Summary

Q96M89

Homolog: Q0VF22.
Function: Coiled-coil domain-containing protein 138.

Statistics

Total GO Annotation: 90
Unique PROST Go: 90
Unique BLAST Go: 0

Total Homologs: 41
Unique PROST Homologs: 38
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q0VF22 (Coiled-coil domain-containing protein 138) with a FATCAT P-Value: 1.11e-16 and RMSD of 2.91 angstrom. The sequence alignment identity is 76.9%.
Structural alignment shown in left. Query protein Q96M89 colored as red in alignment, homolog Q0VF22 colored as blue. Query protein Q96M89 is also shown in right top, homolog Q0VF22 showed in right bottom. They are colored based on secondary structures. 

  Q96M89 MEPRVVKPPGQDLVVESLKSRYGLGGSCP----D-----------EYDFSNFYQSKYKRRTLTSPGD-LDIY-SGDKVGSSLK-YSDESKHCRTPLGSLF 82
  Q0VF22 MERRVVKPPGQDMVVERLKSRYGLAGRCPVEENDMTGVWAALMNQQHELSDFDQTKYKRRIVTSP-DGLDTYSSGDKVGSSPRYYSDGRNHPTPPFCSSF 99

  Q96M89 KHVNVNCLDDELDSFHDLKKQETEEELIENDYRVSTSKITKQSFKEIEKVALPTNTTSSRPRTECCSDAG--DSPLKPVSCPKSKASDKRSLLPHQISQI 180
  Q0VF22 KHLNVNCLDDELDSFHDLKKWETEKELMEDDHRDGASKITKQSFKEMETDALMTSMASGL-ETECCS--GSIDSPLKQAVYPRPKVSKKQGLLPHEINQI 196

  Q96M89 YDELFQIHLKLQCETAAQQKFAEELQKRERFLLEREQLLFRHENALSKIKGVEEEVLTRFQIIKEQHDAEVEHLTEVLKEKNKETKRLRSSFDALKELND 280
  Q0VF22 YDELYHIHMKLQYETTAQKKFAEELQKREQFLAEREQLLFSHETALSKIKGVKEEVLTRFQILKEQHGTEIEHLTEALKEKNKENKRMRSSFDTLRELND 296

  Q96M89 TLKKQLNEASEENRKIDIQAKRVQARLDNLQRKYEFMTIQRLKGSSHAVHEMKSLKQEKAPVSKTYKVPLNGQVYELLTVFMDWISDHHLSKVKHEESGM 380
  Q0VF22 NLRKQLNEVSEENKKMEIQAKRVQARLDNLQRKYEFMTVQRLKGDSHAAHEVKSSKQEKAPAPKPFKAALNGQVYELLTVFMDWISDCHLSKVEPEEPGV 396

  Q96M89 DGKKPQLKFASQRNDIQEKCVKLLPLMTEQLQWMPFVNIKLHEPFVKFIYWSLRQLDAGAQHSTMTSTLRRLGEDIFKGVVTKGIQDNSPQHSVENKPKT 480
  Q0VF22 DGGKPPAK-PSQRSDIQEKCVKLLPMMTEQLQWMPLVSAKLHEPFVRFIYWSLRQLDASARQSTMASTLRRLGEDVFKGVTMKGTQDNSLEHSVENKAKT 495

  Q96M89 AAFFKSSNLPLRFLSTLIVLKTVTQADYLAQAFDSLCLDLKTEEGKTLFLEYQAVPVILSHLRISSKGLLSNVIDSLLQMTVESKSLQPFLEACSNSLFF 580
  Q0VF22 AVFFKSSSLPLRFLSTLIVLRTVTQADYLAQAFDSLCLDLKTDEGKTLFLEYQAIPVILKHLRISSKGLLSNVIDSLLQMTVESKSLQPFLEACSNSLFF 595

  Q96M89 RTCSVLLRAPKLDLQILEKLSIILQKLSKIKSNKKLFELFTIHLMLQEIQRTTNPEHAFLCINLNSTLFNLGLTKCNSLVSSASP 665
  Q0VF22 RTCSVLLRTPKLDLHILEKLSIILQKLSKIKSNKKLFEVFTIHLMLQEIQRTTHPEHAFLCINLNSTLFNLGLTKCNSLVTSTSH 680

