Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
Q0P5X1
(Leucine-rich repeat and IQ domain-containing protein 1) with a FATCAT P-Value: 2.16e-06 and RMSD of 17.61 angstrom. The sequence alignment identity is 57.1%.
Structural alignment shown in left. Query protein Q96JM4 colored as red in alignment, homolog Q0P5X1 colored as blue.
Query protein Q96JM4 is also shown in right top, homolog Q0P5X1 showed in right bottom. They are colored based on secondary structures.
Q96JM4 MDD-DD--AKLKAEIEAELDKLSISSLEKEDIESDAKSETQSDDSDTDSVELPESVLHCINIIKNRSKAVEELILQDLEDTDILS-----CSYGAVSNNH 92 Q0P5X1 MEDSDDSEAKLREEIEAELDKISISSLENDEVENDSVSDTQSDSSDTDLLELPESVLHYINVIKNKSKTAEELILQDVEDTDIFSDYKKGCNHGTVTDSH 100 Q96JM4 MHLRTG-LSTEYEESSEQLIKILSEIEKEEFMRS---KTDCAT-PDFVPEPSPHDLPMDEHVLPDDADINFGYCEVEEKCRQSFEAWQEKQKELEDKEKQ 187 Q0P5X1 MHLRTGSL-PESKANAEQLMKILSVIEKEEFMRSLAPSARCVSVREII---TP-DTPMDEYILPDEADLSFGYFEVEERCRKSFEAWQDKQQELEEKDKE 195 Q96JM4 TLKAQRDREEKQFQEEEEKRHCWMKQFKVEKKKLENIQKQEQDKMNDELYKEEKIWKEKFKQHEEYIRNLHLQMEEERTRFKDQQEKEKNSLLKQQNNAA 287 Q0P5X1 TLEAQNEREKRTFQEEDEKRQCWMRQFEVEKKHLEDLQKQDQDKMNDELHKEEKIWKEKYRQHEEHIRNLHLKMEEERTRLSELQEKEKARLFKLRYDAA 295 Q96JM4 VKIQAKYKAFVAYQKYGPIIKEQIESKKRKAQEWKEKEAKIRQKEEENRKRLEEEQRIKEERKKQKEEERKRREKEYEEKKNIVKQEREQLISKEKIILR 387 Q0P5X1 VKIQATYRASVTYRKYSPIIKEQMEKKRRRAQELKEKEAKIRQKEEEKRRRLEEEQRVEEEKKKKMLEERRRREREYEEKKSILRQEREEQRSKEVIRLR 395 Q96JM4 EDASQQLIISSALKKSGYNNKHLSLEDISNDKGDIAKNLVDENSKKQEDVLLWLVEESNMKENVDRQTI-LKESIQVKLKESISSQTILADFKMEEK--- 483 Q0P5X1 EHAHSPLIITCALKKGDCHGKQQAIAHVPKGKGTIAKESVDSNSKKQEDA--CLAQQLNKRENTHVQQLAMKKSTGIKLK---PNQAILVELKMNEKNES 490 Q96JM4 ------NENLAKKRCSEELVKQERKYENTDNKTELGNSDLKGNLKEQFPLQELKSDAQKEEKIMKHVINENTGQKTQIILGHNQEISEVKTNEEQKIIKD 577 Q0P5X1 LPKLKINENLSKNQCSEQPSDQEFNAENVDQKNELENSNLKESVNEQYPWQGLESDTQTEEHV-EHVREEKVGQETEKLFGFNQEVSAEDSKQAQGVMEE 589 Q96JM4 NQQKKIQKVEKEEIQEQNGLLYKD-KDTLVISVKQRSL-SLTSENSKDVRENVIL---QEKEIYSKSKEIEENPKDNAWNSGIV-----IFNTTDTMINI 667 Q0P5X1 TREGLAEEIEIKEMTQQGG--PSDENNSSPISM-QKSLPSLTPDNPEPVERSVTLEEDQETDL--KSERIEEIPEE-----GVLSCDAAVIN-ADASVHT 678 Q96JM4 EGKRND-QDYVLGRHAPCE--GLSNYNAESSMVSKEV-NSLKSEIRNISEKCHENAPEPDS-MTCCVSESTLLYSIEERRLAWIKSFKPWLEIFKQNQQK 762 Q0P5X1 EG-EADLQDSASGKLAPSEEAG--SHSANNLLATEEVEDSPKSEIQEALEKGQQTKAEADGVLTCSVSQLTVLSSVEERRLAWVKTFKPWAEIFEQNQHK 775 Q96JM4 KIVRRKRPVKCPANMTPALDKLEILRCGPWDTLQQVTTVTFQDLPGCVLSTLAECTNLQFLSLRRCGLTSLHSLSNCKKLKYIDAQENHIEAIECENLEN 862 Q0P5X1 KIVKKRRLVKCPPNTMPPLDPSAILQYGPWKSLKQVPVITFQGLPGCSLSTLAECSNLQILSLRRCGLTSLQGLSHCTRLKYIDAQENHIEAISCENLEN 875 Q96JM4 LCVVLLNKNQLTSLHGLDGCTNIQCLELSYNKITRIGYSFFLEEKLVDNAGFCHHLGTSTSYLSLAQVWIPTGLCWSWIPITSLTKNSDCNFLISHLYWN 962 Q0P5X1 LSVVLLNNNLLTSIHGFDGCTNLQSLELSHNKITRIS--------------------------------------------------------------- 912 Q96JM4 CGLESLKNLQQLILDHNQLINTKGLCDTPTIVYLDCSHNHLTDVEGVENCGLLQILKLQGNYLSELPSLENLVLLRELHLDDNSISTVEAFSSYWLPLLQ 1062 Q0P5X1 -GLESLKYLQELTVDHNQLISTKGLCEAPTIVYLDCSHNHLTGIDGIGNCGLLQIIKLQGNYLREPPSLRNHVLLRELHLDDNSISSVEGLSSCWLPLLQ 1011 Q96JM4 NITISQNSLTKIVPLFHFVSLEKLDVSHNCLSDLKSAIKWFDACYSLHELSLTGNPLLQETNWRDSLLKVLPALRILNGNILNSNSESRTEE--HNQLGS 1160 Q0P5X1 YLSISQNSLATIVPLFHLVSLEKLDVSNNCLSDLTNVMCWFNACYSLRELCLTGNPVLQEINWRDSILKTLPALRVLNGDMLNSYANDRIEEHYHQDLRC 1111 Q96JM4 AGFLALCQSQIREFNLLIENYITGKGDVFTLDTAENLCHYFKKLMILSTEYRHAHERGDVTITKKDESEAQKNHLAP--TNSDSTLQNGVFY----SCAR 1254 Q0P5X1 --LLALCQYQLQEFNLLPEKYITQKRDILTLHAVDRLSQYYKDLMKLSHECRRAHEQGDVNTTERSAAETNKNH--PDFSNTDSALQNKTLHAQTNSC-- 1205 Q96JM4 EGEPDSPDI-PEKWMDSVSSHSPLSKSATCENMEGRHQEILVCQKREDSKASSIPTIRIPFKEVVMTNSLLRNHQNIE---PSEKIMAAVVIQSYWRGYL 1350 Q0P5X1 --EADSPATSPNP-LDTV--FRP-STSH-CEELRGRNQEKLMAHKSEQSRISSRSNSRASFIEMKMADSPMSNHHNAERSSPT-K--AAMVIQAQWRSYI 