Summary

Q96MR6

Homolog: Q6P6T4.
Function: Echinoderm microtubule-associated protein-like 2.

Statistics

Total GO Annotation: 509
Unique PROST Go: 13
Unique BLAST Go: 473

Total Homologs: 534
Unique PROST Homologs: 5
Unique BLAST Homologs: 521

Structures and Sequence Alignment

The best structural homolog that predicted by 3. B was Q6P6T4 (Echinoderm microtubule-associated protein-like 2) with a FATCAT P-Value: 0.0 and RMSD of 2.84 angstrom. The sequence alignment identity is 13.5%.
Structural alignment shown in left. Query protein Q96MR6 colored as red in alignment, homolog Q6P6T4 colored as blue. Query protein Q96MR6 is also shown in right top, homolog Q6P6T4 showed in right bottom. They are colored based on secondary structures. 

  Q96MR6 -------------------------------MSAV---VAQTLHVFGL--RSHVANN------IF-Y--FD--EQIIIFPSG-------NHCVKYNVDQK 46
  Q6P6T4 MSSFGTGKTKEVIFSMEEGSVKMFLRGRPVPM-LIPDELAPT---YSLDTRSELPSSRLKLDWVYGYRGRDCRANLYLLPTGEVVYFVASVAVLYSVEEQ 96

  Q96MR6 WQK-FIPGSEKSQGMLALSISPNRRYLA---ISETVQE-K---PAITIYE---LSSIPCRKRKV-LNNFDFQVQKFISMAFSPDS-KYLLAQTSPPESN- 132
  Q6P6T4 RQRHYL-G--HNDDIKCLAVHPDMVTIATGQVAGTTKEGKPLPPHVRVWDSVSLSTL----HVLGLGVFDRAV---CCVAFSKSNGGNLLCAVD--ESND 184

  Q96MR6 --LVYWLWEKQ-KVMAIVRIDTQ--NNPVYQVSFSPQD-NTQV-CVTGNG---MFKLLRFAE-GTL-KQTS-FQRGE-PQNY-LAHTWV-ADDKIVVGTD 216
  Q6P6T4 HVLSVWDWAKESKV-----VDSKCSNEAVLVATFHPTDPNLLITC--GKSHIYFWSL----EGGNLSKRQGLFEKHEKPK-YVLCVTFLEGGD-VVTG-D 270

  Q96MR6 T-GKLFLFESGDQRWETSIMVKEPTNGSKSLDVIQESESLIEFPPVSSPLPSYEQMVAASSHSQMSMPQVFAIAAYSKGFACSAGPG---RVLLFEKMEE 312
  Q6P6T4 SGGNLYVWGKGGNR----I-----TQ-----EVL-------------------------GAHD----GGVFALCALRDGTLVSGG-GRDRRVVLW----G 322

  Q96MR6 KDFYRESREIRIPVD--P-QSNDPSQSDKQDVLCLCFSPSEETLVASTSKNQ--LYSI-T-MSLTEISKGEPAHFEYLMYPLHSAPITGLATCIRKPLIA 405
  Q6P6T4 SD-YSKVQEVEVPEDFGPVRTVAEGRGD--------------TLYVGTTRNSILLGSVHTGFSL--LVQG---HVEEL-W--------GLATHPSRAQFV 393

  Q96MR6 TCSLDRSIRLWNYETNTLELF-KEYQEEAYSISLHPSGHFIVVGFADKL--RLMNLLID-DIRSFKEYSVRGCGE----CSFS-NGGHLFAAVNG---NV 493
  Q6P6T4 SCGQDKLVHLWSSETHQ-PVWSRSIEDPARSAGFHPSGSVLAVG---TVTGRW--LLLDTDTRDLVAIHTDG-NEQISVVSFSPDGAYL--AV-GSHDNL 483

  Q96MR6 IHVYTTTSLEN----ISSL-K--GHTGKIRSIVWNADDSK--LISGGTDGAVYE---WNLSTGKRETEC-VLKSCSY---NCVTVSPDAKIIFAV---GS 574
  Q6P6T4 VYVYT---VDQGGRKVSRLGKCSGHSSFITHLDW-AQDSTCFVTNSG-D---YEILYWDAATCKQITSADTVRNVQWATATCV-LGFG---VFGIWPEGA 571

  Q96MR6 DHTLKEIADSLILREISAFDVTYTAIVISHSGRMMFVGTSVGTIRAMKYPL--P--LQKEFNEYQAHAGPITKMLLTFDDQFLL-TAAEDGCLFTWKVFD 669
  Q6P6T4 DGT----------------DI--NAVARSHDGNLLVSADDFGKVHLFSYPCCQPRALS---HKYGGHSSHVTNVAFLWDDSMVLTTGGKDTSVLQWRVA- 649

  Q96MR6 KDGRGIKREREVGFAEEVLVTKTDMEEKAQVMLELKTRVEELKMENEYQLRLKDMNYSEKIKELTDKFIQEMESLKTKNQVLRTEKEKQDVYHHEHIEDL 769
  Q6P6T4 ---------------------------------------------------------------------------------------------------- 649

  Q96MR6 LDKQSRELQDMECCNNQKLLLEYEKYQELQLKSQRMQEEYEKQLRDNDETKSQALEELTEFYEAKLQEKTTLLEEAQEDVRQQLREFEETKKQIEEDEDR 869
  Q6P6T4 ---------------------------------------------------------------------------------------------------- 649

  Q96MR6 EIQDIKTKYEKKLRDEKESNLRLKGETGIMRKKFSSLQKEIEERTNDIETLKGEQMKLQGVIKSLEKDIQGLKREIQERDETIQDKEKRIYDLKKKNQEL 969
  Q6P6T4 ---------------------------------------------------------------------------------------------------- 649

  Q96MR6 GKFKFVLDYKIKELKKQIEPRENEIRVMKEQIQEMEAELENFHKQNTQLELNITELWQKLRATDQEMRRERQKERDLEALVKRFKTDLHNCVAYIQEPRL 1069
  Q6P6T4 ---------------------------------------------------------------------------------------------------- 649

  Q96MR6 LKEKVRGLFEKYVQRADMVEIAGLNTDLQQEYTRQREHLERNLATLKKKVVKEGELHRTDYVRIMQENVSLIKEINELRRELKFTRSQVYDLEAALKLTK 1169
  Q6P6T4 ---------------------------------------------------------------------------------------------------- 649

  Q96MR6 KVRPQEVSETEPSRDMLSTAPTARLNEQEETGRIIEMQRLEIQRLRDQIQEQEQVTGFHTLAGVRLPSLSNSEVDLEVKTN 1250
  Q6P6T4 --------------------------------------------------------------------------------- 649

