Summary

Q96M66

Homolog: I0J062.
Function: Proapoptotic nucleolar protein 1.

Statistics

Total GO Annotation: 48
Unique PROST Go: 48
Unique BLAST Go: 0

Total Homologs: 41
Unique PROST Homologs: 40
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was I0J062 (Proapoptotic nucleolar protein 1) with a FATCAT P-Value: 0.0146 and RMSD of 5.83 angstrom. The sequence alignment identity is 25.5%.
Structural alignment shown in left. Query protein Q96M66 colored as red in alignment, homolog I0J062 colored as blue. Query protein Q96M66 is also shown in right top, homolog I0J062 showed in right bottom. They are colored based on secondary structures. 

  Q96M66 --------MAAKSTQDSLPRDTGE-PSALPVQG---------RAEG-RSSE----GRKERTAE----CALRGKQASEPA------LRKRNFLP---G--P 62
  I0J062 MGVRLRVWPAAPHSISRCPRPLGAVLSIL-LAGGSRKGTPTARCLGQRTKEKRVGGRSLRSEAGSGPCPTAGAQPTAPSSAWPPRLRPRT-CPQMSGELP 98

  Q96M66 NSDTVRPAAETELVPCSL----RHP----RQDLCGEHPSFPVMQPSLETQAKPERDRA-VLIP--PK-----GPWPPAQGLAMRTHCPTGPPSKAYCRGG 146
  I0J062 R---VRP---TRVGLSSLGSGPGHPPSGTR--MCGE-------------RARNRRGRARRLTPEQPRIGASAGPGPP---L---------PPARPRCSGS 165

  Q96M66 SSSTSRNQVASLAYRTQNTAASQPRQPG----G--RG--KEDTAGYGS-------CSPRSLAV 194
  I0J062 ---------CHLP-RPPQ-HLSPP-QPGRVRMGAAEGSRRADTH-HARRRRRARLPAPRSAST 215

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:1905747 negative regulation of saliva secretion
2. P GO:0098583 learned vocalization behavior
2. P GO:0021559 trigeminal nerve development
2. P GO:0044196 host cell nucleolus
2. P GO:0051028 mRNA transport
2. P GO:0005884 actin filament
2. P GO:0030430 host cell cytoplasm
2. P GO:0009630 gravitropism
2. P GO:1902103 negative regulation of metaphase/anaphase transition of meiotic cell cycle
2. P GO:0097094 craniofacial suture morphogenesis
2. P GO:0031223 auditory behavior
2. P GO:1990948 ubiquitin ligase inhibitor activity
2. P GO:0039540 suppression by virus of host viral-induced cytoplasmic pattern recognition receptor signaling pathway via inhibition of host RIG-I activity
2. P GO:0005547 phosphatidylinositol-3,4,5-trisphosphate binding
2. P GO:0021650 vestibulocochlear nerve formation
2. P GO:1901078 negative regulation of relaxation of muscle
2. P GO:0040008 regulation of growth
2. P GO:0005198 structural molecule activity
2. P GO:0048806 genitalia development
2. P GO:0090103 cochlea morphogenesis
2. P GO:0042472 inner ear morphogenesis
2. P GO:0051017 actin filament bundle assembly
2. P GO:0030432 peristalsis
2. P GO:0046660 female sex differentiation
2. P GO:0061572 actin filament bundle organization
2. P GO:0035375 zymogen binding
2. P GO:0090102 cochlea development
2. P GO:0007356 thorax and anterior abdomen determination
2. P GO:1990946 meiosis I/meiosis II transition
2. P GO:0032435 negative regulation of proteasomal ubiquitin-dependent protein catabolic process
2. P GO:0005882 intermediate filament
2. P GO:0031647 regulation of protein stability
2. P GO:0005546 phosphatidylinositol-4,5-bisphosphate binding
2. P GO:0048634 regulation of muscle organ development
2. P GO:0019028 viral capsid
2. P GO:0071626 mastication
2. P GO:0097655 serpin family protein binding
2. P GO:1905187 negative regulation of metaphase/anaphase transition of meiosis I
2. P GO:0044220 host cell perinuclear region of cytoplasm
2. P GO:1905748 hard palate morphogenesis
2. P GO:0051494 negative regulation of cytoskeleton organization
2. P GO:0001848 complement binding
2. P GO:0016476 regulation of embryonic cell shape
2. P GO:0035112 genitalia morphogenesis
2. P GO:0050885 neuromuscular process controlling balance
2. P GO:0110069 syncytial embryo cellularization
2. P GO:0048839 inner ear development
2. P GO:0046740 transport of virus in host, cell to cell