1295 Q96JM4 MRRQTHFSTRLHTAATEGLPNSSIKNQTILKKGKRENIVNIRKQREKAAILIQAVWKGFILRKKLTTALEAIKNEESDEEYREIDLEDFIFDEAALEEEW 1450 Q0P5X1 AHRQINCSAEMHPTTTEPLQDPLINNQTTSNEERRKTNMDIQEQREKAALHIQAVWKGFILRKKLATARKAIKDEESGEEYEEIDLEDFEFDEDALEKDW 1395 Q96JM4 LALDSTRFPSQTLLLSNQLHWPKIPGNLKWDDTSFNLPSNPAQAWLCNDKENLSSSEHTQFNSRSENKTSSWTPESKTSRKSLLKSEKEKKISEEWGFKD 1550 Q0P5X1 PALDSTGFPSQTLPLSNQLPWPKNSRTLRHDETSPTIPVRPAQAWLCNEKENVMSSEYTQLSSRSESGILSWTPDSKTSRKNLLQSEKEEKISEEWGFKD 1495 Q96JM4 ISTAQQMLKRAQKMKSKKLKKKIDSTVRLALFKNNENKVSLPKSPKMVQPRRDGYFEG-I-----EEDPIHKDTTANEKLERNREYTYQWLHTQVGVHET 1644 Q0P5X1 ISTAQQMLKRAKKMKSKKLRKKLEPSVRLALFKKAKNKVSVTKSSKKTQLRRDNYFEAHISSQDEEEEAVSKATAAKEKLERSQEYTYQWLHTQVGFPEA 1595 Q96JM4 TSSRNMKCNHFLPELDPDVLNGGRVQLVARLVSREDTDLDLFSMTNGSALSVNREKKNQAHRHSAGSSSKLWFPSKLI 1722 Q0P5X1 TSSRNLKCNHFLPELDPDVLNGGRVQLVARLVSREDTDLDLFSMTSASALSVNKDKKSQTHRYSTGSSSKLWFPSELI 1673
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0019901 | protein kinase binding |
| 3. B | GO:0140278 | mitotic division septum assembly |
| 3. B | GO:0071666 | Slit-Robo signaling complex |
| 3. B | GO:0035082 | axoneme assembly |
| 3. B | GO:1901970 | positive regulation of mitotic sister chromatid separation |
| 3. B | GO:0042497 | triacyl lipopeptide binding |
| 3. B | GO:0032922 | circadian regulation of gene expression |
| 3. B | GO:2001013 | epithelial cell proliferation involved in renal tubule morphogenesis |
| 3. B | GO:0005686 | U2 snRNP |
| 3. B | GO:0035904 | aorta development |
| 3. B | GO:0044409 | entry into host |
| 3. B | GO:0003351 | epithelial cilium movement involved in extracellular fluid movement |
| 3. B | GO:0045121 | membrane raft |
| 3. B | GO:0010640 | regulation of platelet-derived growth factor receptor signaling pathway |
| 3. B | GO:0055037 | recycling endosome |
| 3. B | GO:0035307 | positive regulation of protein dephosphorylation |
| 3. B | GO:0030539 | male genitalia development |
| 3. B | GO:0034451 | centriolar satellite |
| 3. B | GO:0034123 | positive regulation of toll-like receptor signaling pathway |
| 3. B | GO:0090263 | positive regulation of canonical Wnt signaling pathway |
| 3. B | GO:0045171 | intercellular bridge |
| 3. B | GO:0007605 | sensory perception of sound |
| 3. B | GO:0000389 | mRNA 3'-splice site recognition |
| 3. B | GO:0015459 | potassium channel regulator activity |
| 3. B | GO:0061809 | NAD+ nucleotidase, cyclic ADP-ribose generating |
| 3. B | GO:0071907 | determination of digestive tract left/right asymmetry |
| 3. B | GO:0007190 | activation of adenylate cyclase activity |
| 3. B | GO:0097062 | dendritic spine maintenance |
| 3. B | GO:1901673 | regulation of mitotic spindle assembly |
| 3. B | GO:0016500 | protein-hormone receptor activity |
| 3. B | GO:1902018 | negative regulation of cilium assembly |
| 3. B | GO:0090543 | Flemming body |
| 3. B | GO:0120103 | centriolar subdistal appendage |
| 3. B | GO:0120293 | dynein axonemal particle |
| 3. B | GO:0016201 | synaptic target inhibition |
| 3. B | GO:0048495 | Roundabout binding |
| 3. B | GO:0030620 | U2 snRNA binding |
| 3. B | GO:0008330 | protein tyrosine/threonine phosphatase activity |
| 3. B | GO:0046849 | bone remodeling |
| 3. B | GO:1990030 | pericellular basket |
| 3. B | GO:0032228 | regulation of synaptic transmission, GABAergic |
| 3. B | GO:0097431 | mitotic spindle pole |
| 3. B | GO:0001942 | hair follicle development |
| 3. B | GO:0007268 | chemical synaptic transmission |
| 3. B | GO:0007165 | signal transduction |
| 3. B | GO:0007509 | mesoderm migration involved in gastrulation |