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0035082 axoneme assembly
1. PB GO:0120197 mucociliary clearance
1. PB GO:0007420 brain development
1. PB GO:0032040 small-subunit processome
1. PB GO:0000387 spliceosomal snRNP assembly
1. PB GO:0034719 SMN-Sm protein complex
1. PB GO:0045943 positive regulation of transcription by RNA polymerase I
1. PB GO:0090660 cerebrospinal fluid circulation
1. PB GO:0060271 cilium assembly
1. PB GO:0030317 flagellated sperm motility
1. PB GO:0031514 motile cilium
1. PB GO:0060285 cilium-dependent cell motility
1. PB GO:0007288 sperm axoneme assembly
1. PB GO:0003356 regulation of cilium beat frequency
1. PB GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
1. PB GO:0030621 U4 snRNA binding
1. PB GO:0032797 SMN complex
1. PB GO:0016607 nuclear speck
1. PB GO:0030686 90S preribosome
1. PB GO:0005930 axoneme
1. PB GO:0097729 9+2 motile cilium
1. PB GO:0043022 ribosome binding
1. PB GO:0005654 nucleoplasm
2. P GO:0097504 Gemini of coiled bodies
2. P GO:0016604 nuclear body
2. P GO:0003351 epithelial cilium movement involved in extracellular fluid movement
2. P GO:0034718 SMN-Gemin2 complex
2. P GO:0065003 protein-containing complex assembly
2. P GO:0034455 t-UTP complex
2. P GO:0030622 U4atac snRNA binding
2. P GO:0000340 RNA 7-methylguanosine cap binding
2. P GO:0044458 motile cilium assembly
2. P GO:0017069 snRNA binding
2. P GO:0030619 U1 snRNA binding
2. P GO:0003730 mRNA 3'-UTR binding
2. P GO:0006417 regulation of translation
3. B GO:0021540 corpus callosum morphogenesis
3. B GO:0031932 TORC2 complex
3. B GO:1902510 regulation of apoptotic DNA fragmentation
3. B GO:0005770 late endosome
3. B GO:0007094 mitotic spindle assembly checkpoint signaling
3. B GO:0019226 transmission of nerve impulse
3. B GO:0034450 ubiquitin-ubiquitin ligase activity
3. B GO:0000244 spliceosomal tri-snRNP complex assembly
3. B GO:0008610 lipid biosynthetic process
3. B GO:0005874 microtubule
3. B GO:0032717 negative regulation of interleukin-8 production
3. B GO:1905191 positive regulation of metaphase/anaphase transition of meiosis II
3. B GO:0008283 cell population proliferation
3. B GO:0006368 transcription elongation from RNA polymerase II promoter
3. B GO:0035327
3. B GO:0005080 protein kinase C binding
3. B GO:0042800 histone methyltransferase activity (H3-K4 specific)
3. B GO:1902610 response to N-phenylthiourea
3. B GO:0046548 retinal rod cell development
3. B GO:0047496 vesicle transport along microtubule
3. B GO:2000543 positive regulation of gastrulation
3. B GO:0051013 microtubule severing
3. B GO:0031965 nuclear membrane
3. B GO:0005656 nuclear pre-replicative complex
3. B GO:1903260 protein localization to mating projection tip
3. B GO:0016567 protein ubiquitination
3. B GO:0046469 platelet activating factor metabolic process
3. B GO:0071380 cellular response to prostaglandin E stimulus
3. B GO:0060307 regulation of ventricular cardiac muscle cell membrane repolarization
3. B GO:0051321 meiotic cell cycle
3. B GO:0044877 protein-containing complex binding
3. B GO:0070986 left/right axis specification
3. B GO:0007541 sex determination, primary response to X:A ratio
3. B GO:0007191 adenylate cyclase-activating dopamine receptor signaling pathway
3. B GO:0005576 extracellular region
3. B GO:1905786 positive regulation of anaphase-promoting complex-dependent catabolic process
3. B GO:0019903 protein phosphatase binding
3. B GO:0048359 mucilage metabolic process involved in seed coat development
3. B GO:0120095 vacuole-isolation membrane contact site
3. B GO:2000234 positive regulation of rRNA processing
3. B GO:0051343 positive regulation of cyclic-nucleotide phosphodiesterase activity
3. B GO:0008017 microtubule binding
3. B GO:0008344 adult locomotory behavior
3. B GO:0004842 ubiquitin-protein transferase activity
3. B GO:0120293 dynein axonemal particle
3. B GO:1903467 negative regulation of mitotic DNA replication initiation
3. B GO:0007405 neuroblast proliferation
3. B GO:1990757 ubiquitin ligase activator activity
3. B GO:0097431 mitotic spindle pole
3. B GO:0030902 hindbrain development
3. B GO:0032420 stereocilium
3. B GO:0032956 regulation of actin cytoskeleton organization
3. B GO:0070016 armadillo repeat domain binding
3. B GO:0030914
3. B GO:0050885 neuromuscular process controlling balance
3. B GO:0045722 positive regulation of gluconeogenesis
3. B GO:1904668 positive regulation of ubiquitin protein ligase activity
3. B GO:0010968 regulation of microtubule nucleation
3. B GO:0022618 ribonucleoprotein complex assembly
3. B GO:0043224 nuclear SCF ubiquitin ligase complex
3. B GO:0071540 eukaryotic translation initiation factor 3 complex, eIF3e
3. B GO:0051301 cell division
3. B GO:0008247 1-alkyl-2-acetylglycerophosphocholine esterase complex
3. B GO:0005524 ATP binding
3. B GO:0060256 regulation of flocculation
3. B GO:0010525 regulation of transposition, RNA-mediated
3. B GO:0016579 protein deubiquitination
3. B GO:0034511 U3 snoRNA binding
3. B GO:0030036 actin cytoskeleton organization
3. B GO:0016282 eukaryotic 43S preinitiation complex
3. B GO:0071217 cellular response to external biotic stimulus
3. B GO:0003735 structural constituent of ribosome
3. B GO:0001650 fibrillar center
3. B GO:0017053 transcription repressor complex
3. B GO:0043025 neuronal cell body
3. B GO:2000114 regulation of establishment of cell polarity
3. B GO:0010997 anaphase-promoting complex binding
3. B GO:2001162 positive regulation of histone H3-K79 methylation
3. B GO:0070840 dynein complex binding
3. B GO:1905168 positive regulation of double-strand break repair via homologous recombination
3. B GO:0005886 plasma membrane
3. B GO:0039023 pronephric duct morphogenesis
3. B GO:0045879 negative regulation of smoothened signaling pathway
3. B GO:0061739 protein lipidation involved in autophagosome assembly
3. B GO:0005826 actomyosin contractile ring
3. B GO:0009792 embryo development ending in birth or egg hatching
3. B GO:0072520 seminiferous tubule development
3. B GO:0031931 TORC1 complex
3. B GO:2001268 negative regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway
3. B GO:0051649 establishment of localization in cell
3. B GO:0031145 anaphase-promoting complex-dependent catabolic process
3. B GO:0090129 positive regulation of synapse maturation
3. B GO:0039689 negative stranded viral RNA replication
