Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
Q14BJ1
(Protein FAM89A) with a FATCAT P-Value: 4.71e-10 and RMSD of 3.14 angstrom. The sequence alignment identity is 81.0%.
Structural alignment shown in left. Query protein Q96GI7 colored as red in alignment, homolog Q14BJ1 colored as blue.
Query protein Q96GI7 is also shown in right top, homolog Q14BJ1 showed in right bottom. They are colored based on secondary structures.
Q96GI7 MSGARAAPGAAGNGAVRGLRVDGLPPLPKSLSGLLHSASGGGASGGWRHLERLYAQKSRIQDELSRGGPGGGGARAAALPAKPPNLDAALALLRKEMVGL 100 Q14BJ1 MSGT----GSA--GMARGLRVDGLPPLPKSLSGLLHSAA-GGAAGGWRHLERLYAQKSRIQDELNRGGAGGGGARAAGMRTKPPNLDAALALLRKEMVGL 93 Q96GI7 RQLDMSLLCQLYSLYESIQEYKGACQAASSPDCTYALENGFFDEEEEYFQEQNSLHDRRDRGPPRDLSLPVSSLSSSDWILESI 184 Q14BJ1 RQLDMSLLCQLYSLYESIQEYKGACQAASSLDCTYALENGFFDDEED-FQEQGSLQDGQHHGSPRDQS-PLTHLSSSDWILESI 175
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0030512 | negative regulation of transforming growth factor beta receptor signaling pathway |
| 1. PB | GO:0001222 | transcription corepressor binding |
| 1. PB | GO:0060392 | negative regulation of SMAD protein signal transduction |
| 1. PB | GO:0030335 | positive regulation of cell migration |
| 1. PB | GO:0030010 | establishment of cell polarity |
| 1. PB | GO:0030027 | lamellipodium |
| 2. P | GO:0001227 | DNA-binding transcription repressor activity, RNA polymerase II-specific |
| 2. P | GO:0001570 | vasculogenesis |
| 2. P | GO:0019904 | protein domain specific binding |
| 2. P | GO:0000122 | negative regulation of transcription by RNA polymerase II |
| 2. P | GO:0031083 | BLOC-1 complex |
| 2. P | GO:0030172 | troponin C binding |
| 2. P | GO:0001980 | regulation of systemic arterial blood pressure by ischemic conditions |
| 2. P | GO:0006937 | regulation of muscle contraction |
| 2. P | GO:0006941 | striated muscle contraction |
| 2. P | GO:1990584 | cardiac Troponin complex |
| 2. P | GO:0008156 | negative regulation of DNA replication |
| 2. P | GO:0030016 | myofibril |
| 2. P | GO:0048306 | calcium-dependent protein binding |
| 2. P | GO:0007507 | heart development |
| 2. P | GO:0071163 | DNA replication preinitiation complex assembly |
| 2. P | GO:0001228 | DNA-binding transcription activator activity, RNA polymerase II-specific |
| 2. P | GO:0003714 | transcription corepressor activity |
| 2. P | GO:0032402 | melanosome transport |
| 2. P | GO:0097512 | cardiac myofibril |
| 2. P | GO:0006940 | regulation of smooth muscle contraction |
| 2. P | GO:0033299 | secretion of lysosomal enzymes |
| 2. P | GO:0060707 | trophoblast giant cell differentiation |
| 2. P | GO:0140297 | DNA-binding transcription factor binding |
| 2. P | GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB signaling |
| 2. P | GO:0046983 | protein dimerization activity |
| 2. P | GO:0050885 | neuromuscular process controlling balance |
| 2. P | GO:0009887 | animal organ morphogenesis |
| 2. P | GO:0051015 | actin filament binding |
| 2. P | GO:0070527 | platelet aggregation |
| 2. P | GO:0010882 | regulation of cardiac muscle contraction by calcium ion signaling |
| 2. P | GO:0005861 | troponin complex |
| 2. P | GO:0008089 | anterograde axonal transport |
| 2. P | GO:0030318 | melanocyte differentiation |
| 2. P | GO:0000978 | RNA polymerase II cis-regulatory region sequence-specific DNA binding |
| 2. P | GO:0006357 | regulation of transcription by RNA polymerase II |
| 2. P | GO:0060047 | heart contraction |
| 2. P | GO:0045786 | negative regulation of cell cycle |
| 2. P | GO:1990837 | sequence-specific double-stranded DNA binding |
| 2. P | GO:0019901 | protein kinase binding |
| 2. P | GO:0000981 | DNA-binding transcription factor activity, RNA polymerase II-specific |
| 2. P | GO:0035563 | positive regulation of chromatin binding |
| 2. P | GO:0060048 | cardiac muscle contraction |
| 2. P | GO:0046907 | intracellular transport |
| 2. P | GO:0055010 | ventricular cardiac muscle tissue morphogenesis |
| 2. P | GO:1904115 | axon cytoplasm |
| 2. P | GO:0050942 | positive regulation of pigment cell differentiation |
| 2. P | GO:0003009 | skeletal muscle contraction |
| 2. P | GO:0042826 | histone deacetylase binding |