| 3. B | GO:0033566 | gamma-tubulin complex localization |
| 3. B | GO:0004722 | protein serine/threonine phosphatase activity |
| 3. B | GO:0050896 | response to stimulus |
| 3. B | GO:0050919 | negative chemotaxis |
| 3. B | GO:0006954 | inflammatory response |
| 3. B | GO:0072282 | metanephric nephron tubule morphogenesis |
| 3. B | GO:0048132 | female germ-line stem cell asymmetric division |
| 3. B | GO:0005815 | microtubule organizing center |
| 3. B | GO:0030336 | negative regulation of cell migration |
| 3. B | GO:0005524 | ATP binding |
| 3. B | GO:1904027 | negative regulation of collagen fibril organization |
| 3. B | GO:0016323 | basolateral plasma membrane |
| 3. B | GO:0030054 | cell junction |
| 3. B | GO:0070433 | negative regulation of nucleotide-binding oligomerization domain containing 2 signaling pathway |
| 3. B | GO:0106030 | neuron projection fasciculation |
| 3. B | GO:0003341 | cilium movement |
| 3. B | GO:0008076 | voltage-gated potassium channel complex |
| 3. B | GO:0008217 | regulation of blood pressure |
| 3. B | GO:0042995 | cell projection |
| 3. B | GO:0060384 | innervation |
| 3. B | GO:0071910 | determination of liver left/right asymmetry |
| 3. B | GO:0030036 | actin cytoskeleton organization |
| 3. B | GO:0036157 | outer dynein arm |
| 3. B | GO:0007283 | spermatogenesis |
| 3. B | GO:0034134 | toll-like receptor 2 signaling pathway |
| 3. B | GO:0098887 | neurotransmitter receptor transport, endosome to postsynaptic membrane |
| 3. B | GO:0035091 | phosphatidylinositol binding |
| 3. B | GO:0043231 | intracellular membrane-bounded organelle |
| 3. B | GO:0060287 | epithelial cilium movement involved in determination of left/right asymmetry |
| 3. B | GO:0055028 | cortical microtubule |
| 3. B | GO:0038023 | signaling receptor activity |
| 3. B | GO:2001222 | regulation of neuron migration |
| 3. B | GO:0045108 | regulation of intermediate filament polymerization or depolymerization |
| 3. B | GO:0071727 | cellular response to triacyl bacterial lipopeptide |
| 3. B | GO:0070840 | dynein complex binding |
| 3. B | GO:0060285 | cilium-dependent cell motility |
| 3. B | GO:0060972 | left/right pattern formation |
| 3. B | GO:0120229 | protein localization to motile cilium |
| 3. B | GO:0045433 | male courtship behavior, veined wing generated song production |
| 3. B | GO:0009755 | hormone-mediated signaling pathway |
| 3. B | GO:0030030 | cell projection organization |
| 3. B | GO:0036159 | inner dynein arm assembly |
| 3. B | GO:0090619 | meiotic spindle pole |
| 3. B | GO:0001649 | osteoblast differentiation |
| 3. B | GO:0030029 | actin filament-based process |
| 3. B | GO:0048565 | digestive tract development |
| 3. B | GO:0045087 | innate immune response |
| 3. B | GO:0010102 | lateral root morphogenesis |
| 3. B | GO:0051649 | establishment of localization in cell |
| 3. B | GO:0040022 | feminization of hermaphroditic germ-line |
| 3. B | GO:0120163 | negative regulation of cold-induced thermogenesis |
| 3. B | GO:0071638 | negative regulation of monocyte chemotactic protein-1 production |
| 3. B | GO:1905232 | cellular response to L-glutamate |
| 3. B | GO:0071726 | cellular response to diacyl bacterial lipopeptide |
| 3. B | GO:0034146 | toll-like receptor 5 signaling pathway |
| 3. B | GO:0099072 | regulation of postsynaptic membrane neurotransmitter receptor levels |
| 3. B | GO:0060976 | coronary vasculature development |
| 3. B | GO:0030282 | bone mineralization |
| 3. B | GO:0050929 | induction of negative chemotaxis |
| 3. B | GO:0051729 | germline cell cycle switching, mitotic to meiotic cell cycle |