3. B GO:0040011 locomotion
3. B GO:0090594 inflammatory response to wounding
3. B GO:0090181 regulation of cholesterol metabolic process
3. B GO:0051571 positive regulation of histone H3-K4 methylation
3. B GO:0005671 obsolete Ada2/Gcn5/Ada3 transcription activator complex
3. B GO:0030836 positive regulation of actin filament depolymerization
3. B GO:0005730 nucleolus
3. B GO:0008656 cysteine-type endopeptidase activator activity involved in apoptotic process
3. B GO:0006412 translation
3. B GO:0050765 negative regulation of phagocytosis
3. B GO:0035097 histone methyltransferase complex
3. B GO:0075296 positive regulation of ascospore formation
3. B GO:1990298 bub1-bub3 complex
3. B GO:0043547 positive regulation of GTPase activity
3. B GO:0050909 sensory perception of taste
3. B GO:0036126 sperm flagellum
3. B GO:0090344 negative regulation of cell aging
3. B GO:0001198 negative regulation of mating-type specific transcription from RNA polymerase II promoter
3. B GO:0044665 MLL1/2 complex
3. B GO:0006367 transcription initiation from RNA polymerase II promoter
3. B GO:0008608 attachment of spindle microtubules to kinetochore
3. B GO:0097361 CIA complex
3. B GO:0061003 positive regulation of dendritic spine morphogenesis
3. B GO:0006886 intracellular protein transport
3. B GO:0048711 positive regulation of astrocyte differentiation
3. B GO:0017145 stem cell division
3. B GO:0006903 vesicle targeting
3. B GO:0051130 positive regulation of cellular component organization
3. B GO:0071906 CRD domain binding
3. B GO:0000349 generation of catalytic spliceosome for first transesterification step
3. B GO:0005819 spindle
3. B GO:0036158 outer dynein arm assembly
3. B GO:0043130 ubiquitin binding
3. B GO:0001667 ameboidal-type cell migration
3. B GO:0031115 negative regulation of microtubule polymerization
3. B GO:0072357 PTW/PP1 phosphatase complex
3. B GO:0048511 rhythmic process
3. B GO:0008022 protein C-terminus binding
3. B GO:0043209 myelin sheath
3. B GO:0005078 MAP-kinase scaffold activity
3. B GO:0071215 cellular response to abscisic acid stimulus
3. B GO:0051661 maintenance of centrosome location
3. B GO:0031037 myosin II filament disassembly
3. B GO:0072686 mitotic spindle
3. B GO:0045638 negative regulation of myeloid cell differentiation
3. B GO:0005834 heterotrimeric G-protein complex
3. B GO:0072432 response to G1 DNA damage checkpoint signaling
3. B GO:0030425 dendrite
3. B GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
3. B GO:0030496 midbody
3. B GO:0036170 filamentous growth of a population of unicellular organisms in response to starvation
3. B GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
3. B GO:0000375 RNA splicing, via transesterification reactions
3. B GO:0005634 nucleus
3. B GO:0006303 double-strand break repair via nonhomologous end joining
3. B GO:0003720 telomerase activity
3. B GO:0000123 histone acetyltransferase complex
3. B GO:2000217 regulation of invasive growth in response to glucose limitation
3. B GO:0036064 ciliary basal body
3. B GO:0031682 G-protein gamma-subunit binding
3. B GO:1905188 positive regulation of metaphase/anaphase transition of meiosis I
3. B GO:0000118 histone deacetylase complex
3. B GO:0048383 mesectoderm development
3. B GO:0001891 phagocytic cup
3. B GO:0051660 establishment of centrosome localization
3. B GO:0035064 methylated histone binding
3. B GO:0045014 carbon catabolite repression of transcription by glucose
3. B GO:0030335 positive regulation of cell migration
3. B GO:0005681 spliceosomal complex
3. B GO:0034504 protein localization to nucleus
3. B GO:0044114 development of symbiont in host
3. B GO:1905301 regulation of macropinocytosis
3. B GO:1990498 mitotic spindle microtubule
3. B GO:0043297 apical junction assembly
3. B GO:0003677 DNA binding
3. B GO:0048471 perinuclear region of cytoplasm
3. B GO:0051012 microtubule sliding
3. B GO:0034388 Pwp2p-containing subcomplex of 90S preribosome
3. B GO:0030971 receptor tyrosine kinase binding
3. B GO:1903013 response to differentiation-inducing factor 1
3. B GO:0001764 neuron migration
3. B GO:0003682 chromatin binding
3. B GO:1900425 negative regulation of defense response to bacterium
3. B GO:0043473 pigmentation
3. B GO:0046784 viral mRNA export from host cell nucleus
3. B GO:0090724 central region of growth cone
3. B GO:0016905 myosin heavy chain kinase activity
3. B GO:0000722 telomere maintenance via recombination
3. B GO:0030507 spectrin binding
3. B GO:0000398 mRNA splicing, via spliceosome
3. B GO:1900091 regulation of raffinose biosynthetic process
3. B GO:0043531 ADP binding
3. B GO:0030178 negative regulation of Wnt signaling pathway
3. B GO:0030042 actin filament depolymerization
3. B GO:0071339 MLL1 complex
3. B GO:0005814 centriole
3. B GO:0000235 astral microtubule
3. B GO:0007079 mitotic chromosome movement towards spindle pole
3. B GO:0032350 regulation of hormone metabolic process
3. B GO:2000574 obsolete regulation of microtubule motor activity
3. B GO:0034452 dynactin binding
3. B GO:0051512 positive regulation of unidimensional cell growth
3. B GO:0005776 autophagosome
3. B GO:0098792 xenophagy
3. B GO:0005840 ribosome
3. B GO:0005525 GTP binding
3. B GO:0038026 reelin-mediated signaling pathway
3. B GO:1904115 axon cytoplasm
3. B GO:0045931 positive regulation of mitotic cell cycle
3. B GO:0021987 cerebral cortex development
3. B GO:1990266 neutrophil migration
3. B GO:0071007 U2-type catalytic step 2 spliceosome
3. B GO:0030043 actin filament fragmentation
3. B GO:0098780 response to mitochondrial depolarisation
3. B GO:0030834 regulation of actin filament depolymerization
3. B GO:1900087 positive regulation of G1/S transition of mitotic cell cycle
3. B GO:0090164 asymmetric Golgi ribbon formation
3. B GO:0015630 microtubule cytoskeleton
3. B GO:0016575 histone deacetylation
3. B GO:0007368 determination of left/right symmetry
3. B GO:0030865 cortical cytoskeleton organization
3. B GO:0008352 katanin complex
3. B GO:0070121 Kupffer's vesicle development
3. B GO:0005680 anaphase-promoting complex
3. B GO:0040019 positive regulation of embryonic development
3. B GO:0097344 Rix1 complex
3. B GO:0045827 negative regulation of isoprenoid metabolic process
3. B GO:0036180 filamentous growth of a population of unicellular organisms in response to biotic stimulus
3. B GO:0035844 cloaca development
