	7.53e-18	9.16e-05
1. PB	Q9H069	Dynein regulatory complex subunit 3	1.20e-06	3.32e-04	0.001
1. PB	B4F7C5	Leucine-rich repeat transmembrane neuronal protein 4	3.75e-03	3.47e-05	0.032
1. PB	P34390	Uncharacterized protein F09G8.5	3.28e-03	4.62e-04	1.32e-04
1. PB	O75473	Leucine-rich repeat-containing G-protein coupled receptor 5	1.72e-02	2.99e-03	0.001
1. PB	Q4R747	Leucine-rich repeat-containing protein 46	4.49e-14	3.21e-96	0.0
1. PB	Q8K375	Leucine-rich repeat-containing protein 56	2.76e-04	7.47e-16	0.016
1. PB	Q8IUZ0	Leucine-rich repeat-containing protein 49	5.96e-04	8.09e-05	1.56e-07
1. PB	Q80XG9	Leucine-rich repeat transmembrane neuronal protein 4	1.12e-02	1.26e-05	0.033
1. PB	B0BLW3	Leucine-rich repeat-containing G-protein coupled receptor 4	6.92e-02	4.53e-04	0.001
1. PB	B6D5P3	Dynein axonemal assembly factor 1	1.09e-04	6.10e-07	3.85e-12
1. PB	Q3SYS4	Dynein axonemal assembly factor 1	8.80e-05	5.48e-07	1.51e-11
1. PB	O75325	Leucine-rich repeat neuronal protein 2	1.72e-01	2.41e-02	0.012
1. PB	Q9VR52	Protein tilB	5.98e-06	1.51e-03	1.10e-11
1. PB	Q86VH4	Leucine-rich repeat transmembrane neuronal protein 4	5.16e-03	3.36e-05	0.028
1. PB	Q8NEP3	Dynein axonemal assembly factor 1	4.56e-05	1.14e-08	1.39e-12
1. PB	Q9V895	Acidic leucine-rich nuclear phosphoprotein 32 family member A	1.27e-05	4.66e-05	5.04e-08
2. P	Q9H756	Leucine-rich repeat-containing protein 19	1.30e-03	1.30e-06	NA
2. P	Q6FV04	U2 small nuclear ribonucleoprotein A'	5.22e-06	2.39e-10	NA
2. P	O01615	Acidic leucine-rich nuclear phosphoprotein 32-related protein 2	1.43e-05	1.04e-05	NA
2. P	Q5F4A3	Acidic leucine-rich nuclear phosphoprotein 32 family member E	7.73e-06	8.72e-05	NA
2. P	Q8N309	Leucine-rich repeat-containing protein 43	2.65e-03	1.81e-07	NA
2. P	Q7TNJ4	Amphoterin-induced protein 2	2.26e-02	1.92e-03	NA
2. P	O35381	Acidic leucine-rich nuclear phosphoprotein 32 family member A	5.08e-07	1.77e-03	NA
2. P	Q99PI8	Reticulon-4 receptor	1.78e-02	6.55e-04	NA
2. P	Q387Y5	Leucine-rich repeat-containing protein 56 homolog	1.14e-03	8.06e-03	NA
2. P	Q7ZUP0	Acidic leucine-rich nuclear phosphoprotein 32 family member A	6.67e-06	3.46e-04	NA
2. P	Q5E9X4	Leucine-rich repeat-containing protein 59	1.08e-04	1.06e-04	NA
2. P	Q99M75	Reticulon-4 receptor	6.26e-03	9.82e-04	NA
2. P	Q326Z6	E3 ubiquitin-protein ligase ipaH9.8	1.08e-02	2.30e-02	NA
2. P	Q4P5F9	U2 small nuclear ribonucleoprotein A'	1.30e-06	4.14e-14	NA
2. P	Q5NVQ6	Immunoglobulin superfamily containing leucine-rich repeat protein	6.80e-02	4.39e-02	NA
2. P	O75427	Leucine-rich repeat and calponin homology domain-containing protein 4	3.61e-03	1.24e-03	NA
2. P	P49911	Acidic leucine-rich nuclear phosphoprotein 32 family member A	3.15e-06	3.69e-04	NA
2. P	O62220	Acidic leucine-rich nuclear phosphoprotein 32-related protein 1	7.68e-05	1.31e-04	NA
2. P	Q80YS5	Leucine-rich repeat-containing protein 27	8.01e-03	1.65e-03	NA
