Summary

Q96J88

Homolog: Q8VDI1.
Function: Epithelial-stromal interaction protein 1.

Statistics

Total GO Annotation: 77
Unique PROST Go: 71
Unique BLAST Go: 6

Total Homologs: 54
Unique PROST Homologs: 50
Unique BLAST Homologs: 1

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q8VDI1 (Epithelial-stromal interaction protein 1) with a FATCAT P-Value: 3.03e-11 and RMSD of 3.31 angstrom. The sequence alignment identity is 66.0%.
Structural alignment shown in left. Query protein Q96J88 colored as red in alignment, homolog Q8VDI1 colored as blue. Query protein Q96J88 is also shown in right top, homolog Q8VDI1 showed in right bottom. They are colored based on secondary structures. 

  Q96J88 MNTRNRVVNSGLGASPASRPTRDPQDPSGRQGELSPVEDQREGLE-AAPKGPSRESVVHAGQRRTSAYTLIAPNINRRNEIQRIAEQELANLEKWKEQNR 99
  Q8VDI1 MYTRSKVVGPGLGTSSIS---RD-HAGAGQRRELGLQQNRRQSLEVAAPEGPKMERQGHADQGSAGTYTLIAPNESRRQKIQRIAEQELADLERWKQQNR 96

  Q96J88 AKPVHLVPRRLGGSQSETEVRQKQQLQLMQSKYKQKLKREESVRIKKEAEEAELQKMKAIQREKSNKLEEKKRLQENLRREAFREHQQYKTAEFLSKLNT 199
  Q8VDI1 AKPVYLVPQRLGGSQSEAEVRQKQQLQQMRSKYQQKLKRDESIRIRKEAEEAKFQKMKAIQREKSNKLEEKKQLQEDIRRATFREHHQSKTAELLSRLDT 196

  Q96J88 ESPDRSACQSAVCGP--QSSTWKLPILPRDHSWARSWAYRDSLKAEENRKLQKMKDEQHQKSELLELKRQQQEQERAKIHQTEHRRVNNAFLDRLQGKSQ 297
  Q8VDI1 ERRNRSAC--LIAPPATQSSRWKLPVLLRDPSWAGSQAHRDSPQKEDNPRLQKTRD-GHQKNKLLETKGQHQEEERAQIHQAEHWRVNNAFLDRLQGKSQ 293