3. B GO:0047391 alkylglycerophosphoethanolamine phosphodiesterase activity
3. B GO:0000974 Prp19 complex
3. B GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process
3. B GO:0010476 gibberellin mediated signaling pathway
3. B GO:0010906 regulation of glucose metabolic process
3. B GO:0000776 kinetochore
3. B GO:0000077 DNA damage checkpoint signaling
3. B GO:0030862 positive regulation of polarized epithelial cell differentiation
3. B GO:0005662 DNA replication factor A complex
3. B GO:0043588 skin development
3. B GO:0005635 nuclear envelope
3. B GO:2000024 regulation of leaf development
3. B GO:0071333 cellular response to glucose stimulus
3. B GO:0043982 histone H4-K8 acetylation
3. B GO:1990907 beta-catenin-TCF complex
3. B GO:0040013 negative regulation of locomotion
3. B GO:0021819 layer formation in cerebral cortex
3. B GO:0035591 signaling adaptor activity
3. B GO:0021766 hippocampus development
3. B GO:0008090 retrograde axonal transport
3. B GO:0016055 Wnt signaling pathway
3. B GO:0007369 gastrulation
3. B GO:0051434 BH3 domain binding
3. B GO:0005881 cytoplasmic microtubule
3. B GO:0051081 nuclear membrane disassembly
3. B GO:0003380 establishment or maintenance of cytoskeleton polarity involved in gastrulation
3. B GO:0007080 mitotic metaphase plate congression
3. B GO:0030174 regulation of DNA-dependent DNA replication initiation
3. B GO:0000346 transcription export complex
3. B GO:0001934 positive regulation of protein phosphorylation
3. B GO:0030220 platelet formation
3. B GO:0000245 spliceosomal complex assembly
3. B GO:0051898 negative regulation of protein kinase B signaling
3. B GO:0001738 morphogenesis of a polarized epithelium
3. B GO:0048705 skeletal system morphogenesis
3. B GO:0006406 mRNA export from nucleus
3. B GO:0007399 nervous system development
3. B GO:0090090 negative regulation of canonical Wnt signaling pathway
3. B GO:0071870 cellular response to catecholamine stimulus
3. B GO:0000132 establishment of mitotic spindle orientation
3. B GO:0051510 regulation of unidimensional cell growth
3. B GO:0033290 eukaryotic 48S preinitiation complex
3. B GO:0043966 histone H3 acetylation
3. B GO:0048568 embryonic organ development
3. B GO:1903028 positive regulation of opsonization
3. B GO:0048872 homeostasis of number of cells
3. B GO:0090263 positive regulation of canonical Wnt signaling pathway
3. B GO:1990716 axonemal central apparatus
3. B GO:0001675 acrosome assembly
3. B GO:0032091 negative regulation of protein binding
3. B GO:1901386 negative regulation of voltage-gated calcium channel activity
3. B GO:0003714 transcription corepressor activity
3. B GO:0016251 RNA polymerase II general transcription initiation factor activity
3. B GO:0043577 chemotropism
3. B GO:0044666 MLL3/4 complex
3. B GO:0042998 positive regulation of Golgi to plasma membrane protein transport
3. B GO:0045995 regulation of embryonic development
3. B GO:1900052 regulation of retinoic acid biosynthetic process
3. B GO:0042247 establishment of planar polarity of follicular epithelium
3. B GO:0055087 Ski complex
3. B GO:0031915 positive regulation of synaptic plasticity
3. B GO:0039008 pronephric nephron tubule morphogenesis
3. B GO:0010272 response to silver ion
3. B GO:0031117 positive regulation of microtubule depolymerization
3. B GO:0006974 cellular response to DNA damage stimulus
3. B GO:0005929 cilium
3. B GO:0048713 regulation of oligodendrocyte differentiation
3. B GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport
3. B GO:0001826 inner cell mass cell differentiation
3. B GO:0140297 DNA-binding transcription factor binding
3. B GO:0034399 nuclear periphery
3. B GO:0034396 negative regulation of transcription from RNA polymerase II promoter in response to iron
3. B GO:0005246 calcium channel regulator activity
3. B GO:0006891 intra-Golgi vesicle-mediated transport
3. B GO:0000480 endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
3. B GO:1902525 regulation of protein monoubiquitination
3. B GO:0050795 regulation of behavior
3. B GO:0007165 signal transduction
3. B GO:0005669 transcription factor TFIID complex
3. B GO:0007097 nuclear migration
3. B GO:0002244 hematopoietic progenitor cell differentiation
3. B GO:0033276 transcription factor TFTC complex
3. B GO:0007019 microtubule depolymerization
3. B GO:0005737 cytoplasm
3. B GO:0007059 chromosome segregation
3. B GO:0001895 retina homeostasis
3. B GO:0007281 germ cell development
3. B GO:0005815 microtubule organizing center
3. B GO:0043622 cortical microtubule organization
3. B GO:1904672 regulation of somatic stem cell population maintenance
3. B GO:0070534 protein K63-linked ubiquitination
3. B GO:2001244 positive regulation of intrinsic apoptotic signaling pathway
3. B GO:0061630 ubiquitin protein ligase activity
3. B GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
3. B GO:0005847 mRNA cleavage and polyadenylation specificity factor complex
3. B GO:0043981 histone H4-K5 acetylation
3. B GO:0043005 neuron projection
3. B GO:0045505 dynein intermediate chain binding
3. B GO:0001750 photoreceptor outer segment
3. B GO:0000417 HIR complex
3. B GO:0030308 negative regulation of cell growth
3. B GO:0030277 maintenance of gastrointestinal epithelium
3. B GO:0031023 microtubule organizing center organization
3. B GO:0060041 retina development in camera-type eye
3. B GO:0048854 brain morphogenesis
3. B GO:0032880 regulation of protein localization
3. B GO:0001403 invasive growth in response to glucose limitation
3. B GO:0046549 retinal cone cell development
3. B GO:0000421 autophagosome membrane
3. B GO:0000922 spindle pole
3. B GO:0007219 Notch signaling pathway
3. B GO:0010073 meristem maintenance
3. B GO:0005848 mRNA cleavage stimulating factor complex
3. B GO:0033597 mitotic checkpoint complex
3. B GO:0001732 formation of cytoplasmic translation initiation complex
3. B GO:0031252 cell leading edge
3. B GO:0007212 dopamine receptor signaling pathway
3. B GO:0042622 photoreceptor outer segment membrane
3. B GO:0030030 cell projection organization
3. B GO:0007064 mitotic sister chromatid cohesion
3. B GO:1901998 toxin transport
3. B GO:1900088 regulation of inositol biosynthetic process
3. B GO:0071013 catalytic step 2 spliceosome
3. B GO:0060590 ATPase regulator activity
3. B GO:0009845 seed germination
3. B GO:0009560 embryo sac egg cell differentiation