2. P	Q8R2R5	Leucine-rich repeat-containing protein 61	2.05e-08	7.80e-11	NA
2. P	Q80ZD9	Amphoterin-induced protein 2	6.32e-03	1.10e-03	NA
2. P	P55456	Probable E3 ubiquitin-protein ligase NGR_a03640	1.68e-02	1.08e-02	NA
2. P	Q86WK7	Amphoterin-induced protein 3	8.13e-03	3.77e-03	NA
2. P	Q80ZD7	Amphoterin-induced protein 1	9.81e-04	5.35e-03	NA
2. P	Q9BV99	Leucine-rich repeat-containing protein 61	2.96e-10	2.63e-13	NA
2. P	Q8VSC3	E3 ubiquitin-protein ligase ipaH9.8	1.84e-02	1.65e-02	NA
2. P	Q86WK6	Amphoterin-induced protein 1	3.98e-03	5.88e-03	NA
2. P	Q9Z1P4	Leucine-rich repeat-containing G-protein coupled receptor 5	1.63e-02	5.24e-03	NA
2. P	Q9CQ07	Leucine-rich repeat-containing protein 18	1.52e-04	4.09e-05	NA
2. P	Q5ZMN0	Acidic leucine-rich nuclear phosphoprotein 32 family member B	2.47e-08	1.33e-03	NA
2. P	D3ZAL8	Leucine-rich repeat transmembrane neuronal protein 3	1.96e-02	2.50e-03	NA
2. P	Q9D9B4	Leucine-rich melanocyte differentiation-associated protein	2.56e-05	6.14e-14	NA
2. P	Q8HY67	Acidic leucine-rich nuclear phosphoprotein 32 family member A	NA	1.60e-05	NA
2. P	A6H759	Leucine-rich repeat-containing protein 72	7.61e-07	1.14e-17	NA
2. P	Q9N0E3	Reticulon-4 receptor	1.30e-03	1.08e-04	NA
2. P	Q9VIW3	Ran GTPase-activating protein	2.61e-02	1.87e-04	NA
2. P	P09661	U2 small nuclear ribonucleoprotein A'	6.26e-07	5.96e-18	NA
2. P	Q08963	U2 small nuclear ribonucleoprotein A'	4.02e-05	8.11e-04	NA
2. P	Q7ZY40	Acidic leucine-rich nuclear phosphoprotein 32 family member E	2.55e-05	8.21e-07	NA
2. P	Q9USX8	U2 small nuclear ribonucleoprotein A'	2.87e-07	4.80e-11	NA
2. P	P97822	Acidic leucine-rich nuclear phosphoprotein 32 family member E	1.84e-05	2.42e-05	NA
2. P	P39687	Acidic leucine-rich nuclear phosphoprotein 32 family member A	7.05e-07	8.47e-06	NA
2. P	Q6NX28	Leucine-rich repeat-containing protein 59	4.48e-05	1.36e-06	NA
2. P	F1MLX5	Leucine-rich repeat-containing G-protein coupled receptor 4	1.84e-02	3.22e-04	NA
2. P	Q8BXQ3	Leucine-rich repeat and transmembrane domain-containing protein 1	1.65e-04	5.18e-04	NA
2. P	Q86VH5	Leucine-rich repeat transmembrane neuronal protein 3	9.15e-03	2.92e-02	NA
2. P	Q5PPX0	Protein phosphatase 1 regulatory subunit 42	5.15e-06	7.12e-21	NA
2. P	Q8BZT5	Leucine-rich repeat-containing protein 19	1.60e-03	6.05e-05	NA
2. P	Q922Q8	Leucine-rich repeat-containing protein 59	1.35e-04	1.83e-05	NA
2. P	Q5R7M3	Amphoterin-induced protein 2	5.16e-03	1.33e-04	NA
2. P	Q8C2S7	Amphoterin-induced protein 3	6.40e-03	2.30e-02	NA
2. P	Q80ZD8	Amphoterin-induced protein 1	6.36e-04	5.72e-03	NA
2. P	Q9BXB1	Leucine-rich repeat-containing G-protein coupled receptor 4	2.06e-02	3.06e-04	NA
2. P	E5DHB5	Leucine-rich repeat-containing G-protein coupled receptor 5A	3.29e-02	1.45e-02	NA
2. P	Q55CS8	MAP kinase phosphatase with leucine-rich repeats protein 2	1.77e-02	3.66e-02	NA
2. P	Q505F5	Leucine-rich repeat-containing protein 47	2.43e-02	2.14e-05	NA
