Summary

Q96LY2

Homolog: Q96AQ1.
Function: Coiled-coil domain-containing protein 74A.

Statistics

Total GO Annotation: 57
Unique PROST Go: 52
Unique BLAST Go: 4

Total Homologs: 29
Unique PROST Homologs: 26
Unique BLAST Homologs: 1

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q96AQ1 (Coiled-coil domain-containing protein 74A) with a FATCAT P-Value: 2e-07 and RMSD of 6.93 angstrom. The sequence alignment identity is 97.6%.
Structural alignment shown in left. Query protein Q96LY2 colored as red in alignment, homolog Q96AQ1 colored as blue. Query protein Q96LY2 is also shown in right top, homolog Q96AQ1 showed in right bottom. They are colored based on secondary structures. 

  Q96LY2 MSGAGVAAGTRPPSSPTPGSRRRRQRPSVGVQSLRPQSPQLRQSDPQKRNLDLEKSLQFLQQQHSEMLAKLHEEIEHLKRENKDLRYKLIMNQTSQKKDG 100
  Q96AQ1 MSGAGVAAGTRPPSSPTPGSRRRRQRPSVGVQSLRPQSPQLRQSDPQKRNLDLEKSLQFLQQQHSEMLAKLHEEIEHLKRENKDLHYKLIMNQTSQKKDG 100

  Q96LY2 PSGNHLSRASAPLGARWVCINGVWVEPGGPSPARLKEGSSRTHRPGGKHGRLAGGSADTVRSPADSLSTSSFQSVKSISNSGKARPQPGSFNKQDSKADV 200
  Q96AQ1 PSGNHLSRASAPLGARWVCINGVWVEPGGPSPARLKEGSSRTHRPGGKRGRLAGGSADTVRSPADSLSMSSFQSVKSISNSGKARPQPGSFNKQDSKADV 200

  Q96LY2 PQKADLEEEPLLHNSKLDKVPGVQGQARKEKAEASNAGAACMGNSQHQGRQMGAAAHPPMILPLPLRKPTTLRQCEVLIRELWNTNLLQTQELQHLKSLL 300
  Q96AQ1 SQKADLEEEPLLHNSKLDKVPGVQGQARKEKAEASNAGAACMGNSQHQGRQMGAGAHPPMILPLPLRKPTTLRQCEVLIRELWNTNLLQTQELRHLKSLL 300

  Q96LY2 EGSQRPQAVPEEASFPRDQEATHFPKVSTKSLSKKCLLLSPPVAERAILPALKQTPKNNFAERQKRLQAMQKRRLHRSVL 380
  Q96AQ1 EGSQRPQAAPEEASFPRDQEATHFPKVSTKSLSKKC--LSPPVAERAILPALKQTPKNNFAERQKRLQAMQKRRLHRSVL 378

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0005813 centrosome
2. P GO:0007317 regulation of pole plasm oskar mRNA localization
2. P GO:0045132 meiotic chromosome segregation
2. P GO:0008608 attachment of spindle microtubules to kinetochore
2. P GO:0007309 oocyte axis specification
2. P GO:0051301 cell division
2. P GO:0005881 cytoplasmic microtubule
2. P GO:0000775 chromosome, centromeric region
2. P GO:0000406 double-strand/single-strand DNA junction binding
2. P GO:0007051 spindle organization
2. P GO:0043296 apical junction complex
2. P GO:0001779 natural killer cell differentiation
2. P GO:0140463 chromatin-protein adaptor
2. P GO:0039021 pronephric glomerulus development
2. P GO:0003094 glomerular filtration
2. P GO:0045892 negative regulation of transcription, DNA-templated
2. P GO:0007623 circadian rhythm
2. P GO:0006955 immune response
2. P GO:0071962 mitotic sister chromatid cohesion, centromeric
2. P GO:0071353 cellular response to interleukin-4
2. P GO:0007059 chromosome segregation
2. P GO:0008103 oocyte microtubule cytoskeleton polarization
2. P GO:0000922 spindle pole
2. P GO:0007314 oocyte anterior/posterior axis specification
2. P GO:0048741 skeletal muscle fiber development
2. P GO:0008407 chaeta morphogenesis
2. P GO:0070336 flap-structured DNA binding
2. P GO:0021987 cerebral cortex development
2. P GO:0019900 kinase binding
2. P GO:0045143 homologous chromosome segregation
2. P GO:0010457 centriole-centriole cohesion
2. P GO:0000779 condensed chromosome, centromeric region
2. P GO:0005923 bicellular tight junction
2. P GO:0006366 transcription by RNA polymerase II
2. P GO:0005634 nucleus
2. P GO:0034090 maintenance of meiotic sister chromatid cohesion
2. P GO:0010792 DNA double-strand break processing involved in repair via single-strand annealing
2. P GO:1904801 positive regulation of neuron remodeling
2. P GO:0000014 single-stranded DNA endodeoxyribonuclease activity
2. P GO:0005816 spindle pole body
2. P GO:0090575 RNA polymerase II transcription regulator complex
2. P GO:0045144 meiotic sister chromatid segregation
2. P GO:0016325 oocyte microtubule cytoskeleton organization
2. P GO:0005912 adherens junction
2. P GO:0051177 meiotic sister chromatid cohesion
2. P GO:0000403 Y-form DNA binding
2. P GO:0000776 kinetochore
2. P GO:0042734 presynaptic membrane
2. P GO:0017075 syntaxin-1 binding
2. P GO:0000785 chromatin
2. P GO:0000070 mitotic sister chromatid segregation
2. P GO:0036091 positive regulation of transcription from RNA polymerase II promoter in response to oxidative stress
2. P GO:0008301 DNA binding, bending
3. B GO:0043231 intracellular membrane-bounded organelle
3. B GO:0005814 centriole
3. B GO:0042802 identical protein binding
3. B GO:0005654 nucleoplasm