3. B GO:0120163 negative regulation of cold-induced thermogenesis
3. B GO:0045159 myosin II binding
3. B GO:0000380 alternative mRNA splicing, via spliceosome
3. B GO:0002183 cytoplasmic translational initiation
3. B GO:0048188 Set1C/COMPASS complex
3. B GO:0044297 cell body
3. B GO:0008635 activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c
3. B GO:0071006 U2-type catalytic step 1 spliceosome
3. B GO:0120171 Cdc24p-Far1p-Gbetagamma complex
3. B GO:1902183 regulation of shoot apical meristem development
3. B GO:0051219 phosphoprotein binding
3. B GO:0048026 positive regulation of mRNA splicing, via spliceosome
3. B GO:0046898 response to cycloheximide
3. B GO:0045199 maintenance of epithelial cell apical/basal polarity
3. B GO:0051983 regulation of chromosome segregation
3. B GO:1902773 GTPase activator complex
3. B GO:0043984 histone H4-K16 acetylation
3. B GO:0051015 actin filament binding
3. B GO:0051010 microtubule plus-end binding
3. B GO:0021895 cerebral cortex neuron differentiation
3. B GO:0097730 non-motile cilium
3. B GO:0035220 wing disc development
3. B GO:0051020 GTPase binding
3. B GO:0051901 positive regulation of mitochondrial depolarization
3. B GO:0030126 COPI vesicle coat
3. B GO:0036035 osteoclast development
3. B GO:0002446 neutrophil mediated immunity
3. B GO:0034501 protein localization to kinetochore
3. B GO:0009967 positive regulation of signal transduction
3. B GO:0046662 regulation of oviposition
3. B GO:0071541 eukaryotic translation initiation factor 3 complex, eIF3m
3. B GO:0006378 mRNA polyadenylation
3. B GO:0000437 carbon catabolite repression of transcription from RNA polymerase II promoter
3. B GO:0005102 signaling receptor binding
3. B GO:0060117 auditory receptor cell development
3. B GO:0007026 negative regulation of microtubule depolymerization
3. B GO:0051568 histone H3-K4 methylation
3. B GO:0009944 polarity specification of adaxial/abaxial axis
3. B GO:1903003 positive regulation of protein deubiquitination
3. B GO:0033137 negative regulation of peptidyl-serine phosphorylation
3. B GO:0005092 GDP-dissociation inhibitor activity
3. B GO:0035861 site of double-strand break
3. B GO:0033365 protein localization to organelle
3. B GO:0050773 regulation of dendrite development
3. B GO:0065001 specification of axis polarity
3. B GO:1990630 IRE1-RACK1-PP2A complex
3. B GO:0048358 mucilage pectin biosynthetic process
3. B GO:0007611 learning or memory
3. B GO:1990447 U2 snRNP binding
3. B GO:0010393 galacturonan metabolic process
3. B GO:0000226 microtubule cytoskeleton organization
3. B GO:0007099 centriole replication
3. B GO:0046329 negative regulation of JNK cascade
3. B GO:0080008 Cul4-RING E3 ubiquitin ligase complex
3. B GO:0061966 establishment of left/right asymmetry
3. B GO:0000445 THO complex part of transcription export complex
3. B GO:0042462 eye photoreceptor cell development
3. B GO:0090307 mitotic spindle assembly
3. B GO:0043204 perikaryon
3. B GO:0000045 autophagosome assembly
3. B GO:0071363 cellular response to growth factor stimulus
3. B GO:1903138 negative regulation of cell wall integrity MAPK cascade
3. B GO:0042393 histone binding
3. B GO:0019899 enzyme binding
3. B GO:0030332 cyclin binding
3. B GO:0034613 cellular protein localization
3. B GO:0036038 MKS complex
3. B GO:0090176 microtubule cytoskeleton organization involved in establishment of planar polarity
3. B GO:0016593 Cdc73/Paf1 complex
3. B GO:0005852 eukaryotic translation initiation factor 3 complex
3. B GO:1903725 regulation of phospholipid metabolic process
3. B GO:0045598 regulation of fat cell differentiation
3. B GO:0030154 cell differentiation
3. B GO:1902066 regulation of cell wall pectin metabolic process
3. B GO:0080001 mucilage extrusion from seed coat
3. B GO:0016230 sphingomyelin phosphodiesterase activator activity
3. B GO:0060027 convergent extension involved in gastrulation
3. B GO:0070306 lens fiber cell differentiation
3. B GO:0006919 activation of cysteine-type endopeptidase activity involved in apoptotic process
3. B GO:0043087 regulation of GTPase activity
3. B GO:0001961 positive regulation of cytokine-mediated signaling pathway
3. B GO:0071599 otic vesicle development
3. B GO:0040020 regulation of meiotic nuclear division
3. B GO:0031334 positive regulation of protein-containing complex assembly
3. B GO:0016021 integral component of membrane
3. B GO:0080182 histone H3-K4 trimethylation
3. B GO:0008380 RNA splicing
3. B GO:0000393 spliceosomal conformational changes to generate catalytic conformation
3. B GO:0000781 chromosome, telomeric region
3. B GO:0010659 cardiac muscle cell apoptotic process
3. B GO:0051302 regulation of cell division
3. B GO:0005875 microtubule associated complex
3. B GO:0030663 COPI-coated vesicle membrane
3. B GO:0031929 TOR signaling
3. B GO:0005813 centrosome
3. B GO:0035845 photoreceptor cell outer segment organization
3. B GO:0043293 apoptosome
3. B GO:0007186 G protein-coupled receptor signaling pathway
3. B GO:0070034 telomerase RNA binding
3. B GO:0005829 cytosol
3. B GO:0046872 metal ion binding
3. B GO:0005697 telomerase holoenzyme complex
3. B GO:0070507 regulation of microtubule cytoskeleton organization
3. B GO:0090207 regulation of triglyceride metabolic process
3. B GO:0031124 mRNA 3'-end processing
3. B GO:0016243 regulation of autophagosome size
3. B GO:0090102 cochlea development
3. B GO:0002102 podosome
3. B GO:0030512 negative regulation of transforming growth factor beta receptor signaling pathway
3. B GO:0030117 membrane coat
3. B GO:0015631 tubulin binding
3. B GO:0042249 establishment of planar polarity of embryonic epithelium
3. B GO:0042169 SH2 domain binding
3. B GO:1903208 negative regulation of hydrogen peroxide-induced neuron death
3. B GO:0030292 protein tyrosine kinase inhibitor activity
3. B GO:0051572 negative regulation of histone H3-K4 methylation
3. B GO:0120206 photoreceptor distal connecting cilium
3. B GO:0010842 retina layer formation
3. B GO:0090443 FAR/SIN/STRIPAK complex
3. B GO:0072344 rescue of stalled ribosome
3. B GO:0005938 cell cortex
3. B GO:0045773 positive regulation of axon extension
3. B GO:0000433 carbon catabolite repression of transcription from RNA polymerase II promoter by glucose
3. B GO:0002092 positive regulation of receptor internalization
3. B GO:0046982 protein heterodimerization activity

