Summary

Q96HJ3

Homolog: Q3UI66.
Function: Coiled-coil domain-containing protein 34.

Statistics

Total GO Annotation: 69
Unique PROST Go: 60
Unique BLAST Go: 9

Total Homologs: 27
Unique PROST Homologs: 23
Unique BLAST Homologs: 2

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q3UI66 (Coiled-coil domain-containing protein 34) with a FATCAT P-Value: 1e-10 and RMSD of 4.62 angstrom. The sequence alignment identity is 69.0%.
Structural alignment shown in left. Query protein Q96HJ3 colored as red in alignment, homolog Q3UI66 colored as blue. Query protein Q96HJ3 is also shown in right top, homolog Q3UI66 showed in right bottom. They are colored based on secondary structures. 

  Q96HJ3 MWAAGRW---GPTFP-SSYAGFSADCRPRSRPSSDSCSVPMTGARGQ-GLE---VVRSPSPPLPLSCSNSTRSLLSPLGHQSFQFDEDDGDGEDEEDVDD 92
  Q3UI66 MRAAGPWRAASPA-PCTRYL---ARCKPGFRPSS-SFVVDLLVDSGDPGLEDVALTECLSPP-SLSCSNSTLSLLSPLGHQSFPFGADDSEGE------D 88

  Q96HJ3 EEDVDEDAHDSEAKVASLRGMELQ---GCASTQVESENNQEEQKQVRLPESRLTPWEVWFIGKEKEERDRLQLKALEELNQQLEKRKEMEEREKRKIIAE 189
  Q3UI66 EEALDEDARESESKVESLEGIEFQQRSSC---EVESQDKQE--KLVLLQHGSLTPWEMWFVGKEKEERGRLQQKFLEELNQQIEKRKEMEEREKRKIIAE 183

  Q96HJ3 EKHKEWVQKKNEQKRKEREQKINKEMEEKAAKELEKEYLQEKAKEKYQEWLKKKNAEECERKKKEKEKEKQQQAEIQEKKEIAEKKFQEWLENAKHKPRP 289
  Q3UI66 VKHKEWVQKKNKQERKEREQKINKEMEEKEAKKREKEHLQEKAKEKYQEWLKKKKAEEYEKKKKEKEKEKQRQAELQEKKEIAEKKFKEWLENAKNKPRP 283

  Q96HJ3 AAKSYGYANGKLTGFYSGNSYPEPAFYNPIPWKPIHMPPPKEAKDLSGRKSKRPVISQPHKSSSLVIHKARSNLCLGTLCRIQR 373
  Q3UI66 AAKSYGYSSGKLTGFYSGNSYPEPTFYNPIPWKPIHMPPPKEAKSGPGKKSKRHAASQPLPSSSLAVHNAKSSLCLGALCRGQR 367