| 3. B | GO:0005176 | ErbB-2 class receptor binding |
| 3. B | GO:0099104 | potassium channel activator activity |
| 3. B | GO:0007411 | axon guidance |
| 3. B | GO:0098633 | collagen fibril binding |
| 3. B | GO:0007160 | cell-matrix adhesion |
| 3. B | GO:0090651 | apical cytoplasm |
| 3. B | GO:0034122 | negative regulation of toll-like receptor signaling pathway |
| 3. B | GO:0010544 | negative regulation of platelet activation |
| 3. B | GO:1902533 | positive regulation of intracellular signal transduction |
| 3. B | GO:0036035 | osteoclast development |
| 3. B | GO:0009574 | preprophase band |
| 3. B | GO:0061512 | protein localization to cilium |
| 3. B | GO:0010632 | regulation of epithelial cell migration |
| 3. B | GO:0030670 | phagocytic vesicle membrane |
| 3. B | GO:0070286 | axonemal dynein complex assembly |
| 3. B | GO:0036158 | outer dynein arm assembly |
| 3. B | GO:1901398 | regulation of transforming growth factor beta3 activation |
| 3. B | GO:0005102 | signaling receptor binding |
| 3. B | GO:0010378 | temperature compensation of the circadian clock |
| 3. B | GO:0090660 | cerebrospinal fluid circulation |
| 3. B | GO:0097581 | lamellipodium organization |
| 3. B | GO:1903818 | positive regulation of voltage-gated potassium channel activity |
| 3. B | GO:0045197 | establishment or maintenance of epithelial cell apical/basal polarity |
| 3. B | GO:0007432 | salivary gland boundary specification |
| 3. B | GO:0045175 | basal protein localization |
| 3. B | GO:0030056 | hemidesmosome |
| 3. B | GO:0001947 | heart looping |
| 3. B | GO:0005149 | interleukin-1 receptor binding |
| 3. B | GO:0035996 | rhabdomere microvillus |
| 3. B | GO:0098968 | neurotransmitter receptor transport postsynaptic membrane to endosome |
| 3. B | GO:0016601 | Rac protein signal transduction |
| 3. B | GO:0002224 | toll-like receptor signaling pathway |
| 3. B | GO:2000274 | regulation of epithelial cell migration, open tracheal system |
| 3. B | GO:0005178 | integrin binding |
| 3. B | GO:0016028 | rhabdomere |
| 3. B | GO:0090190 | positive regulation of branching involved in ureteric bud morphogenesis |
| 3. B | GO:0031012 | extracellular matrix |
| 3. B | GO:0008201 | heparin binding |
| 3. B | GO:0005518 | collagen binding |
| 3. B | GO:0006930 | substrate-dependent cell migration, cell extension |
| 3. B | GO:0035385 | Roundabout signaling pathway |
| 3. B | GO:0050135 | NAD(P)+ nucleosidase activity |
| 3. B | GO:0007099 | centriole replication |
| 3. B | GO:0007502 | digestive tract mesoderm development |
| 3. B | GO:0019888 | protein phosphatase regulator activity |
| 3. B | GO:0042052 | rhabdomere development |
| 3. B | GO:0008092 | cytoskeletal protein binding |
| 3. B | GO:0005930 | axoneme |
| 3. B | GO:0035469 | determination of pancreatic left/right asymmetry |
| 3. B | GO:0032757 | positive regulation of interleukin-8 production |
| 3. B | GO:0007427 | epithelial cell migration, open tracheal system |
| 3. B | GO:0072202 | cell differentiation involved in metanephros development |
| 3. B | GO:0003146 | heart jogging |
| 3. B | GO:0048243 | norepinephrine secretion |
| 3. B | GO:0001817 | regulation of cytokine production |
| 3. B | GO:0061499 | outer plaque of mitotic spindle pole body |
| 3. B | GO:0003281 | ventricular septum development |
| 3. B | GO:0072224 | metanephric glomerulus development |
| 3. B | GO:0007155 | cell adhesion |
| 3. B | GO:0005681 | spliceosomal complex |
| 3. B | GO:0000398 | mRNA splicing, via spliceosome |
| 3. B | GO:0097708 | intracellular vesicle |