2. P	Q6NUW5	Acidic leucine-rich nuclear phosphoprotein 32 family member E	1.15e-06	4.59e-06	NA
2. P	P18009	Probable E3 ubiquitin-protein ligase ipaH4.5	2.27e-02	1.27e-02	NA
2. P	Q96AG4	Leucine-rich repeat-containing protein 59	1.40e-04	1.33e-04	NA
2. P	Q8AVS8	Leucine-rich repeat-containing protein 59	3.45e-04	3.08e-07	NA
2. P	Q5BGW9	U2 small nuclear ribonucleoprotein A'	4.01e-04	4.42e-12	NA
2. P	Q63912	Oligodendrocyte-myelin glycoprotein	2.94e-02	6.92e-03	NA
2. P	A2ARI4	Leucine-rich repeat-containing G-protein coupled receptor 4	2.48e-02	6.82e-04	NA
2. P	Q9H2I8	Leucine-rich melanocyte differentiation-associated protein	6.67e-04	2.21e-12	NA
2. P	Q6PAF6	Acidic leucine-rich nuclear phosphoprotein 32 family member A	6.40e-06	1.30e-03	NA
2. P	Q7S9P4	U2 small nuclear ribonucleoprotein A'	6.93e-08	1.78e-12	NA
2. P	Q9EST5	Acidic leucine-rich nuclear phosphoprotein 32 family member B	2.24e-04	2.10e-02	NA
2. P	Q8BZ81	Leucine-rich repeat transmembrane neuronal protein 3	2.04e-02	3.33e-03	NA
2. P	Q9BTT0	Acidic leucine-rich nuclear phosphoprotein 32 family member E	7.59e-06	4.18e-05	NA
2. P	Q5F334	Leucine-rich repeat-containing protein 59	5.63e-04	3.50e-04	NA
2. P	Q6BT60	U2 small nuclear ribonucleoprotein A'	4.62e-06	1.24e-06	NA
2. P	Q8N1G4	Leucine-rich repeat-containing protein 47	2.63e-02	2.12e-06	NA
2. P	Q86SJ2	Amphoterin-induced protein 2	7.16e-03	1.61e-04	NA
2. P	Q4WV66	U2 small nuclear ribonucleoprotein A'	1.17e-06	1.61e-13	NA
2. P	P57784	U2 small nuclear ribonucleoprotein A'	1.07e-06	9.84e-18	NA
2. P	Q9BGY6	Leucine-rich repeat-containing protein 53	8.17e-04	1.84e-08	NA
2. P	Q9V4Q8	Probable U2 small nuclear ribonucleoprotein A'	4.62e-09	1.73e-17	NA
2. P	Q9BZR6	Reticulon-4 receptor	5.17e-03	3.75e-05	NA
2. P	Q6A1I3	Acidic leucine-rich nuclear phosphoprotein 32 family member B	1.08e-05	7.91e-03	NA
2. P	A4IFA6	Immunoglobulin superfamily containing leucine-rich repeat protein	4.45e-02	1.60e-02	NA
2. P	Q6P1U7	Acidic leucine-rich nuclear phosphoprotein 32 family member B	1.53e-06	4.98e-02	NA
2. P	Q66HD6	Leucine-rich repeat-containing protein 18	9.03e-05	6.60e-03	NA
2. P	Q3U3V8	X-ray radiation resistance-associated protein 1	2.42e-02	3.50e-08	NA
2. P	Q3YTH5	E3 ubiquitin-protein ligase ipaH9.8	2.06e-02	2.69e-02	NA
2. P	Q921G6	Leucine-rich repeat and calponin homology domain-containing protein 4	9.93e-03	1.77e-03	NA
2. P	Q5XIE0	Acidic leucine-rich nuclear phosphoprotein 32 family member E	1.82e-06	7.83e-06	NA
2. P	E7FE13	Leucine-rich repeat-containing G-protein coupled receptor 4	2.12e-02	5.68e-04	NA
2. P	P46060	Ran GTPase-activating protein 1	1.56e-02	1.17e-02	NA
2. P	P23515	Oligodendrocyte-myelin glycoprotein	1.05e-03	2.34e-03	NA
2. P	F7D3V9	Leucine-rich repeat-containing G-protein coupled receptor 5	1.43e-02	3.31e-02	NA
2. P	P51122	Acidic leucine-rich nuclear phosphoprotein 32 family member A	5.91e-07	9.70e-06	NA