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q96LY2 Coiled-coil domain-containing protein 74B 0 3.02e-155 0.0
1. PB Q96AQ1 Coiled-coil domain-containing protein 74A 2.00e-07 7.69e-107 0.0
2. P Q1RMX6 Coiled-coil domain-containing protein 190 4.79e-03 7.28e-05 NA
2. P Q5FW38 Nuclear factor interleukin-3-regulated protein 2.28e-02 4.23e-04 NA
2. P Q6NZK5 Protein hinderin 1.68e-02 2.90e-03 NA
2. P Q01663 AP-1-like transcription factor 1.26e-02 1.26e-02 NA
2. P Q4V872 Coiled-coil domain-containing protein 85C 3.74e-02 1.32e-02 NA
2. P B5DF41 Syntaphilin 5.62e-02 2.89e-02 NA
2. P Q759Q5 Shugoshin 1.32e-01 1.90e-03 NA
2. P Q16649 Nuclear factor interleukin-3-regulated protein 1.86e-02 2.31e-02 NA
2. P Q86T90 Protein hinderin 1.34e-01 1.92e-04 NA
2. P Q9CXH7 Shugoshin 1 4.30e-02 3.95e-05 NA
2. P E9Q6B2 Coiled-coil domain-containing protein 85C 1.69e-01 1.10e-04 NA
2. P Q6FLP6 Spindle pole body component SPC42 3.90e-02 6.71e-07 NA
2. P Q0V989 Coiled-coil domain-containing protein 85C 1.24e-01 1.26e-02 NA
2. P E3VXF2 Shugoshin-1 1.87e-02 1.60e-03 NA
2. P Q4QSC8 Shugoshin-1 3.52e-02 1.39e-03 NA
2. P Q9V9Y9 Protein spindle-F 3.68e-01 4.28e-03 NA
2. P Q2M2Z5 Centrosomal protein kizuna 2.01e-02 3.58e-03 NA
2. P Q66J36 Nuclear factor interleukin-3-regulated protein 7.09e-03 2.90e-03 NA
2. P A6NKD9 Coiled-coil domain-containing protein 85C 5.11e-02 4.20e-03 NA
2. P Q5FBB7 Shugoshin 1 5.24e-02 2.57e-04 NA
2. P A6QNQ6 DNA endonuclease RBBP8 7.43e-02 9.37e-04 NA
2. P Q0WTB8 SHUGOSHIN 2 3.01e-02 3.27e-02 NA
2. P C5E4H7 Spindle pole body component SPC42 1.01e-01 2.61e-02 NA
2. P Q0KK56 Protein FAM184B 1.31e-01 3.21e-03 NA
2. P Q0P485 Coiled-coil domain-containing protein 85C-A 6.49e-03 4.96e-02 NA
2. P Q96PX6 Coiled-coil domain-containing protein 85A 1.44e-02 2.15e-05 NA
3. B Q53HC0 Coiled-coil domain-containing protein 92 5.87e-02 NA 0.012