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q96M66 Putative uncharacterized protein FLJ32790 0 5.90e-145 2.00e-139
2. P P40794 Protein bottleneck 5.26e-01 3.16e-02 NA
2. P A8MZ25 Putative uncharacterized protein FLJ38767 2.25e-02 1.37e-03 NA
2. P Q96KT6 Putative uncharacterized protein encoded by LINC00208 2.52e-01 2.33e-02 NA
2. P Q32PB5 Uncharacterized protein C3orf22 homolog 4.35e-01 3.22e-02 NA
2. P Q96LS8 Putative uncharacterized protein C2orf48 4.52e-01 3.91e-05 NA
2. P Q8TF63 Dendritic cell nuclear protein 1 3.52e-02 2.33e-08 NA
2. P Q66K80 Putative uncharacterized protein RUSC1-AS1 9.94e-02 3.19e-07 NA
2. P O14603 PTPN13-like protein, Y-linked 8.48e-01 3.63e-02 NA
2. P P0C045 F protein NA 1.54e-02 NA
2. P Q8IZ16 Uncharacterized protein C7orf61 2.73e-01 2.73e-03 NA
2. P Q1G3U5 Protein LAZY 3 3.66e-01 1.09e-03 NA
2. P P58512 Uncharacterized protein encoded by LINC01547 4.19e-01 9.10e-05 NA
2. P P0C206 Protein Rex NA 4.14e-03 NA
2. P P0C044 F protein NA 4.48e-02 NA
2. P I0J062 Proapoptotic nucleolar protein 1 1.46e-02 2.47e-04 NA
2. P Q5SWW7 Uncharacterized protein C10orf55 3.77e-02 6.49e-05 NA
2. P P0DPF5 Uncharacterized protein C2orf27A 2.67e-02 4.40e-04 NA
2. P Q6ZUL3 Uncharacterized protein C8orf86 8.06e-01 1.19e-03 NA
2. P P17145 Uncharacterized protein US25 NA 3.99e-06 NA
2. P Q04221 Putative trans-acting factor NA 3.54e-03 NA
2. P P47162 Uncharacterized protein YJR128W 8.97e-01 2.68e-05 NA
2. P Q2T9X5 Uncharacterized protein C7orf61 homolog 1.16e-01 3.94e-02 NA
2. P Q5SR53 Putative uncharacterized protein PIK3CD-AS1 2.23e-01 2.24e-02 NA
2. P P41005 Protein mes1 7.71e-02 1.44e-02 NA
2. P P0C205 Protein Rex NA 2.41e-02 NA
2. P Q8NAA6 Putative uncharacterized protein encoded by LINC02694 5.05e-01 2.78e-09 NA
2. P O13999 Meiotically up-regulated gene 155 protein 8.04e-01 4.02e-02 NA
2. P Q6ZRN7 Putative uncharacterized protein FLJ46214 6.14e-02 3.55e-08 NA
2. P A0A023PZL7 Putative uncharacterized protein YMR294W-A 8.10e-01 7.96e-03 NA
2. P U3H040 Uncharacterized protein SPBC18E5.09c 7.76e-01 4.74e-02 NA
2. P Q6PEX3 Keratin-associated protein 26-1 3.56e-02 5.29e-03 NA
2. P Q8NHX4 Spermatogenesis-associated protein 3 1.74e-01 1.37e-02 NA
2. P Q6ZR03 Uncharacterized protein FLJ46757 2.53e-01 1.40e-05 NA
2. P Q5UQP5 Uncharacterized protein R457 NA 9.28e-03 NA
2. P Q8N8H1 Putative protein ZNF321 1.73e-02 1.55e-02 NA
2. P Q8TEE9 Histone deacetylase complex subunit SAP25 2.09e-01 3.66e-02 NA
2. P P0DPF6 Putative uncharacterized protein CDRT15P3 9.82e-03 1.80e-03 NA
2. P P16806 Uncharacterized protein IRL8 NA 6.01e-03 NA
2. P P29046 Movement protein NA 2.94e-02 NA
2. P Q23949 Female-specific protein transformer 3.88e-02 4.40e-02 NA