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0032258 cytoplasm to vacuole transport by the Cvt pathway
2. P GO:0016973 poly(A)+ mRNA export from nucleus
2. P GO:0070530 K63-linked polyubiquitin modification-dependent protein binding
2. P GO:0005881 cytoplasmic microtubule
2. P GO:0034271 phosphatidylinositol 3-kinase complex, class III, type I
2. P GO:0140445 chromosome, telomeric repeat region
2. P GO:0001829 trophectodermal cell differentiation
2. P GO:0045177 apical part of cell
2. P GO:0010607 negative regulation of cytoplasmic mRNA processing body assembly
2. P GO:0005643 nuclear pore
2. P GO:0008283 cell population proliferation
2. P GO:0060296 regulation of cilium beat frequency involved in ciliary motility
2. P GO:0007143 female meiotic nuclear division
2. P GO:0006406 mRNA export from nucleus
2. P GO:0030688 preribosome, small subunit precursor
2. P GO:0034272 phosphatidylinositol 3-kinase complex, class III, type II
2. P GO:0042138 meiotic DNA double-strand break formation
2. P GO:0031062 positive regulation of histone methylation
2. P GO:0001825 blastocyst formation
2. P GO:0031965 nuclear membrane
2. P GO:0007444 imaginal disc development
2. P GO:0001701 in utero embryonic development
2. P GO:0007141 male meiosis I
2. P GO:0031369 translation initiation factor binding
2. P GO:0005543 phospholipid binding
2. P GO:0044614 nuclear pore cytoplasmic filaments
2. P GO:0006661 phosphatidylinositol biosynthetic process
2. P GO:0014010 Schwann cell proliferation
2. P GO:0007348 regulation of syncytial blastoderm mitotic cell cycle
2. P GO:0034046 poly(G) binding
2. P GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
2. P GO:0070198 protein localization to chromosome, telomeric region
2. P GO:0014044 Schwann cell development
2. P GO:1990918 double-strand break repair involved in meiotic recombination
2. P GO:0120095 vacuole-isolation membrane contact site
2. P GO:0007517 muscle organ development
2. P GO:0033314 mitotic DNA replication checkpoint signaling
2. P GO:0036064 ciliary basal body
2. P GO:0017148 negative regulation of translation
2. P GO:0006449 regulation of translational termination
2. P GO:1905339 positive regulation of cohesin unloading
2. P GO:0030515 snoRNA binding
2. P GO:0002151 G-quadruplex RNA binding
2. P GO:0045324 late endosome to vacuole transport
2. P GO:0072710 response to hydroxyurea
2. P GO:0000723 telomere maintenance
2. P GO:0016321 female meiosis chromosome segregation
2. P GO:0007144 female meiosis I
2. P GO:0010044 response to aluminum ion
2. P GO:0030371 translation repressor activity
2. P GO:0000290 deadenylation-dependent decapping of nuclear-transcribed mRNA
2. P GO:0034183 negative regulation of maintenance of mitotic sister chromatid cohesion
2. P GO:1904749 regulation of protein localization to nucleolus
2. P GO:1902751 positive regulation of cell cycle G2/M phase transition
2. P GO:0005814 centriole
2. P GO:0000822 inositol hexakisphosphate binding
2. P GO:0042995 cell projection
2. P GO:0030242 autophagy of peroxisome
2. P GO:0140588 chromatin looping
2. P GO:0072718 response to cisplatin
2. P GO:0016605 PML body
2. P GO:0010332 response to gamma radiation
2. P GO:1902340 negative regulation of chromosome condensation
2. P GO:0060287 epithelial cilium movement involved in determination of left/right asymmetry
2. P GO:0060271 cilium assembly
2. P GO:0005813 centrosome
2. P GO:0043015 gamma-tubulin binding
2. P GO:0015031 protein transport
2. P GO:0005694 chromosome
2. P GO:0000932 P-body
2. P GO:0006409 tRNA export from nucleus
2. P GO:0070507 regulation of microtubule cytoskeleton organization
2. P GO:0006364 rRNA processing
2. P GO:0007064 mitotic sister chromatid cohesion
2. P GO:0014842 regulation of skeletal muscle satellite cell proliferation
2. P GO:0010224 response to UV-B
2. P GO:0016607 nuclear speck
2. P GO:0008266 poly(U) RNA binding
2. P GO:0014037 Schwann cell differentiation
2. P GO:0031573 mitotic intra-S DNA damage checkpoint signaling
2. P GO:0000077 DNA damage checkpoint signaling
2. P GO:0005635 nuclear envelope
2. P GO:0005730 nucleolus
2. P GO:0042802 identical protein binding
2. P GO:0006446 regulation of translational initiation
2. P GO:0033962 P-body assembly
2. P GO:2000288 positive regulation of myoblast proliferation
2. P GO:0070310 ATR-ATRIP complex
2. P GO:0048316 seed development
2. P GO:0005654 nucleoplasm