| 3. B | GO:0008528 | G protein-coupled peptide receptor activity |
| 3. B | GO:0005814 | centriole |
| 3. B | GO:0003305 | cell migration involved in heart jogging |
| 3. B | GO:0003314 | heart rudiment morphogenesis |
| 3. B | GO:0005618 | cell wall |
| 3. B | GO:0003279 | cardiac septum development |
| 3. B | GO:0071356 | cellular response to tumor necrosis factor |
| 3. B | GO:0031028 | septation initiation signaling |
| 3. B | GO:0061458 | reproductive system development |
| 3. B | GO:0005794 | Golgi apparatus |
| 3. B | GO:0048681 | negative regulation of axon regeneration |
| 3. B | GO:1901388 | regulation of transforming growth factor beta activation |
| 3. B | GO:0060271 | cilium assembly |
| 3. B | GO:0046579 | positive regulation of Ras protein signal transduction |
| 3. B | GO:0048679 | regulation of axon regeneration |
| 3. B | GO:0030317 | flagellated sperm motility |
| 3. B | GO:0002755 | MyD88-dependent toll-like receptor signaling pathway |
| 3. B | GO:0031514 | motile cilium |
| 3. B | GO:2000010 | positive regulation of protein localization to cell surface |
| 3. B | GO:0008078 | mesodermal cell migration |
| 3. B | GO:0051965 | positive regulation of synapse assembly |
| 3. B | GO:0003356 | regulation of cilium beat frequency |
| 3. B | GO:0005813 | centrosome |
| 3. B | GO:0002177 | manchette |
| 3. B | GO:0061290 | canonical Wnt signaling pathway involved in metanephric kidney development |
| 3. B | GO:0032495 | response to muramyl dipeptide |
| 3. B | GO:0015630 | microtubule cytoskeleton |
| 3. B | GO:0046872 | metal ion binding |
| 3. B | GO:0051493 | regulation of cytoskeleton organization |
| 3. B | GO:0032528 | microvillus organization |
| 3. B | GO:0044458 | motile cilium assembly |
| 3. B | GO:0001818 | negative regulation of cytokine production |
| 3. B | GO:0004888 | transmembrane signaling receptor activity |
| 3. B | GO:0015631 | tubulin binding |
| 3. B | GO:0000164 | protein phosphatase type 1 complex |
| 3. B | GO:0036335 | intestinal stem cell homeostasis |
| 3. B | GO:0035239 | tube morphogenesis |
| 3. B | GO:1902412 | regulation of mitotic cytokinesis |
| 3. B | GO:0099572 | postsynaptic specialization |
| 3. B | GO:0051045 | negative regulation of membrane protein ectodomain proteolysis |
| 3. B | GO:1904779 | regulation of protein localization to centrosome |
| 3. B | GO:0032088 | negative regulation of NF-kappaB transcription factor activity |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q96JM4 | Leucine-rich repeat and IQ domain-containing protein 1 | 0 | 2.11e-153 | 0.0 |
| 1. PB | Q0P5X1 | Leucine-rich repeat and IQ domain-containing protein 1 | 2.16e-06 | 1.57e-43 | 0.0 |
| 3. B | O08770 | Platelet glycoprotein V | 3.16e-02 | NA | 1.15e-04 |
| 3. B | Q723X5 | Internalin I | 1.05e-01 | NA | 1.40e-07 |
| 3. B | Q0GC71 | Toll-like receptor 2 | 6.76e-02 | NA | 0.003 |
| 3. B | Q9C099 | Leucine-rich repeat and coiled-coil domain-containing protein 1 | 1.21e-02 | NA | 0.002 |
| 3. B | Q9D3R3 | Centrosomal protein of 72 kDa | 2.09e-01 | NA | 0.029 |
| 3. B | Q9XHH2 | Dynein axonemal light chain 1 | 5.69e-03 | NA | 0.043 |
| 3. B | Q52KR2 | Leucine-rich repeats and immunoglobulin-like domains protein 2 | 2.36e-01 | NA | 0.004 |
| 3. B | P0DJM0 | Internalin A | 1.77e-02 | NA | 4.21e-09 |
| 3. B | B5T267 | Toll-like receptor 2 | NA | NA | 0.002 |
| 3. B | B2LT62 | Toll-like receptor 2 | 1.86e-01 | NA | 0.002 |
| 3. B | B2LT61 | Toll-like receptor 2 | NA | NA | 0.016 |
| 3. B | Q32NT4 | Leucine-rich repeat-containing protein 58 | 6.61e-02 | NA | 0.002 |
