Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
Q8VDI1
(Epithelial-stromal interaction protein 1) with a FATCAT P-Value: 3.03e-11 and RMSD of 3.31 angstrom. The sequence alignment identity is 66.0%.
Structural alignment shown in left. Query protein Q96J88 colored as red in alignment, homolog Q8VDI1 colored as blue.
Query protein Q96J88 is also shown in right top, homolog Q8VDI1 showed in right bottom. They are colored based on secondary structures.
Q96J88 MNTRNRVVNSGLGASPASRPTRDPQDPSGRQGELSPVEDQREGLE-AAPKGPSRESVVHAGQRRTSAYTLIAPNINRRNEIQRIAEQELANLEKWKEQNR 99 Q8VDI1 MYTRSKVVGPGLGTSSIS---RD-HAGAGQRRELGLQQNRRQSLEVAAPEGPKMERQGHADQGSAGTYTLIAPNESRRQKIQRIAEQELADLERWKQQNR 96 Q96J88 AKPVHLVPRRLGGSQSETEVRQKQQLQLMQSKYKQKLKREESVRIKKEAEEAELQKMKAIQREKSNKLEEKKRLQENLRREAFREHQQYKTAEFLSKLNT 199 Q8VDI1 AKPVYLVPQRLGGSQSEAEVRQKQQLQQMRSKYQQKLKRDESIRIRKEAEEAKFQKMKAIQREKSNKLEEKKQLQEDIRRATFREHHQSKTAELLSRLDT 196 Q96J88 ESPDRSACQSAVCGP--QSSTWKLPILPRDHSWARSWAYRDSLKAEENRKLQKMKDEQHQKSELLELKRQQQEQERAKIHQTEHRRVNNAFLDRLQGKSQ 297 Q8VDI1 ERRNRSAC--LIAPPATQSSRWKLPVLLRDPSWAGSQAHRDSPQKEDNPRLQKTRD-GHQKNKLLETKGQHQEEERAQIHQAEHWRVNNAFLDRLQGKSQ 293 Q96J88 PGGLEQSGGCWNMNSGNSWGI 318 Q8VDI1 PGGLEQSGGCCNMNSTDSWGL 314
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 2. P | GO:0016032 | viral process |
| 2. P | GO:0005881 | cytoplasmic microtubule |
| 2. P | GO:0055009 | atrial cardiac muscle tissue morphogenesis |
| 2. P | GO:0006942 | regulation of striated muscle contraction |
| 2. P | GO:0031110 | regulation of microtubule polymerization or depolymerization |
| 2. P | GO:0005874 | microtubule |
| 2. P | GO:0031444 | slow-twitch skeletal muscle fiber contraction |
| 2. P | GO:1903612 | positive regulation of calcium-dependent ATPase activity |
| 2. P | GO:0006937 | regulation of muscle contraction |
| 2. P | GO:0030172 | troponin C binding |
| 2. P | GO:1990584 | cardiac Troponin complex |
| 2. P | GO:0061436 | establishment of skin barrier |
| 2. P | GO:0035024 | negative regulation of Rho protein signal transduction |
| 2. P | GO:0031115 | negative regulation of microtubule polymerization |
| 2. P | GO:0030016 | myofibril |
| 2. P | GO:0048306 | calcium-dependent protein binding |
| 2. P | GO:0007507 | heart development |
| 2. P | GO:0007409 | axonogenesis |
| 2. P | GO:0097546 | ciliary base |
| 2. P | GO:0005523 | tropomyosin binding |
| 2. P | GO:0032958 | inositol phosphate biosynthetic process |
| 2. P | GO:0031013 | troponin I binding |
| 2. P | GO:0048012 | hepatocyte growth factor receptor signaling pathway |
| 2. P | GO:0044877 | protein-containing complex binding |
| 2. P | GO:0051592 | response to calcium ion |
| 2. P | GO:0097512 | cardiac myofibril |
| 2. P | GO:0051764 | actin crosslink formation |
| 2. P | GO:0000828 | inositol hexakisphosphate kinase activity |
| 2. P | GO:0007052 | mitotic spindle organization |
| 2. P | GO:0032781 | positive regulation of ATP-dependent activity |
| 2. P | GO:0045214 | sarcomere organization |
| 2. P | GO:0005930 | axoneme |
| 2. P | GO:0005929 | cilium |
| 2. P | GO:0061966 | establishment of left/right asymmetry |
| 2. P | GO:0030049 | muscle filament sliding |
| 2. P | GO:0008016 | regulation of heart contraction |