  Q96J88 PGGLEQSGGCWNMNSGNSWGI 318
  Q8VDI1 PGGLEQSGGCCNMNSTDSWGL 314

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0016032 viral process
2. P GO:0005881 cytoplasmic microtubule
2. P GO:0055009 atrial cardiac muscle tissue morphogenesis
2. P GO:0006942 regulation of striated muscle contraction
2. P GO:0031110 regulation of microtubule polymerization or depolymerization
2. P GO:0005874 microtubule
2. P GO:0031444 slow-twitch skeletal muscle fiber contraction
2. P GO:1903612 positive regulation of calcium-dependent ATPase activity
2. P GO:0006937 regulation of muscle contraction
2. P GO:0030172 troponin C binding
2. P GO:1990584 cardiac Troponin complex
2. P GO:0061436 establishment of skin barrier
2. P GO:0035024 negative regulation of Rho protein signal transduction
2. P GO:0031115 negative regulation of microtubule polymerization
2. P GO:0030016 myofibril
2. P GO:0048306 calcium-dependent protein binding
2. P GO:0007507 heart development
2. P GO:0007409 axonogenesis
2. P GO:0097546 ciliary base
2. P GO:0005523 tropomyosin binding
2. P GO:0032958 inositol phosphate biosynthetic process
2. P GO:0031013 troponin I binding
2. P GO:0048012 hepatocyte growth factor receptor signaling pathway
2. P GO:0044877 protein-containing complex binding
2. P GO:0051592 response to calcium ion
2. P GO:0097512 cardiac myofibril
2. P GO:0051764 actin crosslink formation
2. P GO:0000828 inositol hexakisphosphate kinase activity
2. P GO:0007052 mitotic spindle organization
2. P GO:0032781 positive regulation of ATP-dependent activity
2. P GO:0045214 sarcomere organization
2. P GO:0005930 axoneme
2. P GO:0005929 cilium
2. P GO:0061966 establishment of left/right asymmetry
2. P GO:0030049 muscle filament sliding
2. P GO:0008016 regulation of heart contraction
2. P GO:0070495 negative regulation of thrombin-activated receptor signaling pathway
2. P GO:0007019 microtubule depolymerization
2. P GO:0045932 negative regulation of muscle contraction
2. P GO:0043462 regulation of ATP-dependent activity
2. P GO:0009617 response to bacterium
2. P GO:0007420 brain development
2. P GO:1905098 negative regulation of guanyl-nucleotide exchange factor activity
2. P GO:0005861 troponin complex
2. P GO:0043005 neuron projection
2. P GO:0003341 cilium movement
2. P GO:0005200 structural constituent of cytoskeleton
2. P GO:0060048 cardiac muscle contraction
2. P GO:0055010 ventricular cardiac muscle tissue morphogenesis
2. P GO:0060287 epithelial cilium movement involved in determination of left/right asymmetry
2. P GO:0060271 cilium assembly
2. P GO:0003009 skeletal muscle contraction
2. P GO:0014883 transition between fast and slow fiber
2. P GO:0051272 positive regulation of cellular component movement
2. P GO:0031175 neuron projection development
2. P GO:0032972 regulation of muscle filament sliding speed
2. P GO:0005865 striated muscle thin filament
2. P GO:0006936 muscle contraction
2. P GO:0007368 determination of left/right symmetry
2. P GO:0031014 troponin T binding
2. P GO:0015630 microtubule cytoskeleton
2. P GO:0003779 actin binding
2. P GO:0009615 response to virus
2. P GO:0000281 mitotic cytokinesis
2. P GO:0032780 negative regulation of ATP-dependent activity
2. P GO:0015631 tubulin binding
2. P GO:0039644 suppression by virus of host NF-kappaB cascade
2. P GO:0097729 9+2 motile cilium
2. P GO:0030017 sarcomere
2. P GO:0051497 negative regulation of stress fiber assembly
2. P GO:0030674 protein-macromolecule adaptor activity
3. B GO:0098609 cell-cell adhesion
3. B GO:0008201 heparin binding
3. B GO:0016324 apical plasma membrane
3. B GO:1990225 rhoptry neck
3. B GO:0044647 host-symbiont bicellular tight junction
3. B GO:0046789 host cell surface receptor binding