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q9D180 Cilia- and flagella-associated protein 57 0.00e+00 1.69e-109 0.0
1. PB Q96MR6 Cilia- and flagella-associated protein 57 0 3.89e-154 0.0
1. PB E9Q5M6 Cilia- and flagella-associated protein 44 2.26e-07 2.01e-02 4.64e-18
1. PB Q57WH1 Cilia- and flagella-associated protein 44 3.64e-07 2.09e-03 2.45e-11
1. PB Q8NDM7 Cilia- and flagella-associated protein 43 1.03e-08 2.53e-04 1.43e-06
1. PB E9Q7R9 Cilia- and flagella-associated protein 43 1.87e-13 4.23e-06 3.35e-08
1. PB Q6DFC6 WD repeat-containing protein 75 1.32e-06 2.61e-04 0.017
1. PB A8J1V4 Cilia- and flagella-associated protein 44 5.33e-07 1.47e-03 6.73e-14
2. P Q8TEQ6 Gem-associated protein 5 8.71e-05 1.53e-02 NA
2. P Q580P9 Cilia- and flagella-associated protein 43 9.61e-11 4.12e-04 NA
2. P Q8BX17 Gem-associated protein 5 5.62e-05 4.48e-03 NA
2. P Q06679 U3 small nucleolar RNA-associated protein 4 1.39e-05 2.70e-02 NA
2. P A0A1L8GXY4 Cilia- and flagella-associated protein 43 9.22e-10 1.93e-07 NA
3. B Q9D994 WD repeat-containing protein 38 1.29e-05 NA 4.40e-06
3. B G8SD34 NAD(+) hydrolase ApTIR 1.47e-04 NA 3.50e-06
3. B Q5BE22 Pre-mRNA-splicing factor prp46 2.40e-05 NA 3.57e-06
3. B Q58E77 WD repeat-containing protein 82-B 6.24e-06 NA 6.57e-04
3. B Q8YRI1 Uncharacterized WD repeat-containing protein alr3466 1.92e-09 NA 3.73e-13
3. B O42469 Transducin-like enhancer protein 1 1.74e-03 NA 0.003
3. B Q5R664 Coatomer subunit beta' 2.85e-05 NA 0.010
3. B G4MQX3 MST50-interacting protein 11 1.96e-06 NA 0.001
3. B Q05048 Cleavage stimulation factor subunit 1 3.40e-08 NA 0.002
3. B O00423 Echinoderm microtubule-associated protein-like 1 0.00e+00 NA 3.13e-06
3. B P0CS49 Pre-mRNA-splicing factor PRP46 4.04e-04 NA 2.66e-06
3. B Q8BFQ4 WD repeat-containing protein 82 6.88e-06 NA 0.012
3. B O43815 Striatin 3.06e-03 NA 0.006
3. B P74442 Uncharacterized WD repeat-containing protein slr0143 9.68e-07 NA 1.13e-11
3. B Q9C827 Coatomer subunit beta'-2 1.09e-06 NA 0.005
3. B Q7PP77 Eukaryotic translation initiation factor 3 subunit I 3.50e-09 NA 0.002
3. B Q15061 WD repeat-containing protein 43 3.72e-04 NA 0.003
3. B P35606 Coatomer subunit beta' 6.04e-04 NA 0.008
3. B Q75BY3 Pre-mRNA-splicing factor PRP46 2.70e-06 NA 2.34e-04
3. B P62881 Guanine nucleotide-binding protein subunit beta-5 1.91e-04 NA 0.009
3. B Q6P2Y2 Dynein assembly factor with WDR repeat domains 1 8.19e-06 NA 9.72e-06
3. B Q12788 Transducin beta-like protein 3 1.42e-08 NA 2.35e-04
3. B Q7T0P4 POC1 centriolar protein homolog A 3.29e-08 NA 2.26e-09
3. B B8PD53 Nuclear distribution protein PAC1-2 NA NA 4.51e-05
3. B Q32LN7 WD repeat-containing protein 61 1.05e-10 NA 5.76e-04
3. B Q6ZMY6 WD repeat-containing protein 88 1.19e-04 NA 1.02e-04
3. B P41318 Target of rapamycin complex subunit LST8 1.33e-07 NA 6.35e-04
3. B Q40507 Guanine nucleotide-binding protein subunit beta 1.84e-10 NA 0.045
3. B Q6NZH4 Lissencephaly-1 homolog 4.53e-10 NA 2.42e-04
3. B Q02225 Ski oncogene 2.99e-01 NA 0.032
3. B Q8SQS4 Transcription initiation factor TFIID subunit 5 5.83e-04 NA 0.001
3. B B0LSW3 Platelet-activating factor acetylhydrolase IB subunit beta 4.75e-10 NA 3.16e-04
3. B P49846 Transcription initiation factor TFIID subunit 5 5.53e-04 NA 4.44e-08
3. B Q6UXN9 WD repeat-containing protein 82 6.39e-06 NA 0.012
3. B Q9R1K5 Fizzy-related protein homolog 1.06e-03 NA 0.012
3. B P18851 Guanine nucleotide-binding protein subunit beta 1.09e-05 NA 0.042
3. B P0CS48 Pre-mRNA-splicing factor PRP46 6.99e-04 NA 2.44e-06
3. B Q8YV57 Uncharacterized WD repeat-containing protein all2124 3.13e-06 NA 2.67e-12
3. B Q8HXX0 Platelet-activating factor acetylhydrolase IB subunit alpha 4.12e-10 NA 1.72e-04
3. B Q9P775 Uncharacterized WD repeat-containing protein C17D11.16 3.94e-03 NA 0.004
3. B Q498M4 WD repeat-containing protein 5 3.55e-06 NA 0.002
3. B Q96MT7 Cilia- and flagella-associated protein 44 3.51e-07 NA 8.81e-17
3. B Q499N3 WD repeat-containing protein 18 2.09e-05 NA 0.002
3. B Q9UM11 Fizzy-related protein homolog 5.37e-04 NA 0.003
3. B Q8TC44 POC1 centriolar protein homolog B 1.09e-04 NA 3.16e-08
3. B P16371 Protein groucho 1.73e-03 NA 0.002
3. B P25635 Periodic tryptophan protein 2 5.71e-09 NA 5.22e-05
3. B A3LTS5 Protein DSE1 9.63e-03 NA 0.002
3. B P63244 Receptor of activated protein C kinase 1 1.14e-07 NA 0.005
3. B Q6DTM3 Jouberin 2.35e-03 NA 1.86e-04
3. B Q9FKT5 THO complex subunit 3 1.24e-05 NA 1.60e-04
3. B Q0U1B1 Nuclear distribution protein PAC1 1.60e-09 NA 1.63e-04
3. B O60097 Transcription factor spt8 2.31e-02 NA 0.024
3. B Q54MZ3 Anaphase-promoting complex subunit cdc20 7.55e-04 NA 1.42e-05
3. B B2VWG7 Nuclear distribution protein PAC1 1.64e-09 NA 1.42e-04
3. B Q4R2Z6 WD repeat-containing protein 48 2.90e-04 NA 7.56e-04
3. B Q90ZL4 Lissencephaly-1 homolog 4.54e-10 NA 6.66e-04
3. B P63245 Receptor of activated protein C kinase 1 1.21e-07 NA 0.005
3. B C4YFX2 Transcriptional repressor TUP1 4.85e-05 NA 2.38e-04
3. B P79959 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 2.81e-07 NA 0.009
3. B Q8YTC2 Uncharacterized WD repeat-containing protein alr2800 3.81e-08 NA 4.90e-11
3. B P62882 Guanine nucleotide-binding protein subunit beta-5 1.12e-07 NA 0.008
3. B Q6P6T4 Echinoderm microtubule-associated protein-like 2 0.00e+00 NA 3.33e-15
