Summary

Q96GI7

Homolog: Q14BJ1.
Function: Protein FAM89A.

Statistics

Total GO Annotation: 74
Unique PROST Go: 68
Unique BLAST Go: 0

Total Homologs: 41
Unique PROST Homologs: 33
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q14BJ1 (Protein FAM89A) with a FATCAT P-Value: 4.71e-10 and RMSD of 3.14 angstrom. The sequence alignment identity is 81.0%.
Structural alignment shown in left. Query protein Q96GI7 colored as red in alignment, homolog Q14BJ1 colored as blue. Query protein Q96GI7 is also shown in right top, homolog Q14BJ1 showed in right bottom. They are colored based on secondary structures. 

  Q96GI7 MSGARAAPGAAGNGAVRGLRVDGLPPLPKSLSGLLHSASGGGASGGWRHLERLYAQKSRIQDELSRGGPGGGGARAAALPAKPPNLDAALALLRKEMVGL 100
  Q14BJ1 MSGT----GSA--GMARGLRVDGLPPLPKSLSGLLHSAA-GGAAGGWRHLERLYAQKSRIQDELNRGGAGGGGARAAGMRTKPPNLDAALALLRKEMVGL 93

  Q96GI7 RQLDMSLLCQLYSLYESIQEYKGACQAASSPDCTYALENGFFDEEEEYFQEQNSLHDRRDRGPPRDLSLPVSSLSSSDWILESI 184
  Q14BJ1 RQLDMSLLCQLYSLYESIQEYKGACQAASSLDCTYALENGFFDDEED-FQEQGSLQDGQHHGSPRDQS-PLTHLSSSDWILESI 175

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0030512 negative regulation of transforming growth factor beta receptor signaling pathway
1. PB GO:0001222 transcription corepressor binding
1. PB GO:0060392 negative regulation of SMAD protein signal transduction
1. PB GO:0030335 positive regulation of cell migration
1. PB GO:0030010 establishment of cell polarity
1. PB GO:0030027 lamellipodium
2. P GO:0001227 DNA-binding transcription repressor activity, RNA polymerase II-specific
2. P GO:0001570 vasculogenesis
2. P GO:0019904 protein domain specific binding
2. P GO:0000122 negative regulation of transcription by RNA polymerase II
2. P GO:0031083 BLOC-1 complex
2. P GO:0030172 troponin C binding
2. P GO:0001980 regulation of systemic arterial blood pressure by ischemic conditions
2. P GO:0006937 regulation of muscle contraction
2. P GO:0006941 striated muscle contraction
2. P GO:1990584 cardiac Troponin complex
2. P GO:0008156 negative regulation of DNA replication
2. P GO:0030016 myofibril
2. P GO:0048306 calcium-dependent protein binding
2. P GO:0007507 heart development
2. P GO:0071163 DNA replication preinitiation complex assembly
2. P GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
2. P GO:0003714 transcription corepressor activity
2. P GO:0032402 melanosome transport
2. P GO:0097512 cardiac myofibril
2. P GO:0006940 regulation of smooth muscle contraction
2. P GO:0033299 secretion of lysosomal enzymes
2. P GO:0060707 trophoblast giant cell differentiation
2. P GO:0140297 DNA-binding transcription factor binding
2. P GO:0043123 positive regulation of I-kappaB kinase/NF-kappaB signaling
2. P GO:0046983 protein dimerization activity
2. P GO:0050885 neuromuscular process controlling balance
2. P GO:0009887 animal organ morphogenesis
2. P GO:0051015 actin filament binding
2. P GO:0070527 platelet aggregation
2. P GO:0010882 regulation of cardiac muscle contraction by calcium ion signaling
2. P GO:0005861 troponin complex
2. P GO:0008089 anterograde axonal transport
2. P GO:0030318 melanocyte differentiation
2. P GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
2. P GO:0006357 regulation of transcription by RNA polymerase II
2. P GO:0060047 heart contraction
2. P GO:0045786 negative regulation of cell cycle
2. P GO:1990837 sequence-specific double-stranded DNA binding
2. P GO:0019901 protein kinase binding
2. P GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
2. P GO:0035563 positive regulation of chromatin binding
2. P GO:0060048 cardiac muscle contraction
2. P GO:0046907 intracellular transport
2. P GO:0055010 ventricular cardiac muscle tissue morphogenesis
2. P GO:1904115 axon cytoplasm
2. P GO:0050942 positive regulation of pigment cell differentiation
2. P GO:0003009 skeletal muscle contraction
2. P GO:0042826 histone deacetylase binding
2. P GO:2000104 negative regulation of DNA-dependent DNA replication
2. P GO:0031175 neuron projection development
2. P GO:0007288 sperm axoneme assembly
2. P GO:0019855 calcium channel inhibitor activity
2. P GO:0006936 muscle contraction
2. P GO:0031014 troponin T binding
2. P GO:0006874 cellular calcium ion homeostasis
2. P GO:0003779 actin binding
2. P GO:0035646 endosome to melanosome transport
2. P GO:0005816 spindle pole body
2. P GO:0034605 cellular response to heat
2. P GO:0032780 negative regulation of ATP-dependent activity
2. P GO:0048490 anterograde synaptic vesicle transport
2. P GO:0045944 positive regulation of transcription by RNA polymerase II
2. P GO:0061025 membrane fusion
2. P GO:0032816 positive regulation of natural killer cell activation
2. P GO:0043292 contractile fiber
2. P GO:0032438 melanosome organization
2. P GO:0030017 sarcomere
2. P GO:0005654 nucleoplasm