| 3. B | C0LGH8 | Probable LRR receptor-like serine/threonine-protein kinase At1g63430 | 3.18e-01 | NA | 0.027 |
| 3. B | P22194 | Protein phosphatase 1 regulatory subunit SDS22 | 8.12e-04 | NA | 0.043 |
| 3. B | A9NGL9 | Ribonuclease Y | 8.60e-02 | NA | 0.003 |
| 3. B | Q9UUG2 | Uncharacterized leucine-rich repeat-containing protein C926.06c | 4.56e-01 | NA | 0.013 |
| 3. B | Q28XE2 | Acidic leucine-rich nuclear phosphoprotein 32 family member A | 2.05e-01 | NA | 0.024 |
| 3. B | Q5RFE9 | Leucine-rich repeat-containing protein 40 | 9.54e-03 | NA | 0.002 |
| 3. B | Q9M6A7 | Leucine-rich repeat receptor-like kinase protein CLV1B | 8.50e-02 | NA | 0.015 |
| 3. B | Q6GQN5 | Protein phosphatase 1 regulatory subunit 42 | 1.72e-02 | NA | 7.35e-05 |
| 3. B | Q8CDN9 | Leucine-rich repeat-containing protein 9 | 1.30e-02 | NA | 5.09e-10 |
| 3. B | Q5HZV9 | Protein phosphatase 1 regulatory subunit 7 | 2.67e-05 | NA | 2.75e-07 |
| 3. B | P82963 | Chaoptin (Fragment) | 4.08e-02 | NA | 0.021 |
| 3. B | O60602 | Toll-like receptor 5 | 1.56e-01 | NA | 0.001 |
| 3. B | Q6NRC9 | Leucine-rich repeat and coiled-coil domain-containing protein 1 | 9.23e-02 | NA | 4.56e-07 |
| 3. B | Q4P5F9 | U2 small nuclear ribonucleoprotein A' | 1.90e-01 | NA | 0.003 |
| 3. B | Q86X45 | Dynein axonemal assembly factor 11 | 1.10e-01 | NA | 0.005 |
| 3. B | Q7AP87 | Internalin H | 2.35e-01 | NA | 1.36e-05 |
| 3. B | Q7Z7A1 | Centriolin | 5.49e-01 | NA | 0.006 |
| 3. B | Q5NVQ6 | Immunoglobulin superfamily containing leucine-rich repeat protein | 3.65e-01 | NA | 0.017 |
| 3. B | Q7SXW3 | Leucine-rich repeat-containing protein 40 | 1.04e-02 | NA | 0.022 |
| 3. B | Q723K6 | Internalin A | 1.79e-02 | NA | 3.65e-10 |
| 3. B | Q96RT1 | Erbin | 7.35e-02 | NA | 6.77e-04 |
| 3. B | Q6P4K6 | Serine/threonine-protein kinase 11-interacting protein | 3.70e-01 | NA | 0.033 |
| 3. B | Q4R747 | Leucine-rich repeat-containing protein 46 | 2.55e-01 | NA | 0.023 |
| 3. B | Q9DBB9 | Carboxypeptidase N subunit 2 | 2.02e-02 | NA | 6.22e-06 |
| 3. B | Q9VPF0 | Protein artichoke | 8.01e-02 | NA | 3.68e-05 |
| 3. B | B0BLW3 | Leucine-rich repeat-containing G-protein coupled receptor 4 | 6.85e-02 | NA | 6.79e-05 |
| 3. B | Q28FY0 | Dynein axonemal assembly factor 11 | 1.33e-01 | NA | 1.63e-04 |
| 3. B | Q9VR52 | Protein tilB | 1.24e-01 | NA | 7.15e-04 |
| 3. B | Q80ZD7 | Amphoterin-induced protein 1 | 4.09e-01 | NA | 0.041 |
| 3. B | Q05070 | Uncharacterized protein alr4393 | 1.47e-01 | NA | 5.82e-04 |
| 3. B | Q5RFS7 | Protein phosphatase 1 regulatory subunit 7 | 1.04e-04 | NA | 3.77e-05 |
| 3. B | P0DQD2 | Internalin B | 9.36e-02 | NA | 1.24e-04 |
| 3. B | Q3UM45 | Protein phosphatase 1 regulatory subunit 7 | 5.41e-05 | NA | 4.50e-06 |
| 3. B | Q9NJE9 | Dynein axonemal assembly factor 11 | 1.93e-01 | NA | 1.04e-05 |
| 3. B | Q6GPJ5 | Leucine-rich repeat-containing protein 40 | 8.22e-03 | NA | 0.005 |
| 3. B | Q14247 | Src substrate cortactin | 9.14e-01 | NA | 0.021 |
| 3. B | P90920 | Leucine-rich repeat-containing protein egg-6 | 1.10e-01 | NA | 7.04e-07 |
| 3. B | Q96QE4 | Leucine-rich repeat-containing protein 37B | 2.35e-01 | NA | 0.043 |
| 3. B | F4IIU4 | 187-kDa microtubule-associated protein AIR9 | 4.70e-01 | NA | 0.002 |
| 3. B | Q9RBS2 | Protein PopC | 3.24e-02 | NA | 0.008 |
| 3. B | A8IVX2 | Dynein regulatory complex subunit 3 | 9.44e-02 | NA | 0.002 |
| 3. B | Q6C417 | U2 small nuclear ribonucleoprotein A' | 5.63e-02 | NA | 0.006 |
| 3. B | Q6ZRR7 | Leucine-rich repeat-containing protein 9 | 7.91e-02 | NA | 4.84e-10 |
| 3. B | F1MCA7 | Leucine-rich repeat-containing protein 7 | 3.06e-02 | NA | 8.77e-05 |