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0016572 histone phosphorylation
2. P GO:0009751 response to salicylic acid
2. P GO:0010032 meiotic chromosome condensation
2. P GO:0010555 response to mannitol
2. P GO:0016183 synaptic vesicle coating
2. P GO:0051257 meiotic spindle midzone assembly
2. P GO:0042277 peptide binding
2. P GO:0007269 neurotransmitter secretion
2. P GO:0060170 ciliary membrane
2. P GO:0010015 root morphogenesis
2. P GO:0048032 galacturonate binding
2. P GO:0005861 troponin complex
2. P GO:0005874 microtubule
2. P GO:0006886 intracellular protein transport
2. P GO:0006937 regulation of muscle contraction
2. P GO:0003341 cilium movement
2. P GO:0030136 clathrin-coated vesicle
2. P GO:0000235 astral microtubule
2. P GO:0006836 neurotransmitter transport
2. P GO:0030672 synaptic vesicle membrane
2. P GO:0005326 neurotransmitter transmembrane transporter activity
2. P GO:0005802 trans-Golgi network
2. P GO:0045292 mRNA cis splicing, via spliceosome
2. P GO:0055028 cortical microtubule
2. P GO:0060287 epithelial cilium movement involved in determination of left/right asymmetry
2. P GO:0097546 ciliary base
2. P GO:0010091 trichome branching
2. P GO:0048268 clathrin coat assembly
2. P GO:0005198 structural molecule activity
2. P GO:0043539 protein serine/threonine kinase activator activity
2. P GO:0051310 metaphase plate congression
2. P GO:0030125 clathrin vesicle coat
2. P GO:0000793 condensed chromosome
2. P GO:0007368 determination of left/right symmetry
2. P GO:0099631 postsynaptic endocytic zone cytoplasmic component
2. P GO:0098835 presynaptic endocytic zone membrane
2. P GO:0001578 microtubule bundle formation
2. P GO:0072583 clathrin-dependent endocytosis
2. P GO:0030118 clathrin coat
2. P GO:1990385 meiotic spindle midzone
2. P GO:0007163 establishment or maintenance of cell polarity
2. P GO:0000281 mitotic cytokinesis
2. P GO:0000226 microtubule cytoskeleton organization
2. P GO:0010031 circumnutation
2. P GO:0008017 microtubule binding
2. P GO:0005721 pericentric heterochromatin
2. P GO:0045334 clathrin-coated endocytic vesicle
2. P GO:0051665 membrane raft localization
2. P GO:0071902 positive regulation of protein serine/threonine kinase activity
2. P GO:0009825 multidimensional cell growth
2. P GO:0032050 clathrin heavy chain binding
2. P GO:1990023 mitotic spindle midzone
2. P GO:0090307 mitotic spindle assembly
2. P GO:0030132 clathrin coat of coated pit
2. P GO:0032133 chromosome passenger complex
2. P GO:0030130 clathrin coat of trans-Golgi network vesicle
2. P GO:1902412 regulation of mitotic cytokinesis
2. P GO:0005684 U2-type spliceosomal complex
2. P GO:0000070 mitotic sister chromatid segregation
2. P GO:0071439 clathrin complex
3. B GO:0006955 immune response
3. B GO:0002224 toll-like receptor signaling pathway
3. B GO:1990225 rhoptry neck
3. B GO:0046789 host cell surface receptor binding
3. B GO:0098609 cell-cell adhesion
3. B GO:0008201 heparin binding
3. B GO:0016324 apical plasma membrane
3. B GO:0044647 host-symbiont bicellular tight junction
3. B GO:0004888 transmembrane signaling receptor activity

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q96HJ3 Coiled-coil domain-containing protein 34 0 2.10e-154 0.0
1. PB Q3UI66 Coiled-coil domain-containing protein 34 1.00e-10 8.81e-71 5.19e-138
2. P O80837 Remorin 8.71e-07 2.98e-02 NA
2. P P08082 Clathrin light chain B 6.25e-04 8.62e-04 NA
2. P P53352 Inner centromere protein 4.61e-03 1.89e-02 NA
2. P Q9VWA1 Clathrin light chain 9.67e-04 1.63e-02 NA
2. P Q84ZT9 Protein WAVE-DAMPENED 2 5.52e-02 8.28e-08 NA
2. P Q6IRU5 Clathrin light chain B 1.41e-02 1.60e-03 NA
2. P Q18452 Protein maph-9 4.05e-04 3.04e-15 NA
2. P P09497 Clathrin light chain B 1.56e-03 1.17e-02 NA
2. P Q8GYX9 Protein WVD2-like 1 4.60e-02 2.45e-02 NA
2. P P50751 Troponin T, cardiac muscle 1.19e-05 8.78e-03 NA
2. P Q9P7H6 Uncharacterized protein C1782.03 1.20e-02 5.04e-03 NA
2. P Q7XKE9 Clathrin light chain 1 8.23e-03 1.23e-03 NA
2. P Q8VDI1 Epithelial-stromal interaction protein 1 7.18e-05 3.15e-03 NA
2. P Q9FFA5 Remorin 1.4 2.77e-05 8.69e-03 NA
2. P P04975 Clathrin light chain B 3.94e-03 8.52e-03 NA
2. P P93788 Remorin 9.11e-08 2.33e-02 NA
2. P Q9D439 Cilia- and flagella-associated protein 53 1.11e-07 4.54e-02 NA
2. P Q8N715 Coiled-coil domain-containing protein 185 1.47e-04 4.31e-03 NA
2. P Q6Z3A8 Clathrin light chain 3 7.70e-03 3.07e-02 NA
2. P F4J5M9 Clathrin light chain 3 9.43e-03 3.70e-05 NA
2. P Q5SNV9 Uncharacterized protein C1orf167 5.22e-02 3.26e-02 NA
2. P J7MDG6 Cytosolic-abundant heat soluble protein 2 2.66e-04 2.83e-03 NA
2. P Q96J88 Epithelial-stromal interaction protein 1 3.13e-05 3.19e-02 NA
3. B Q8ILR9 Protein PF14_0175 NA NA 0.031
3. B Q8IDX6 Reticulocyte-binding protein homolog 2a NA NA 4.14e-08