| 2. P | GO:0070495 | negative regulation of thrombin-activated receptor signaling pathway |
| 2. P | GO:0007019 | microtubule depolymerization |
| 2. P | GO:0045932 | negative regulation of muscle contraction |
| 2. P | GO:0043462 | regulation of ATP-dependent activity |
| 2. P | GO:0009617 | response to bacterium |
| 2. P | GO:0007420 | brain development |
| 2. P | GO:1905098 | negative regulation of guanyl-nucleotide exchange factor activity |
| 2. P | GO:0005861 | troponin complex |
| 2. P | GO:0043005 | neuron projection |
| 2. P | GO:0003341 | cilium movement |
| 2. P | GO:0005200 | structural constituent of cytoskeleton |
| 2. P | GO:0060048 | cardiac muscle contraction |
| 2. P | GO:0055010 | ventricular cardiac muscle tissue morphogenesis |
| 2. P | GO:0060287 | epithelial cilium movement involved in determination of left/right asymmetry |
| 2. P | GO:0060271 | cilium assembly |
| 2. P | GO:0003009 | skeletal muscle contraction |
| 2. P | GO:0014883 | transition between fast and slow fiber |
| 2. P | GO:0051272 | positive regulation of cellular component movement |
| 2. P | GO:0031175 | neuron projection development |
| 2. P | GO:0032972 | regulation of muscle filament sliding speed |
| 2. P | GO:0005865 | striated muscle thin filament |
| 2. P | GO:0006936 | muscle contraction |
| 2. P | GO:0007368 | determination of left/right symmetry |
| 2. P | GO:0031014 | troponin T binding |
| 2. P | GO:0015630 | microtubule cytoskeleton |
| 2. P | GO:0003779 | actin binding |
| 2. P | GO:0009615 | response to virus |
| 2. P | GO:0000281 | mitotic cytokinesis |
| 2. P | GO:0032780 | negative regulation of ATP-dependent activity |
| 2. P | GO:0015631 | tubulin binding |
| 2. P | GO:0039644 | suppression by virus of host NF-kappaB cascade |
| 2. P | GO:0097729 | 9+2 motile cilium |
| 2. P | GO:0030017 | sarcomere |
| 2. P | GO:0051497 | negative regulation of stress fiber assembly |
| 2. P | GO:0030674 | protein-macromolecule adaptor activity |
| 3. B | GO:0098609 | cell-cell adhesion |
| 3. B | GO:0008201 | heparin binding |
| 3. B | GO:0016324 | apical plasma membrane |
| 3. B | GO:1990225 | rhoptry neck |
| 3. B | GO:0044647 | host-symbiont bicellular tight junction |
| 3. B | GO:0046789 | host cell surface receptor binding |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q5BK43 | Epithelial-stromal interaction protein 1 | 7.24e-11 | 6.31e-32 | 3.14e-137 |
| 1. PB | Q8VDI1 | Epithelial-stromal interaction protein 1 | 3.03e-11 | 1.65e-42 | 1.07e-135 |
| 1. PB | Q96J88 | Epithelial-stromal interaction protein 1 | 0 | 5.36e-146 | 0.0 |
| 2. P | A9YWH3 | Stathmin | 3.20e-05 | 2.04e-07 | NA |
| 2. P | Q9UL16 | Cilia- and flagella-associated protein 45 | 1.67e-03 | 5.22e-08 | NA |
| 2. P | Q0VFZ6 | Coiled-coil domain-containing protein 173 | 6.62e-05 | 8.01e-05 | NA |
| 2. P | A0JLY1 | Coiled-coil domain-containing protein 173 | 9.05e-06 | 1.23e-02 | NA |
| 2. P | Q96M91 | Cilia- and flagella-associated protein 53 | 3.78e-04 | 1.13e-03 | NA |
| 2. P | Q8MKI3 | Troponin T, fast skeletal muscle | 4.78e-05 | 1.04e-07 | NA |
| 2. P | Q54B75 | Uncharacterized protein DDB_G0293860 | 2.37e-05 | 9.94e-03 | NA |
| 2. P | Q4R712 | Stathmin | 1.92e-05 | 2.04e-07 | NA |
| 2. P | P50751 | Troponin T, cardiac muscle | 6.07e-05 | 1.59e-10 | NA |