| 3. B | O61967 | Protein lap1 | 7.02e-02 | NA | 0.007 |
| 3. B | B2LT65 | Toll-like receptor 2 | 9.92e-02 | NA | 0.002 |
| 3. B | Q16RY9 | Dynein axonemal assembly factor 1 homolog | 2.00e-01 | NA | 2.96e-08 |
| 3. B | Q69ZB0 | Leucine-rich repeat and coiled-coil domain-containing protein 1 | 6.49e-02 | NA | 2.33e-04 |
| 3. B | A4IMH1 | Ribonuclease Y | 1.44e-01 | NA | 0.004 |
| 3. B | Q80TM9 | Nischarin | 3.14e-01 | NA | 1.12e-05 |
| 3. B | Q9USX8 | U2 small nuclear ribonucleoprotein A' | 1.95e-01 | NA | 0.002 |
| 3. B | Q14392 | Transforming growth factor beta activator LRRC32 | 1.54e-02 | NA | 0.013 |
| 3. B | Q6AYH9 | Dynein axonemal assembly factor 1 | 1.50e-01 | NA | 1.66e-05 |
| 3. B | F1MLX5 | Leucine-rich repeat-containing G-protein coupled receptor 4 | 5.71e-03 | NA | 1.03e-04 |
| 3. B | Q7ZV84 | Dynein axonemal assembly factor 1 | 3.89e-02 | NA | 0.005 |
| 3. B | Q6DIQ3 | Protein phosphatase 1 regulatory subunit 7 | 2.03e-05 | NA | 4.40e-07 |
| 3. B | Q9D2H9 | Dynein axonemal assembly factor 1 | 1.10e-01 | NA | 1.01e-05 |
| 3. B | Q5PPX0 | Protein phosphatase 1 regulatory subunit 42 | 5.58e-02 | NA | 0.001 |
| 3. B | Q4R803 | Protein phosphatase 1 regulatory subunit 42 | 1.20e-02 | NA | 0.002 |
| 3. B | B0W6M9 | Leucine-rich repeat protein soc-2 homolog | 1.03e-02 | NA | 0.003 |
| 3. B | Q2V897 | Toll-like receptor 2 | 4.90e-02 | NA | 0.002 |
| 3. B | O02833 | Insulin-like growth factor-binding protein complex acid labile subunit | 3.83e-02 | NA | 0.026 |
| 3. B | Q38SD2 | Leucine-rich repeat serine/threonine-protein kinase 1 | 2.89e-01 | NA | 0.005 |
| 3. B | B4P6W7 | Dynein axonemal assembly factor 1 homolog | 3.76e-02 | NA | 5.48e-07 |
| 3. B | Q96M69 | Leucine-rich repeat and guanylate kinase domain-containing protein | 1.41e-01 | NA | 2.04e-06 |
| 3. B | P12024 | Chaoptin | 1.17e-01 | NA | 5.56e-06 |
| 3. B | Q8IUZ0 | Leucine-rich repeat-containing protein 49 | 3.77e-03 | NA | 2.05e-06 |
| 3. B | Q4R3F0 | Protein tilB homolog | 1.46e-01 | NA | 0.006 |
| 3. B | Q32KP2 | Leucine-rich repeat-containing protein 23 | 5.09e-03 | NA | 0.002 |
| 3. B | B6D5P3 | Dynein axonemal assembly factor 1 | 2.91e-01 | NA | 6.95e-06 |
| 3. B | O14498 | Immunoglobulin superfamily containing leucine-rich repeat protein | 4.90e-01 | NA | 0.009 |
| 3. B | Q5M8G4 | Leucine-rich repeat-containing protein 40 | 2.56e-03 | NA | 0.032 |
| 3. B | Q6GPJ8 | Centrosomal protein of 97 kDa | 5.18e-02 | NA | 0.037 |
| 3. B | Q9BXB1 | Leucine-rich repeat-containing G-protein coupled receptor 4 | 1.84e-01 | NA | 2.16e-05 |
| 3. B | Q53EV4 | Leucine-rich repeat-containing protein 23 | 2.89e-03 | NA | 0.034 |
| 3. B | Q505F5 | Leucine-rich repeat-containing protein 47 | 1.29e-01 | NA | 4.55e-06 |
| 3. B | Q8YA32 | Internalin I | 6.42e-02 | NA | 2.52e-09 |
| 3. B | Q54Y32 | MAP kinase phosphatase with leucine-rich repeats protein 3 | 1.32e-01 | NA | 0.029 |
| 3. B | B4GT53 | Dynein axonemal assembly factor 1 homolog | 3.01e-01 | NA | 5.46e-06 |
| 3. B | Q5ZLN0 | Leucine-rich repeat-containing protein 40 | 9.29e-03 | NA | 0.002 |
| 3. B | Q28CU0 | Leucine-rich repeat-containing protein 23 | 2.08e-03 | NA | 0.016 |
| 3. B | B9F655 | Plant intracellular Ras-group-related LRR protein 7 | 1.17e-01 | NA | 0.033 |
| 3. B | Q91YK0 | Leucine-rich repeat-containing protein 49 | 7.27e-02 | NA | 2.33e-04 |
| 3. B | A0JM56 | Leucine-rich repeat-containing protein 9 | 5.49e-02 | NA | 3.69e-08 |
| 3. B | Q4R3P6 | Leucine-rich repeat-containing protein 40 | 1.46e-02 | NA | 0.002 |
| 3. B | P24014 | Protein slit | 2.05e-01 | NA | 0.003 |