3. B Q4V8C3 Echinoderm microtubule-associated protein-like 1 0.00e+00 NA 3.61e-07
3. B Q8TED0 U3 small nucleolar RNA-associated protein 15 homolog 1.14e-05 NA 0.007
3. B Q99973 Telomerase protein component 1 1.70e-03 NA 8.78e-05
3. B P0CS46 Polyadenylation factor subunit 2 4.56e-04 NA 4.65e-04
3. B Q9CAA0 Coatomer subunit beta'-1 2.90e-06 NA 0.002
3. B P78706 Transcriptional repressor rco-1 1.34e-03 NA 1.67e-05
3. B Q6RI45 Bromodomain and WD repeat-containing protein 3 2.85e-02 NA 0.003
3. B Q9HAV0 Guanine nucleotide-binding protein subunit beta-4 2.64e-07 NA 3.08e-05
3. B Q4R4I8 Coatomer subunit beta' 5.38e-07 NA 0.010
3. B Q6DH44 WD repeat domain-containing protein 83 6.26e-06 NA 0.005
3. B Q8TAF3 WD repeat-containing protein 48 2.92e-03 NA 6.64e-04
3. B Q6P2H3 Centrosomal protein of 85 kDa 3.32e-03 NA 0.002
3. B Q21215 Guanine nucleotide-binding protein subunit beta-2-like 1 1.68e-07 NA 0.015
3. B O93277 WD repeat-containing protein 1 1.73e-12 NA 0.007
3. B P54313 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 6.71e-08 NA 8.72e-04
3. B Q9EPV5 Apoptotic protease-activating factor 1 8.62e-08 NA 0.002
3. B O35242 Protein FAN 2.42e-03 NA 0.003
3. B Q6FJZ9 Pre-mRNA-splicing factor PRP46 5.37e-05 NA 0.017
3. B Q9PTR5 Lissencephaly-1 homolog 4.77e-10 NA 0.001
3. B Q5ZKU8 p21-activated protein kinase-interacting protein 1-like 2.20e-06 NA 0.009
3. B Q6NLV4 Flowering time control protein FY 3.84e-04 NA 5.68e-07
3. B O24456 Receptor for activated C kinase 1A 1.35e-07 NA 0.008
3. B Q55FJ2 WD repeat-containing protein 91 homolog 6.94e-04 NA 0.002
3. B Q8VE80 THO complex subunit 3 3.03e-05 NA 0.004
3. B Q29RH4 THO complex subunit 3 1.71e-04 NA 0.004
3. B P62883 Guanine nucleotide-binding protein subunit beta-like protein 9.64e-07 NA 1.58e-06
3. B Q01277 Probable E3 ubiquitin ligase complex SCF subunit scon-2 1.12e-03 NA 4.27e-04
3. B O88879 Apoptotic protease-activating factor 1 8.12e-07 NA 1.44e-06
3. B Q28I85 POC1 centriolar protein homolog A 2.17e-07 NA 2.60e-09
3. B Q12417 Pre-mRNA-splicing factor PRP46 5.30e-05 NA 0.004
3. B Q5I0B9 Autophagy-related protein 16 9.54e-04 NA 2.43e-04
3. B Q8BG40 Katanin p80 WD40 repeat-containing subunit B1 4.00e-02 NA 9.33e-06
3. B Q7RY68 Polyadenylation factor subunit 2 6.27e-04 NA 0.001
3. B Q9SY00 COMPASS-like H3K4 histone methylase component WDR5B 2.93e-05 NA 0.001
3. B O95834 Echinoderm microtubule-associated protein-like 2 0.00e+00 NA 3.08e-15
3. B Q9UMS4 Pre-mRNA-processing factor 19 1.03e-04 NA 0.002
3. B O54929 WD repeat and SOCS box-containing protein 2 1.12e-03 NA 0.039
3. B P16649 General transcriptional corepressor TUP1 1.06e-03 NA 8.16e-04
3. B Q6NNP0 Autophagy-related protein 16 3.14e-05 NA 1.74e-05
3. B Q55AR8 U5 small nuclear ribonucleoprotein 40 kDa protein 3.98e-05 NA 0.022
3. B O80990 Protein CIA1 1.64e-09 NA 2.23e-04
3. B Q04726 Transducin-like enhancer protein 3 2.77e-03 NA 0.001
3. B Q09150 Meiotic recombination protein rec14 3.77e-05 NA 0.043
3. B Q6PE01 U5 small nuclear ribonucleoprotein 40 kDa protein 2.28e-05 NA 3.79e-05
3. B O60336 Mitogen-activated protein kinase-binding protein 1 3.98e-10 NA 0.007
3. B Q8W1K8 Protein Mut11 1.48e-06 NA 1.65e-08
3. B P56094 General transcriptional corepressor TUP1 5.90e-03 NA 2.13e-04
3. B A2CEH0 POC1 centriolar protein homolog B 1.09e-08 NA 2.05e-08
3. B P38011 Guanine nucleotide-binding protein subunit beta-like protein 6.38e-10 NA 8.25e-05
3. B Q9JIT3 Transducin-like enhancer protein 3 1.10e-03 NA 0.001
3. B A8XSW2 WD repeat-containing protein 48 homolog 1.20e-03 NA 2.96e-04
3. B P69104 Guanine nucleotide-binding protein subunit beta-like protein 3.07e-07 NA 8.05e-06
3. B P13648 Lamin-A 7.90e-03 NA 0.008
3. B Q6DIP5 Echinoderm microtubule-associated protein-like 4 3.89e-10 NA 2.28e-15
3. B Q08E38 Pre-mRNA-processing factor 19 4.66e-05 NA 0.002
3. B P63247 Receptor of activated protein C kinase 1 4.04e-07 NA 0.005
3. B Q54YD8 Coatomer subunit beta' 1.39e-05 NA 0.001
3. B Q9D7H2 WD repeat-containing protein 5B 5.62e-07 NA 4.57e-04
3. B Q4X0A9 Probable E3 ubiquitin ligase complex SCF subunit sconB 5.45e-03 NA 0.002
3. B Q8VEJ4 Notchless protein homolog 1 8.33e-05 NA 0.010
3. B P93398 Guanine nucleotide-binding protein subunit beta-2 5.06e-10 NA 0.021
3. B Q99KP6 Pre-mRNA-processing factor 19 3.98e-05 NA 6.43e-04
3. B O75529 TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L 2.69e-03 NA 3.10e-07
3. B Q5RAW8 WD repeat-containing protein 48 5.64e-03 NA 6.48e-04
3. B Q5BJQ6 Cleavage stimulation factor subunit 1 3.64e-08 NA 0.002
3. B P54311 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 4.82e-08 NA 0.011
3. B Q5R5W8 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 2.82e-07 NA 0.011
3. B Q24371 Protein lethal(2)denticleless 1.75e-03 NA 0.025
3. B Q5XIG8 Serine-threonine kinase receptor-associated protein 3.40e-06 NA 0.031
3. B O16519 Gastrulation defective protein 1 6.69e-04 NA 2.31e-04
3. B B8P4B0 Nuclear distribution protein PAC1-1 2.68e-10 NA 4.50e-04
3. B Q5IS43 Platelet-activating factor acetylhydrolase IB subunit alpha 2.46e-10 NA 5.27e-04
3. B P14197 WD repeat-containing protein AAC3 1.70e-04 NA 0.004
3. B Q16K15 Eukaryotic translation initiation factor 3 subunit I 1.21e-09 NA 0.001