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q5BK43 Epithelial-stromal interaction protein 1 7.24e-11 6.31e-32 3.14e-137
1. PB Q8VDI1 Epithelial-stromal interaction protein 1 3.03e-11 1.65e-42 1.07e-135
1. PB Q96J88 Epithelial-stromal interaction protein 1 0 5.36e-146 0.0
2. P A9YWH3 Stathmin 3.20e-05 2.04e-07 NA
2. P Q9UL16 Cilia- and flagella-associated protein 45 1.67e-03 5.22e-08 NA
2. P Q0VFZ6 Coiled-coil domain-containing protein 173 6.62e-05 8.01e-05 NA
2. P A0JLY1 Coiled-coil domain-containing protein 173 9.05e-06 1.23e-02 NA
2. P Q96M91 Cilia- and flagella-associated protein 53 3.78e-04 1.13e-03 NA
2. P Q8MKI3 Troponin T, fast skeletal muscle 4.78e-05 1.04e-07 NA
2. P Q54B75 Uncharacterized protein DDB_G0293860 2.37e-05 9.94e-03 NA
2. P Q4R712 Stathmin 1.92e-05 2.04e-07 NA
2. P P50751 Troponin T, cardiac muscle 6.07e-05 1.59e-10 NA
2. P Q6DUB7 Stathmin 2.12e-05 2.04e-07 NA
2. P A8I9E8 Cilia- and flagella-associated protein 45 3.38e-04 1.03e-11 NA
2. P Q7TNB2 Troponin T, slow skeletal muscle 2.42e-05 2.93e-06 NA
2. P Q3T078 Enkurin domain-containing protein 1 1.47e-02 1.35e-02 NA
2. P P16949 Stathmin 2.22e-05 2.04e-07 NA
2. P Q3UI66 Coiled-coil domain-containing protein 34 3.20e-04 6.36e-07 NA
2. P Q9QZ47 Troponin T, fast skeletal muscle 6.61e-08 1.42e-06 NA
2. P P0C747 HTLV-1 basic zipper factor NA 5.57e-04 NA
2. P Q96HJ3 Coiled-coil domain-containing protein 34 1.70e-04 7.49e-03 NA
2. P O88346 Troponin T, slow skeletal muscle 3.85e-07 3.63e-06 NA
2. P P31395 Stathmin 1.01e-03 2.93e-06 NA
2. P Q9D439 Cilia- and flagella-associated protein 53 3.45e-05 3.30e-06 NA
2. P P50752 Troponin T, cardiac muscle 9.12e-06 1.63e-07 NA
2. P Q9NVL8 Uncharacterized protein CCDC198 1.08e-01 9.38e-03 NA
2. P P09741 Troponin T, cardiac muscle 5.51e-05 1.81e-08 NA
2. P Q75NG9 Troponin T, fast skeletal muscle 3.58e-08 2.82e-07 NA
2. P P06398 Troponin T, fast skeletal muscle isoforms 1.34e-04 2.38e-04 NA
2. P Q3T0C7 Stathmin 4.08e-04 2.04e-07 NA
2. P P50753 Troponin T, cardiac muscle 2.26e-05 1.18e-07 NA
2. P P0C746 HTLV-1 basic zipper factor NA 3.18e-04 NA
2. P P02642 Troponin T, cardiac muscle isoforms 2.40e-07 5.36e-07 NA
2. P Q75ZZ6 Troponin T, slow skeletal muscle 9.45e-05 5.17e-06 NA
2. P Q6CNQ3 rRNA-processing protein CGR1 9.26e-04 3.69e-02 NA
2. P P02641 Troponin T, fast skeletal muscle 2.46e-05 1.85e-09 NA
2. P P45379 Troponin T, cardiac muscle 8.30e-08 8.92e-09 NA
2. P P13789 Troponin T, cardiac muscle 7.28e-06 1.80e-09 NA
2. P Q7TSV9 Enkurin domain-containing protein 1 2.63e-03 7.63e-04 NA
2. P P09739 Troponin T, fast skeletal muscle 2.23e-07 8.28e-05 NA
2. P P13805 Troponin T, slow skeletal muscle 6.60e-05 2.16e-02 NA
2. P P13668 Stathmin 3.87e-05 7.46e-08 NA
2. P P0C745 HTLV-1 basic zipper factor NA 2.82e-04 NA
2. P Q9ASW8 Protein WVD2-like 2 7.75e-02 4.29e-02 NA
2. P Q8N715 Coiled-coil domain-containing protein 185 5.54e-05 3.56e-02 NA
2. P P45378 Troponin T, fast skeletal muscle 6.70e-08 3.79e-08 NA
2. P P54227 Stathmin 2.19e-05 7.95e-08 NA
2. P Q8MKH6 Troponin T, slow skeletal muscle 1.93e-05 7.68e-06 NA
2. P P12620 Troponin T, fast skeletal muscle isoforms 3.02e-08 2.02e-04 NA
2. P Q9H0I2 Enkurin domain-containing protein 1 9.37e-03 1.74e-03 NA
2. P Q8R0E5 Putative uncharacterized protein ZNRD1-AS1 8.61e-03 1.78e-03 NA
2. P A0A0R4IFG5 Cilia- and flagella-associated protein 53 1.27e-04 1.42e-06 NA
2. P Q09006 Stathmin-1-A 3.85e-05 1.15e-04 NA
3. B Q8IDX6 Reticulocyte-binding protein homolog 2a NA NA 0.021