2. P	Q86X40	Leucine-rich repeat-containing protein 28	2.76e-03	3.76e-02	NA
2. P	Q80ZD5	Amphoterin-induced protein 3	7.40e-03	2.06e-03	NA
2. P	Q2T9T5	Leucine-rich repeat-containing protein 61	1.47e-08	4.93e-16	NA
2. P	Q5RJR8	Leucine-rich repeat-containing protein 59	1.49e-05	1.13e-05	NA
2. P	Q3V0L5	Leucine-rich repeat-containing protein 43	9.50e-04	4.09e-05	NA
2. P	Q3UVD5	Leucine-rich repeat-containing G-protein coupled receptor 6	4.35e-02	4.63e-03	NA
2. P	Q6GU68	Immunoglobulin superfamily containing leucine-rich repeat protein	1.32e-02	2.14e-02	NA
2. P	Q95JT3	Leucine-rich repeat-containing protein 43	2.48e-03	3.33e-06	NA
2. P	Q9HBX8	Leucine-rich repeat-containing G-protein coupled receptor 6	4.33e-02	4.98e-02	NA
2. P	Q755D2	U2 small nuclear ribonucleoprotein A'	1.72e-05	2.16e-02	NA
2. P	D4AC13	Leucine-rich repeat-containing G-protein coupled receptor 5	3.36e-02	7.33e-03	NA
2. P	Q9Z2H4	Leucine-rich repeat-containing G-protein coupled receptor 4	1.74e-02	4.35e-04	NA
2. P	A6NJI9	Leucine-rich repeat-containing protein 72	1.01e-06	2.11e-17	NA
2. P	Q4R8Y8	U2 small nuclear ribonucleoprotein A'	1.44e-07	5.96e-18	NA
2. P	Q5A449	U2 small nuclear ribonucleoprotein A'	3.61e-06	4.84e-08	NA
2. P	Q6NWG1	Leucine-rich repeat-containing protein 59	1.07e-04	1.21e-02	NA
2. P	Q8C6G1	Cilia- and flagella-associated protein 410	3.80e-05	8.78e-17	NA
2. P	Q31SH3	E3 ubiquitin-protein ligase ipaH9.8	1.47e-02	2.71e-02	NA
2. P	Q9BGP6	Leucine-rich repeat transmembrane neuronal protein 3	7.44e-03	2.92e-02	NA
2. P	Q6P2D8	X-ray radiation resistance-associated protein 1	9.43e-02	2.76e-05	NA
2. P	Q54NK3	Putative protein DDB_G0285185	1.68e-04	3.08e-03	NA
2. P	Q86QS6	Acidic leucine-rich nuclear phosphoprotein 32-related protein	1.72e-05	3.31e-10	NA
3. B	Q504C1	Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 2	6.61e-03	NA	4.92e-06
3. B	Q6UXM1	Leucine-rich repeats and immunoglobulin-like domains protein 3	2.23e-01	NA	6.94e-04
3. B	P70193	Leucine-rich repeats and immunoglobulin-like domains protein 1	1.93e-01	NA	0.013
3. B	Q723X5	Internalin I	5.04e-01	NA	3.50e-05
3. B	B3DH20	Dynein axonemal assembly factor 11	3.75e-05	NA	3.97e-12
3. B	Q9C099	Leucine-rich repeat and coiled-coil domain-containing protein 1	2.60e-02	NA	0.006
3. B	Q9XHH2	Dynein axonemal light chain 1	1.75e-09	NA	1.99e-05
3. B	P0DJM0	Internalin A	9.35e-02	NA	0.003
3. B	P22194	Protein phosphatase 1 regulatory subunit SDS22	2.73e-07	NA	1.61e-06
3. B	Q08602	Geranylgeranyl transferase type-2 subunit alpha	3.37e-05	NA	0.025
3. B	Q8CDN9	Leucine-rich repeat-containing protein 9	6.53e-02	NA	2.00e-06
3. B	Q5HZV9	Protein phosphatase 1 regulatory subunit 7	4.07e-07	NA	2.28e-08
3. B	Q86X45	Dynein axonemal assembly factor 11	5.39e-06	NA	6.94e-12
3. B	Q6NRC9	Leucine-rich repeat and coiled-coil domain-containing protein 1	4.84e-03	NA	1.39e-07
3. B	Q9TTB4	Fibromodulin (Fragment)	3.18e-06	NA	8.31e-05