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q0VF22 Coiled-coil domain-containing protein 138 1.11e-16 5.90e-91 0.0
1. PB Q95JJ5 Coiled-coil domain-containing protein 138 1.42e-12 1.76e-123 0.0
1. PB Q96M89 Coiled-coil domain-containing protein 138 0 7.28e-152 0.0
2. P Q9BY12 S phase cyclin A-associated protein in the endoplasmic reticulum 1.70e-03 3.69e-03 NA
2. P A2ARM1 Protein PAT1 homolog 2 1.87e-02 4.92e-04 NA
2. P Q9D4G2 Heat shock factor 2-binding protein 2.08e-04 2.59e-02 NA
2. P W0TD11 Vacuolar protein sorting-associated protein 30 1.34e-02 1.04e-02 NA
2. P Q8BMG1 ATR-interacting protein 1.72e-05 3.31e-07 NA
2. P Q6DRB1 mRNA export factor GLE1 6.34e-05 6.72e-03 NA
2. P Q32N92 Protein PAT1 homolog 1 3.36e-02 1.61e-02 NA
2. P Q99359 Protein RAD61 7.98e-03 2.24e-03 NA
2. P Q12315 mRNA export factor GLE1 1.73e-04 1.20e-02 NA
2. P Q8R322 mRNA export factor GLE1 4.66e-05 6.33e-06 NA
2. P Q5RAS2 mRNA export factor GLE1 8.09e-05 5.21e-05 NA
2. P Q5E9N0 Bystin 2.81e-02 1.91e-02 NA
2. P Q99P25 Translin-associated factor X-interacting protein 1 6.25e-04 2.72e-02 NA
2. P Q3ZBK7 mRNA export factor GLE1 6.64e-05 1.08e-06 NA
2. P Q4KLN4 mRNA export factor GLE1 2.12e-05 2.55e-05 NA
2. P C9JE40 Protein PAT1 homolog 2 9.88e-03 3.38e-04 NA
2. P P58501 PAX3- and PAX7-binding protein 1 3.13e-03 3.54e-03 NA
2. P Q8IXR5 Protein FAM178B 2.57e-03 1.71e-04 NA
2. P Q5M6W3 Clathrin heavy chain linker domain-containing protein 1 3.34e-04 1.19e-03 NA
2. P P36632 DNA repair protein rad26 9.74e-05 8.49e-06 NA
2. P A2RRV3 Protein PAT1 homolog 1 1.58e-02 4.70e-02 NA
2. P Q0WPZ7 mRNA export factor GLE1 1.12e-04 2.32e-04 NA
2. P Q6IQY5 Centrosomal protein of 70 kDa 7.71e-04 1.03e-03 NA
2. P C8KI33 Protein SENSITIVE TO UV 2 4.69e-03 7.52e-04 NA
2. P Q9Y5B6 PAX3- and PAX7-binding protein 1 1.66e-03 4.29e-03 NA
2. P Q55FW7 mRNA export factor GLE1 7.02e-05 7.60e-04 NA
2. P Q80WL2 Bystin 3.88e-03 9.78e-03 NA
2. P Q53GS7 mRNA export factor GLE1 3.31e-05 3.22e-06 NA
2. P O42958 DNA topoisomerase 2-associated protein pat1 3.50e-03 6.99e-04 NA
2. P Q9VVN4 ATR-interacting protein mus304 5.46e-04 8.18e-07 NA
2. P Q13895 Bystin 2.39e-02 4.74e-02 NA
2. P Q8WXE1 ATR-interacting protein 3.25e-04 1.71e-05 NA
2. P Q8NHQ1 Centrosomal protein of 70 kDa 1.38e-03 5.42e-04 NA
2. P Q9V4W1 mRNA export factor Gle1 6.31e-05 4.84e-03 NA
2. P O54825 Bystin 9.92e-03 3.02e-02 NA
2. P Q4R7V1 Centrosomal protein of 70 kDa 1.73e-03 6.56e-04 NA
2. P Q5PQQ9 Centrosomal protein of 70 kDa 6.60e-04 1.71e-05 NA
2. P Q5RDE3 Centrosomal protein of 70 kDa 8.67e-04 9.00e-04 NA