Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 3. B was
F2Z398
(LMO7 downstream neighbor protein) with a FATCAT P-Value: 0.0419 and RMSD of 1.47 angstrom. The sequence alignment identity is 26.1%.
Structural alignment shown in left. Query protein Q96MD7 colored as red in alignment, homolog F2Z398 colored as blue.
Query protein Q96MD7 is also shown in right top, homolog F2Z398 showed in right bottom. They are colored based on secondary structures.
Q96MD7 MSSQKGNVARSRPQKHQNTFSFKNDKFDKSVQTKKINAKLHDGVCQRCKEVLEWRVKYSKYKPLSKPKKCVKCLQKTVKDSYH----IMCRPCACELEV- 95 F2Z398 -----------------MTW------LDKGVWTQ------ED--ENSC------SFSESDF-P-----GCRDQINPSIPSIWTAVSGMMIS-----LEVR 52 Q96MD7 -CAKCGKKEDIVIPWSL--PLLPRLECSGRILAHHNLRLP-CSSDSPASASRVAGTTGAHHHAQLIFVFLVEMGFHYVGQAGLELLTS 179 F2Z398 WWIK-G-KQGYVI--SLGHALSPRLECSGTFSAHCILGLPGGSSYPPASVSQVVGTTA---------LYLVEEAW---AEAG-KMRS- 122
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 2. P | GO:0007623 | circadian rhythm |
| 2. P | GO:0030674 | protein-macromolecule adaptor activity |
| 2. P | GO:0009909 | regulation of flower development |
| 3. B | GO:0045236 | CXCR chemokine receptor binding |
| 3. B | GO:0018026 | peptidyl-lysine monomethylation |
| 3. B | GO:0044389 | ubiquitin-like protein ligase binding |
| 3. B | GO:0031083 | BLOC-1 complex |
| 3. B | GO:0021549 | cerebellum development |
| 3. B | GO:0046548 | retinal rod cell development |
| 3. B | GO:0031870 | thromboxane A2 receptor binding |
| 3. B | GO:2001020 | regulation of response to DNA damage stimulus |
| 3. B | GO:2000646 | positive regulation of receptor catabolic process |
| 3. B | GO:0035116 | embryonic hindlimb morphogenesis |
| 3. B | GO:1902036 | regulation of hematopoietic stem cell differentiation |
| 3. B | GO:0033365 | protein localization to organelle |
| 3. B | GO:0001736 | establishment of planar polarity |
| 3. B | GO:0006468 | protein phosphorylation |
| 3. B | GO:0036064 | ciliary basal body |
| 3. B | GO:0046329 | negative regulation of JNK cascade |
| 3. B | GO:0097225 | sperm midpiece |
| 3. B | GO:0043584 | nose development |
| 3. B | GO:1990763 | arrestin family protein binding |
| 3. B | GO:0004181 | metallocarboxypeptidase activity |
| 3. B | GO:0002669 | positive regulation of T cell anergy |
| 3. B | GO:0016279 | protein-lysine N-methyltransferase activity |
| 3. B | GO:0048487 | beta-tubulin binding |
| 3. B | GO:0051879 | Hsp90 protein binding |
| 3. B | GO:0007163 | establishment or maintenance of cell polarity |
| 3. B | GO:0001558 | regulation of cell growth |
| 3. B | GO:0070423 | nucleotide-binding oligomerization domain containing signaling pathway |
| 3. B | GO:0000185 | obsolete activation of MAPKKK activity |
| 3. B | GO:0060039 | pericardium development |
| 3. B | GO:0043014 | alpha-tubulin binding |
| 3. B | GO:0050687 | negative regulation of defense response to virus |
| 3. B | GO:0034620 | cellular response to unfolded protein |
| 3. B | GO:0070534 | protein K63-linked ubiquitination |
| 3. B | GO:0018022 | peptidyl-lysine methylation |
| 3. B | GO:0018027 | peptidyl-lysine dimethylation |
| 3. B | GO:0021532 | neural tube patterning |
| 3. B | GO:0006479 | protein methylation |
| 3. B | GO:0030544 | Hsp70 protein binding |
| 3. B | GO:0070936 | protein K48-linked ubiquitination |
| 3. B | GO:0021670 | lateral ventricle development |
| 3. B | GO:0008589 | regulation of smoothened signaling pathway |
| 3. B | GO:0021772 | olfactory bulb development |
| 3. B | GO:0032391 | photoreceptor connecting cilium |
| 3. B | GO:0005879 | axonemal microtubule |
| 3. B | GO:0097014 | ciliary plasm |
| 3. B | GO:0090085 | regulation of protein deubiquitination |
| 3. B | GO:0019787 | ubiquitin-like protein transferase activity |