| 2. P | Q6DUB7 | Stathmin | 2.12e-05 | 2.04e-07 | NA |
| 2. P | A8I9E8 | Cilia- and flagella-associated protein 45 | 3.38e-04 | 1.03e-11 | NA |
| 2. P | Q7TNB2 | Troponin T, slow skeletal muscle | 2.42e-05 | 2.93e-06 | NA |
| 2. P | Q3T078 | Enkurin domain-containing protein 1 | 1.47e-02 | 1.35e-02 | NA |
| 2. P | P16949 | Stathmin | 2.22e-05 | 2.04e-07 | NA |
| 2. P | Q3UI66 | Coiled-coil domain-containing protein 34 | 3.20e-04 | 6.36e-07 | NA |
| 2. P | Q9QZ47 | Troponin T, fast skeletal muscle | 6.61e-08 | 1.42e-06 | NA |
| 2. P | P0C747 | HTLV-1 basic zipper factor | NA | 5.57e-04 | NA |
| 2. P | Q96HJ3 | Coiled-coil domain-containing protein 34 | 1.70e-04 | 7.49e-03 | NA |
| 2. P | O88346 | Troponin T, slow skeletal muscle | 3.85e-07 | 3.63e-06 | NA |
| 2. P | P31395 | Stathmin | 1.01e-03 | 2.93e-06 | NA |
| 2. P | Q9D439 | Cilia- and flagella-associated protein 53 | 3.45e-05 | 3.30e-06 | NA |
| 2. P | P50752 | Troponin T, cardiac muscle | 9.12e-06 | 1.63e-07 | NA |
| 2. P | Q9NVL8 | Uncharacterized protein CCDC198 | 1.08e-01 | 9.38e-03 | NA |
| 2. P | P09741 | Troponin T, cardiac muscle | 5.51e-05 | 1.81e-08 | NA |
| 2. P | Q75NG9 | Troponin T, fast skeletal muscle | 3.58e-08 | 2.82e-07 | NA |
| 2. P | P06398 | Troponin T, fast skeletal muscle isoforms | 1.34e-04 | 2.38e-04 | NA |
| 2. P | Q3T0C7 | Stathmin | 4.08e-04 | 2.04e-07 | NA |
| 2. P | P50753 | Troponin T, cardiac muscle | 2.26e-05 | 1.18e-07 | NA |
| 2. P | P0C746 | HTLV-1 basic zipper factor | NA | 3.18e-04 | NA |
| 2. P | P02642 | Troponin T, cardiac muscle isoforms | 2.40e-07 | 5.36e-07 | NA |
| 2. P | Q75ZZ6 | Troponin T, slow skeletal muscle | 9.45e-05 | 5.17e-06 | NA |
| 2. P | Q6CNQ3 | rRNA-processing protein CGR1 | 9.26e-04 | 3.69e-02 | NA |
| 2. P | P02641 | Troponin T, fast skeletal muscle | 2.46e-05 | 1.85e-09 | NA |
| 2. P | P45379 | Troponin T, cardiac muscle | 8.30e-08 | 8.92e-09 | NA |
| 2. P | P13789 | Troponin T, cardiac muscle | 7.28e-06 | 1.80e-09 | NA |
| 2. P | Q7TSV9 | Enkurin domain-containing protein 1 | 2.63e-03 | 7.63e-04 | NA |
| 2. P | P09739 | Troponin T, fast skeletal muscle | 2.23e-07 | 8.28e-05 | NA |
| 2. P | P13805 | Troponin T, slow skeletal muscle | 6.60e-05 | 2.16e-02 | NA |
| 2. P | P13668 | Stathmin | 3.87e-05 | 7.46e-08 | NA |
| 2. P | P0C745 | HTLV-1 basic zipper factor | NA | 2.82e-04 | NA |
| 2. P | Q9ASW8 | Protein WVD2-like 2 | 7.75e-02 | 4.29e-02 | NA |
| 2. P | Q8N715 | Coiled-coil domain-containing protein 185 | 5.54e-05 | 3.56e-02 | NA |
| 2. P | P45378 | Troponin T, fast skeletal muscle | 6.70e-08 | 3.79e-08 | NA |
| 2. P | P54227 | Stathmin | 2.19e-05 | 7.95e-08 | NA |
| 2. P | Q8MKH6 | Troponin T, slow skeletal muscle | 1.93e-05 | 7.68e-06 | NA |
| 2. P | P12620 | Troponin T, fast skeletal muscle isoforms | 3.02e-08 | 2.02e-04 | NA |
| 2. P | Q9H0I2 | Enkurin domain-containing protein 1 | 9.37e-03 | 1.74e-03 | NA |
| 2. P | Q8R0E5 | Putative uncharacterized protein ZNRD1-AS1 | 8.61e-03 | 1.78e-03 | NA |
| 2. P | A0A0R4IFG5 | Cilia- and flagella-associated protein 53 | 1.27e-04 | 1.42e-06 | NA |
| 2. P | Q09006 | Stathmin-1-A | 3.85e-05 | 1.15e-04 | NA |
| 3. B | Q8IDX6 | Reticulocyte-binding protein homolog 2a | NA | NA | 0.021 |