3. B	Q7AP87	Internalin H	7.25e-03	NA	1.25e-04
3. B	Q7Z7A1	Centriolin	1.03e-01	NA	1.44e-04
3. B	Q80XU8	Leucine-rich repeat and fibronectin type-III domain-containing protein 4	1.12e-02	NA	0.014
3. B	Q723K6	Internalin A	1.35e-01	NA	0.003
3. B	Q28FY0	Dynein axonemal assembly factor 11	8.64e-08	NA	1.67e-12
3. B	Q6PJG9	Leucine-rich repeat and fibronectin type-III domain-containing protein 4	7.27e-02	NA	0.004
3. B	Q5RFS7	Protein phosphatase 1 regulatory subunit 7	3.57e-07	NA	6.38e-08
3. B	P0DQD2	Internalin B	1.29e-02	NA	3.27e-05
3. B	Q3UM45	Protein phosphatase 1 regulatory subunit 7	4.74e-07	NA	4.49e-07
3. B	P51887	Fibromodulin	6.18e-05	NA	0.004
3. B	Q9NJE9	Dynein axonemal assembly factor 11	6.76e-07	NA	3.81e-12
3. B	P13605	Fibromodulin	1.74e-03	NA	0.001
3. B	F4IIU4	187-kDa microtubule-associated protein AIR9	2.21e-01	NA	9.60e-05
3. B	P70389	Insulin-like growth factor-binding protein complex acid labile subunit	6.13e-02	NA	0.001
3. B	Q6ZRR7	Leucine-rich repeat-containing protein 9	4.00e-02	NA	1.81e-06
3. B	Q6R5N8	Toll-like receptor 13	6.10e-02	NA	0.015
3. B	P36047	Protein phosphatase 1 regulatory subunit SDS22	1.24e-06	NA	1.97e-05
3. B	Q16RY9	Dynein axonemal assembly factor 1 homolog	1.81e-02	NA	1.66e-07
3. B	Q96JM4	Leucine-rich repeat and IQ domain-containing protein 1	1.09e-01	NA	0.004
3. B	Q69ZB0	Leucine-rich repeat and coiled-coil domain-containing protein 1	1.76e-02	NA	3.05e-04
3. B	Q80TM9	Nischarin	5.02e-02	NA	0.010
3. B	Q6DIQ3	Protein phosphatase 1 regulatory subunit 7	2.70e-07	NA	2.81e-09
3. B	Q2KID4	Dynein axonemal light chain 1	7.55e-10	NA	1.65e-05
3. B	B4P6W7	Dynein axonemal assembly factor 1 homolog	3.96e-02	NA	4.10e-07
3. B	Q96M69	Leucine-rich repeat and guanylate kinase domain-containing protein	9.51e-03	NA	1.10e-06
3. B	Q4R3F0	Protein tilB homolog	2.60e-08	NA	3.50e-11
3. B	P12024	Chaoptin	3.97e-01	NA	1.83e-04
3. B	Q32KP2	Leucine-rich repeat-containing protein 23	2.84e-06	NA	0.003
3. B	Q6GPJ8	Centrosomal protein of 97 kDa	1.48e-03	NA	1.16e-04
3. B	Q53EV4	Leucine-rich repeat-containing protein 23	1.39e-05	NA	1.23e-04
3. B	Q4LDG9	Dynein axonemal light chain 1	9.03e-10	NA	4.15e-05
3. B	Q641R9	Dynein axonemal light chain 1	7.80e-08	NA	0.002
3. B	P58681	Toll-like receptor 7	1.37e-01	NA	0.006
3. B	Q8YA32	Internalin I	4.48e-01	NA	1.86e-07
3. B	B4GT53	Dynein axonemal assembly factor 1 homolog	1.81e-02	NA	2.89e-08
3. B	Q28CU0	Leucine-rich repeat-containing protein 23	1.32e-06	NA	0.002
3. B	Q9V477	Toll-like receptor Tollo	3.88e-01	NA	0.010
3. B	Q6ZVD8	PH domain leucine-rich repeat-containing protein phosphatase 2	1.98e-01	NA	0.013
3. B	O88978	Dynein axonemal assembly factor 11	4.67e-07	NA	1.22e-11
3. B	A0JM56	Leucine-rich repeat-containing protein 9	6.81e-02	NA	1.35e-04
3. B	Q4G017	Nischarin	3.05e-02	NA	0.001
3. B	Q15435	Protein phosphatase 1 regulatory subunit 7	3.50e-07	NA	1.46e-07