| 3. B | GO:0005813 | centrosome |
| 3. B | GO:0002177 | manchette |
| 3. B | GO:0010457 | centriole-centriole cohesion |
| 3. B | GO:0007368 | determination of left/right symmetry |
| 3. B | GO:0005829 | cytosol |
| 3. B | GO:0046642 | negative regulation of alpha-beta T cell proliferation |
| 3. B | GO:0035610 | protein side chain deglutamylation |
| 3. B | GO:0035115 | embryonic forelimb morphogenesis |
| 3. B | GO:0090102 | cochlea development |
| 3. B | GO:0045744 | negative regulation of G protein-coupled receptor signaling pathway |
| 3. B | GO:0007257 | obsolete activation of JUN kinase activity |
| 3. B | GO:0008349 | MAP kinase kinase kinase kinase activity |
| 3. B | GO:1905515 | non-motile cilium assembly |
| 3. B | GO:0035519 | protein K29-linked ubiquitination |
| 3. B | GO:0032480 | negative regulation of type I interferon production |
| 3. B | GO:0035253 | ciliary rootlet |
| 3. B | GO:0035869 | ciliary transition zone |
| 3. B | GO:0022038 | corpus callosum development |
| 3. B | GO:1904628 | cellular response to phorbol 13-acetate 12-myristate |
| 3. B | GO:2000772 | regulation of cellular senescence |
| 3. B | GO:0032088 | negative regulation of NF-kappaB transcription factor activity |
| 3. B | GO:0005654 | nucleoplasm |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q96MD7 | Uncharacterized protein C9orf85 | 0 | 9.76e-128 | 6.56e-133 |
| 1. PB | Q68FU5 | Uncharacterized protein C9orf85 homolog | 6.05e-13 | 1.05e-14 | 3.17e-73 |
| 1. PB | Q9CQ90 | Uncharacterized protein C9orf85 homolog | 2.95e-10 | 1.42e-16 | 4.62e-74 |
| 2. P | Q05B49 | UPF0711 protein C18orf21 homolog | 2.52e-01 | 1.95e-02 | NA |
| 2. P | Q1G3I2 | B-box domain protein 30 | 7.05e-01 | 8.42e-03 | NA |
| 2. P | Q32NC0 | UPF0711 protein C18orf21 | 4.56e-01 | 1.06e-02 | NA |
| 3. B | Q68CZ1 | Protein fantom | 9.64e-01 | NA | 3.48e-09 |
| 3. B | A6NJG6 | Arginine-fifty homeobox | 4.46e-01 | NA | 4.16e-05 |
| 3. B | P51957 | Serine/threonine-protein kinase Nek4 | 7.72e-01 | NA | 1.92e-13 |
| 3. B | Q5SR53 | Putative uncharacterized protein PIK3CD-AS1 | 2.45e-01 | NA | 0.034 |
| 3. B | Q8N2A0 | Putative uncharacterized protein encoded by LINC00269 | 8.16e-01 | NA | 8.86e-27 |
| 3. B | Q9NXG0 | Centlein | 8.19e-01 | NA | 0.010 |
| 3. B | A6NIU2 | Putative uncharacterized protein encoded by LINC01549 | 2.61e-01 | NA | 0.026 |
| 3. B | Q8N9N2 | Activating signal cointegrator 1 complex subunit 1 | 6.06e-01 | NA | 2.32e-07 |
| 3. B | Q09FC8 | Zinc finger protein 415 | 9.64e-01 | NA | 4.87e-07 |
| 3. B | Q8TDM0 | Breast carcinoma-amplified sequence 4 | 9.81e-02 | NA | 3.38e-06 |
| 3. B | Q96M98 | Parkin coregulated gene protein | 3.64e-01 | NA | 0.005 |
| 3. B | Q8N976 | Putative uncharacterized protein FLJ38264 | 1.06e-01 | NA | 5.68e-15 |
| 3. B | F2Z398 | LMO7 downstream neighbor protein | 4.19e-02 | NA | 0.001 |
| 3. B | Q5JPI9 | EEF1A lysine methyltransferase 2 | 3.70e-01 | NA | 3.11e-09 |
| 3. B | P78312 | Protein FAM193A | 8.69e-01 | NA | 5.61e-04 |
| 3. B | Q5T7P6 | Transmembrane protein 78 | 3.69e-01 | NA | 0.004 |
| 3. B | Q5H9K5 | Zinc finger matrin-type protein 1 | 7.06e-01 | NA | 2.81e-07 |
| 3. B | A0A096LPI5 | Putative uncharacterized protein CCDC28A-AS1 | 2.19e-01 | NA | 2.70e-15 |
| 3. B | Q8WTZ3 | Zinc finger protein ENSP00000375192 | 3.04e-01 | NA | 1.63e-30 |
| 3. B | Q96J02 | E3 ubiquitin-protein ligase Itchy homolog | 9.44e-01 | NA | 1.48e-07 |
| 3. B | Q92918 | Mitogen-activated protein kinase kinase kinase kinase 1 | 9.61e-01 | NA | 1.87e-07 |
| 3. B | Q8NEM8 | Cytosolic carboxypeptidase 3 | 9.57e-01 | NA | 1.41e-12 |
| 3. B | Q9BUA6 | Myosin regulatory light chain 10 | 3.17e-01 | NA | 0.025 |