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q9QUI1 Leucine repeat adapter protein 25 4.98e-05 1.04e-36 2.39e-35
1. PB Q6Q0N2 Protein FAM89A 4.50e-09 8.69e-60 2.29e-79
1. PB Q14BJ1 Protein FAM89A 4.71e-10 2.54e-61 1.34e-80
1. PB Q96GI7 Protein FAM89A 0 3.53e-126 1.62e-130
1. PB Q566R4 Leucine repeat adapter protein 25 8.97e-05 1.02e-36 4.98e-35
1. PB Q8N5H3 Leucine repeat adapter protein 25 2.91e-06 1.92e-38 4.86e-33
1. PB Q08AY9 Protein FAM89A 4.37e-08 1.63e-48 2.81e-71
1. PB A6QQF7 Protein FAM89A 4.19e-07 2.34e-65 6.77e-93
2. P B2RV13 Sperm axonemal maintenance protein CFAP97D1 6.49e-03 3.80e-02 NA
2. P P23693 Troponin I, cardiac muscle 4.29e-03 2.23e-02 NA
2. P O75496 Geminin 1.33e-02 7.43e-06 NA
2. P Q6UDH8 Tegument protein UL14 NA 3.29e-02 NA
2. P Q08DU8 Biogenesis of lysosome-related organelles complex 1 subunit 6 2.48e-04 4.71e-02 NA
2. P Q5RFZ7 Protein FAM167A 6.65e-03 4.85e-03 NA
2. P P57100 Heart- and neural crest derivatives-expressed protein 1 2.58e-02 3.60e-02 NA
2. P Q0V7M8 Protein FAM167A 4.85e-03 1.61e-05 NA
2. P Q8K2P1 Leucine rich adaptor protein 1-like 5.01e-03 2.35e-08 NA
2. P Q5PYI0 Troponin I, cardiac muscle 3.42e-03 3.41e-02 NA
2. P O88513 Geminin 9.03e-03 4.82e-08 NA
2. P P02646 Troponin I, cardiac muscle 2.84e-03 1.21e-03 NA
2. P Q863B6 Troponin I, cardiac muscle 3.27e-03 2.49e-03 NA
2. P Q63302 Transcription factor EC 5.11e-03 2.49e-03 NA
2. P P48787 Troponin I, cardiac muscle 2.90e-03 1.53e-02 NA
2. P Q5BJW5 Leucine rich adaptor protein 1-like 2.57e-03 5.73e-08 NA
2. P O14948 Transcription factor EC 5.34e-03 3.73e-02 NA
2. P Q06616 Nuclear envelope protein YPR174C 2.32e-03 1.01e-02 NA
2. P P17257 Protein FAM167B 3.97e-03 2.55e-09 NA
2. P Q8TDM0 Breast carcinoma-amplified sequence 4 2.14e-03 1.20e-03 NA
2. P Q9DAN9 Sperm axonemal maintenance protein CFAP97D1 1.76e-03 8.44e-04 NA
2. P Q3UNU4 Glutamate-rich protein 4 4.42e-03 2.16e-06 NA
2. P Q8MKD5 Troponin I, cardiac muscle 2.86e-03 2.85e-02 NA
2. P Q8IV03 Leucine rich adaptor protein 1-like 6.32e-03 3.19e-04 NA
2. P A2T713 Transcription factor EC 8.02e-03 1.73e-02 NA
2. P Q6P1G6 Protein FAM167A 1.10e-02 2.64e-03 NA
2. P Q9BTA0 Protein FAM167B 2.31e-03 1.62e-06 NA
2. P A2T7L8 Transcription factor EC 6.71e-03 3.73e-02 NA
2. P P0C7N2 Glutamate-rich protein 4 1.53e-02 4.69e-06 NA
2. P Q9WTW4 Transcription factor EC 6.69e-03 5.38e-03 NA
2. P Q9NUP1 Biogenesis of lysosome-related organelles complex 1 subunit 4 2.08e-03 3.09e-03 NA
2. P Q96KS9 Protein FAM167A 1.31e-02 4.36e-03 NA
2. P A6NGS2 Glutamate-rich protein 4 1.66e-02 3.46e-10 NA