| 2. P | GO:2000104 | negative regulation of DNA-dependent DNA replication |
| 2. P | GO:0031175 | neuron projection development |
| 2. P | GO:0007288 | sperm axoneme assembly |
| 2. P | GO:0019855 | calcium channel inhibitor activity |
| 2. P | GO:0006936 | muscle contraction |
| 2. P | GO:0031014 | troponin T binding |
| 2. P | GO:0006874 | cellular calcium ion homeostasis |
| 2. P | GO:0003779 | actin binding |
| 2. P | GO:0035646 | endosome to melanosome transport |
| 2. P | GO:0005816 | spindle pole body |
| 2. P | GO:0034605 | cellular response to heat |
| 2. P | GO:0032780 | negative regulation of ATP-dependent activity |
| 2. P | GO:0048490 | anterograde synaptic vesicle transport |
| 2. P | GO:0045944 | positive regulation of transcription by RNA polymerase II |
| 2. P | GO:0061025 | membrane fusion |
| 2. P | GO:0032816 | positive regulation of natural killer cell activation |
| 2. P | GO:0043292 | contractile fiber |
| 2. P | GO:0032438 | melanosome organization |
| 2. P | GO:0030017 | sarcomere |
| 2. P | GO:0005654 | nucleoplasm |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q9QUI1 | Leucine repeat adapter protein 25 | 4.98e-05 | 1.04e-36 | 2.39e-35 |
| 1. PB | Q6Q0N2 | Protein FAM89A | 4.50e-09 | 8.69e-60 | 2.29e-79 |
| 1. PB | Q14BJ1 | Protein FAM89A | 4.71e-10 | 2.54e-61 | 1.34e-80 |
| 1. PB | Q96GI7 | Protein FAM89A | 0 | 3.53e-126 | 1.62e-130 |
| 1. PB | Q566R4 | Leucine repeat adapter protein 25 | 8.97e-05 | 1.02e-36 | 4.98e-35 |
| 1. PB | Q8N5H3 | Leucine repeat adapter protein 25 | 2.91e-06 | 1.92e-38 | 4.86e-33 |
| 1. PB | Q08AY9 | Protein FAM89A | 4.37e-08 | 1.63e-48 | 2.81e-71 |
| 1. PB | A6QQF7 | Protein FAM89A | 4.19e-07 | 2.34e-65 | 6.77e-93 |
| 2. P | B2RV13 | Sperm axonemal maintenance protein CFAP97D1 | 6.49e-03 | 3.80e-02 | NA |
| 2. P | P23693 | Troponin I, cardiac muscle | 4.29e-03 | 2.23e-02 | NA |
| 2. P | O75496 | Geminin | 1.33e-02 | 7.43e-06 | NA |
| 2. P | Q6UDH8 | Tegument protein UL14 | NA | 3.29e-02 | NA |
| 2. P | Q08DU8 | Biogenesis of lysosome-related organelles complex 1 subunit 6 | 2.48e-04 | 4.71e-02 | NA |
| 2. P | Q5RFZ7 | Protein FAM167A | 6.65e-03 | 4.85e-03 | NA |
| 2. P | P57100 | Heart- and neural crest derivatives-expressed protein 1 | 2.58e-02 | 3.60e-02 | NA |
| 2. P | Q0V7M8 | Protein FAM167A | 4.85e-03 | 1.61e-05 | NA |
| 2. P | Q8K2P1 | Leucine rich adaptor protein 1-like | 5.01e-03 | 2.35e-08 | NA |
| 2. P | Q5PYI0 | Troponin I, cardiac muscle | 3.42e-03 | 3.41e-02 | NA |
| 2. P | O88513 | Geminin | 9.03e-03 | 4.82e-08 | NA |
| 2. P | P02646 | Troponin I, cardiac muscle | 2.84e-03 | 1.21e-03 | NA |
| 2. P | Q863B6 | Troponin I, cardiac muscle | 3.27e-03 | 2.49e-03 | NA |
| 2. P | Q63302 | Transcription factor EC | 5.11e-03 | 2.49e-03 | NA |
| 2. P | P48787 | Troponin I, cardiac muscle | 2.90e-03 | 1.53e-02 | NA |
| 2. P | Q5BJW5 | Leucine rich adaptor protein 1-like | 2.57e-03 | 5.73e-08 | NA |
| 2. P | O14948 | Transcription factor EC | 5.34e-03 | 3.73e-02 | NA |
| 2. P | Q06616 | Nuclear envelope protein YPR174C | 2.32e-03 | 1.01e-02 | NA |
| 2. P | P17257 | Protein FAM167B | 3.97e-03 | 2.55e-09 | NA |
| 2. P | Q8TDM0 | Breast carcinoma-amplified sequence 4 | 2.14e-03 | 1.20e-03 | NA |
| 2. P | Q9DAN9 | Sperm axonemal maintenance protein CFAP97D1 | 1.76e-03 | 8.44e-04 | NA |
| 2. P | Q3UNU4 | Glutamate-rich protein 4 | 4.42e-03 | 2.16e-06 | NA |
| 2. P | Q8MKD5 | Troponin I, cardiac muscle | 2.86e-03 | 2.85e-02 | NA |
| 2. P | Q8IV03 | Leucine rich adaptor protein 1-like | 6.32e-03 | 3.19e-04 | NA |
| 2. P | A2T713 | Transcription factor EC | 8.02e-03 | 1.73e-02 | NA |
| 2. P | Q6P1G6 | Protein FAM167A | 1.10e-02 | 2.64e-03 | NA |
| 2. P | Q9BTA0 | Protein FAM167B | 2.31e-03 | 1.62e-06 | NA |
| 2. P | A2T7L8 | Transcription factor EC | 6.71e-03 | 3.73e-02 | NA |
| 2. P | P0C7N2 | Glutamate-rich protein 4 | 1.53e-02 | 4.69e-06 | NA |
| 2. P | Q9WTW4 | Transcription factor EC | 6.69e-03 | 5.38e-03 | NA |
| 2. P | Q9NUP1 | Biogenesis of lysosome-related organelles complex 1 subunit 4 | 2.08e-03 | 3.09e-03 | NA |
| 2. P | Q96KS9 | Protein FAM167A | 1.31e-02 | 4.36e-03 | NA |
| 2. P | A6NGS2 | Glutamate-rich protein 4 | 1.66e-02 | 3.46e-10 | NA |