| 3. B | O94898 | Leucine-rich repeats and immunoglobulin-like domains protein 2 | 2.86e-01 | NA | 0.005 |
| 3. B | Q4G017 | Nischarin | 4.06e-01 | NA | 2.25e-05 |
| 3. B | Q4R6X9 | Dynein regulatory complex subunit 3 | 7.82e-02 | NA | 2.38e-04 |
| 3. B | Q15435 | Protein phosphatase 1 regulatory subunit 7 | 7.03e-05 | NA | 1.20e-06 |
| 3. B | B6D5P1 | Dynein axonemal assembly factor 1 | 6.55e-02 | NA | 6.01e-06 |
| 3. B | Q9BLB6 | Probable U2 small nuclear ribonucleoprotein A' | 2.57e-01 | NA | 0.003 |
| 3. B | Q28G94 | Dynein axonemal light chain 1 | 4.64e-03 | NA | 0.007 |
| 3. B | P0DQD3 | Internalin B | 1.59e-01 | NA | 1.39e-04 |
| 3. B | Q8IW35 | Centrosomal protein of 97 kDa | 7.05e-02 | NA | 5.52e-08 |
| 3. B | Q80TH2 | Erbin | 2.75e-02 | NA | 0.008 |
| 3. B | Q8C0R9 | Leucine-rich repeat and death domain-containing protein 1 | 8.28e-03 | NA | 1.99e-04 |
| 3. B | Q9Y2I1 | Nischarin | 2.44e-01 | NA | 1.09e-04 |
| 3. B | Q9H9A6 | Leucine-rich repeat-containing protein 40 | 8.82e-03 | NA | 0.002 |
| 3. B | O74473 | Septation initiation network scaffold protein cdc11 | 9.62e-02 | NA | 0.007 |
| 3. B | O08742 | Platelet glycoprotein V | 3.60e-02 | NA | 9.48e-05 |
| 3. B | E9Q7T7 | Chondroadherin-like protein | 5.21e-02 | NA | 1.42e-04 |
| 3. B | A2AL36 | Centriolin | 1.61e-01 | NA | 0.002 |
| 3. B | Q54Q39 | Protein phosphatase 1 regulatory subunit pprA | 2.18e-04 | NA | 2.35e-05 |
| 3. B | Q9CZ62 | Centrosomal protein of 97 kDa | 6.30e-02 | NA | 3.10e-07 |
| 3. B | B3NLX1 | Dynein axonemal assembly factor 1 homolog | 2.18e-01 | NA | 4.01e-08 |
| 3. B | Q84WJ9 | Protein phosphatase 1 regulatory inhibitor subunit PPP1R7 homolog | 2.42e-05 | NA | 0.001 |
| 3. B | G2K3G6 | Internalin A | 1.84e-02 | NA | 5.26e-10 |
| 3. B | Q91W20 | Leucine-rich repeat-containing protein 26 | 1.57e-01 | NA | 0.019 |
| 3. B | Q29KL8 | Dynein axonemal assembly factor 1 homolog | 1.68e-01 | NA | 7.85e-06 |
| 3. B | B6D5P6 | Dynein axonemal assembly factor 1 | 2.29e-01 | NA | 6.78e-06 |
| 3. B | Q689D1 | Toll-like receptor 2 | 2.20e-01 | NA | 0.039 |
| 3. B | Q32PL1 | Protein phosphatase 1 regulatory subunit 7 | 1.14e-04 | NA | 4.11e-07 |
| 3. B | P17778 | Outer membrane protein YopM | 2.27e-02 | NA | 0.002 |
| 3. B | Q96FV0 | Leucine-rich repeat-containing protein 46 | 1.14e-01 | NA | 0.041 |
| 3. B | A0A1L8G016 | Dynein axonemal assembly factor 11 | 9.29e-02 | NA | 3.88e-04 |
| 3. B | Q9Z2H4 | Leucine-rich repeat-containing G-protein coupled receptor 4 | 2.39e-02 | NA | 9.28e-06 |
| 3. B | Q9D5E4 | Dynein regulatory complex subunit 3 | 7.68e-02 | NA | 0.001 |
| 3. B | B2LT64 | Toll-like receptor 2 | 6.11e-02 | NA | 0.014 |
| 3. B | Q8BGX3 | Leucine-rich repeat and transmembrane domain-containing protein 2 | 1.22e-01 | NA | 0.031 |
| 3. B | Q95LA9 | Toll-like receptor 2 | 8.87e-02 | NA | 0.002 |
| 3. B | A4D1F6 | Leucine-rich repeat and death domain-containing protein 1 | 7.54e-03 | NA | 1.09e-04 |
| 3. B | Q9H069 | Dynein regulatory complex subunit 3 | 7.95e-02 | NA | 0.007 |
| 3. B | Q3T0W4 | Protein phosphatase 1 regulatory subunit 7 | 2.29e-05 | NA | 6.59e-07 |
| 3. B | Q8INT5 | Dynein axonemal assembly factor 1 homolog | 5.73e-02 | NA | 8.18e-07 |
| 3. B | Q5F4C4 | Leucine-rich repeat protein SHOC-2 | 2.46e-02 | NA | 4.48e-04 |
| 3. B | Q9JLF7 | Toll-like receptor 5 | 6.57e-02 | NA | 3.40e-04 |
| 3. B | Q9D5S7 | Leucine-rich repeat and guanylate kinase domain-containing protein | 1.18e-01 | NA | 9.96e-06 |
| 3. B | Q2PZH4 | Toll-like receptor 2 | 7.16e-02 | NA | 0.003 |
| 3. B | O35125 | Leucine-rich repeat-containing protein 23 | 1.18e-03 | NA | 2.04e-05 |