3. B	Q6PFC5	Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 2	1.42e-02	NA	0.037
3. B	Q28G94	Dynein axonemal light chain 1	2.42e-09	NA	0.004
3. B	P0DQD3	Internalin B	1.32e-02	NA	3.42e-05
3. B	P35859	Insulin-like growth factor-binding protein complex acid labile subunit	4.91e-02	NA	7.39e-04
3. B	P46023	G-protein coupled receptor GRL101	6.83e-02	NA	0.015
3. B	Q8IW35	Centrosomal protein of 97 kDa	3.68e-03	NA	0.001
3. B	Q7PK92	Dynein axonemal assembly factor 1 homolog	4.09e-03	NA	1.15e-04
3. B	Q9Y2I1	Nischarin	1.10e-01	NA	8.15e-04
3. B	P50609	Fibromodulin	1.81e-03	NA	3.94e-04
3. B	P50608	Fibromodulin	1.97e-03	NA	3.84e-04
3. B	A2AL36	Centriolin	1.28e-01	NA	2.48e-04
3. B	Q1RMR5	Dynein axonemal assembly factor 11	8.08e-07	NA	3.94e-11
3. B	Q54Q39	Protein phosphatase 1 regulatory subunit pprA	2.91e-11	NA	9.32e-07
3. B	Q9CZ62	Centrosomal protein of 97 kDa	3.44e-03	NA	3.29e-05
3. B	Q06828	Fibromodulin	1.89e-03	NA	1.73e-04
3. B	D4ABX8	Leucine-rich repeat and fibronectin type-III domain-containing protein 4	3.22e-01	NA	0.012
3. B	B3NLX1	Dynein axonemal assembly factor 1 homolog	2.33e-02	NA	1.50e-06
3. B	Q0P5X1	Leucine-rich repeat and IQ domain-containing protein 1	1.03e-01	NA	1.18e-04
3. B	Q84WJ9	Protein phosphatase 1 regulatory inhibitor subunit PPP1R7 homolog	5.18e-07	NA	0.013
3. B	Q6DHB1	Dynein axonemal light chain 1	8.11e-08	NA	1.41e-06
3. B	G2K3G6	Internalin A	1.09e-01	NA	0.002
3. B	Q91W20	Leucine-rich repeat-containing protein 26	1.37e-04	NA	0.033
3. B	Q9NYK1	Toll-like receptor 7	1.29e-01	NA	3.46e-04
3. B	Q05A62	Dynein axonemal light chain 1	9.70e-10	NA	8.13e-06
3. B	Q29KL8	Dynein axonemal assembly factor 1 homolog	7.84e-02	NA	2.39e-08
3. B	A0A096MJZ0	Dynein axonemal light chain 1	9.73e-10	NA	1.38e-05
3. B	Q32PL1	Protein phosphatase 1 regulatory subunit 7	2.57e-07	NA	5.95e-05
3. B	Q8T888	Dynein axonemal light chain 1	6.03e-10	NA	2.13e-05
3. B	A0A1L8G016	Dynein axonemal assembly factor 11	4.98e-07	NA	1.39e-12
3. B	Q93373	Leucine-rich repeat-containing protein let-4	1.36e-02	NA	0.001
3. B	Q8BXA7	PH domain leucine-rich repeat-containing protein phosphatase 2	3.82e-01	NA	0.015
3. B	Q3UGP9	Leucine-rich repeat-containing protein 58	1.96e-03	NA	0.016
3. B	P45969	Protein phosphatase 1 regulatory subunit SDS22 homolog	3.05e-07	NA	1.27e-07
3. B	Q9NR99	Matrix-remodeling-associated protein 5	NA	NA	0.012
3. B	Q3T0W4	Protein phosphatase 1 regulatory subunit 7	4.01e-07	NA	1.65e-07
3. B	S4X0Q8	Adhesion G protein-coupled receptor A3	4.88e-01	NA	0.033
3. B	Q96JA1	Leucine-rich repeats and immunoglobulin-like domains protein 1	3.59e-01	NA	4.12e-04
3. B	Q8INT5	Dynein axonemal assembly factor 1 homolog	3.94e-02	NA	2.91e-06
3. B	Q9D5S7	Leucine-rich repeat and guanylate kinase domain-containing protein	7.10e-03	NA	4.34e-07
3. B	O35125	Leucine-rich repeat-containing protein 23	5.32e-06	NA	4.59e-04
3. B	O46378	Fibromodulin (Fragment)	3.08e-06	NA	2.73e-05