3. B Q9FNN2 WD repeat-containing protein 26 homolog 6.41e-03 NA 0.004
3. B C3XVT5 Lissencephaly-1 homolog 1.78e-10 NA 9.00e-05
3. B Q9NVX2 Notchless protein homolog 1 2.31e-04 NA 0.035
3. B Q9V3J8 Protein will die slowly 1.86e-05 NA 0.002
3. B Q6GPC6 F-box-like/WD repeat-containing protein TBL1XR1-B 6.11e-05 NA 0.003
3. B Q96DI7 U5 small nuclear ribonucleoprotein 40 kDa protein 2.38e-05 NA 3.68e-05
3. B Q54PK4 Structural maintenance of chromosomes protein 2 1.36e-02 NA 0.017
3. B F4KB17 Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.3 4.37e-05 NA 3.65e-08
3. B A7MB12 U3 small nucleolar RNA-associated protein 15 homolog 9.55e-06 NA 4.11e-04
3. B Q8BHD1 POC1 centriolar protein homolog B 8.15e-07 NA 3.90e-07
3. B Q28YY2 WD repeat-containing protein 48 homolog 5.75e-04 NA 0.002
3. B O48847 Transcriptional corepressor LEUNIG_HOMOLOG 3.48e-04 NA 0.011
3. B O18640 Guanine nucleotide-binding protein subunit beta-like protein 2.96e-07 NA 1.84e-05
3. B Q8VZS9 Protein FIZZY-RELATED 1 5.73e-04 NA 8.96e-05
3. B P79083 Eukaryotic translation initiation factor 3 subunit I 1.53e-09 NA 0.016
3. B Q5R8K2 Cleavage stimulation factor subunit 1 3.33e-08 NA 0.002
3. B Q0P593 Dynein assembly factor with WDR repeat domains 1 1.28e-05 NA 1.14e-05
3. B Q8VYZ5 Periodic tryptophan protein 2 1.15e-09 NA 0.004
3. B P62884 Guanine nucleotide-binding protein subunit beta-like protein 1.19e-06 NA 1.58e-06
3. B Q9SZA4 Cell division cycle 20.1, cofactor of APC complex 4.91e-04 NA 0.017
3. B A8NEG8 Nuclear distribution protein PAC1 2.06e-10 NA 1.14e-06
3. B Q6S7B0 Transcription initiation factor TFIID subunit 5 6.37e-04 NA 1.01e-04
3. B Q5ZMA2 Pre-mRNA-processing factor 19 5.14e-05 NA 0.002
3. B Q54IY5 Component of gems protein 5 1.11e-04 NA 0.007
3. B Q54MH6 Retinoblastoma-binding-like protein E 7.34e-04 NA 0.020
3. B A8Q2R5 WD repeat-containing protein 48 homolog 1.29e-03 NA 0.044
3. B C4Q0P6 Lissencephaly-1 homolog 2.12e-07 NA 1.20e-05
3. B O22212 U4/U6 small nuclear ribonucleoprotein PRP4-like protein 4.84e-04 NA 8.15e-06
3. B Q68EI0 WD repeat-containing protein 18 7.30e-06 NA 0.008
3. B Q6BSL7 Eukaryotic translation initiation factor 3 subunit I 5.84e-07 NA 0.049
3. B Q08706 Guanine nucleotide-binding protein subunit beta 8.22e-08 NA 2.29e-04
3. B O43684 Mitotic checkpoint protein BUB3 3.81e-08 NA 0.033
3. B B0X2V9 WD repeat-containing protein 48 homolog 8.15e-04 NA 0.001
3. B Q5XX13 F-box/WD repeat-containing protein 10 1.40e-01 NA 0.017
3. B Q54KL5 WD repeat-containing protein 5 homolog 4.67e-06 NA 1.10e-04
3. B Q2UFN8 Probable E3 ubiquitin ligase complex SCF subunit sconB 1.68e-02 NA 5.31e-04
3. B F4I5Q6 Myosin-7 3.25e-01 NA 0.016
3. B Q58D20 Notchless protein homolog 1 1.44e-04 NA 0.007
3. B P62872 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 7.09e-08 NA 0.011
3. B O88342 WD repeat-containing protein 1 3.72e-12 NA 0.009
3. B Q0CY32 Probable E3 ubiquitin ligase complex SCF subunit sconB 3.80e-03 NA 0.002
3. B Q8C092 Transcription initiation factor TFIID subunit 5 3.15e-03 NA 7.62e-08
3. B Q9GZS3 WD repeat-containing protein 61 5.90e-11 NA 5.76e-04
3. B Q922V4 Pleiotropic regulator 1 5.23e-04 NA 6.80e-05
3. B Q12834 Cell division cycle protein 20 homolog 7.80e-04 NA 1.58e-05
3. B Q5ZMV7 WD repeat-containing protein 82 6.48e-06 NA 5.97e-04
3. B Q5E959 Serine-threonine kinase receptor-associated protein 4.39e-06 NA 0.009
3. B Q5ZL33 Serine-threonine kinase receptor-associated protein 4.55e-06 NA 2.42e-04
3. B A2RRU3 U3 small nucleolar RNA-associated protein 15 homolog 6.66e-06 NA 0.001
3. B Q99M74 Keratin, type II cuticular Hb2 5.10e-03 NA 0.042
3. B Q10281 Guanine nucleotide-binding protein subunit beta-like protein 6.49e-08 NA 4.93e-04
3. B O22785 Pre-mRNA-processing factor 19 homolog 2 6.51e-05 NA 2.19e-05
3. B P49177 Guanine nucleotide-binding protein subunit beta 3.77e-10 NA 0.005
3. B Q05AM5 Elongator complex protein 2 2.11e-07 NA 0.040
3. B Q8L4J2 Cleavage stimulation factor subunit 50 1.47e-04 NA 0.002
3. B Q5ZIU8 Katanin p80 WD40 repeat-containing subunit B1 2.15e-04 NA 2.26e-05
3. B F4HTH8 Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.2 5.64e-04 NA 7.40e-07
3. B Q9HGL2 Uncharacterized calcium-binding protein C800.10c 6.37e-02 NA 0.022
3. B Q7ZV55 Eukaryotic translation initiation factor 3 subunit I 2.51e-09 NA 0.049
3. B P93107 Flagellar WD repeat-containing protein Pf20 6.26e-05 NA 3.78e-04
3. B Q9JMJ4 Pre-mRNA-processing factor 19 1.96e-04 NA 6.43e-04
3. B Q8BX09 Retinoblastoma-binding protein 5 1.20e-03 NA 0.042
3. B O76734 General transcriptional corepressor tupA 3.35e-05 NA 0.001
3. B Q1JQB2 Mitotic checkpoint protein BUB3 3.81e-08 NA 0.033
3. B Q93847 WD repeat-containing protein wdr-5.2 2.12e-04 NA 0.005
3. B Q7T394 Lissencephaly-1 homolog A 4.31e-10 NA 6.71e-04
3. B Q7ZXK9 Notchless protein homolog 1 2.23e-04 NA 0.043
3. B Q5RAC9 Autophagy-related protein 16-1 2.04e-04 NA 1.63e-05
3. B P83774 Guanine nucleotide-binding protein subunit beta-like protein 3.99e-07 NA 0.046
3. B P26308 Guanine nucleotide-binding protein subunit beta-1 6.51e-08 NA 0.004
3. B O08653 Telomerase protein component 1 2.78e-04 NA 0.002
3. B Q9NDC9 Lissencephaly-1 homolog 9.21e-11 NA 3.30e-05
3. B Q1LV15 Dynein assembly factor with WDR repeat domains 1 8.79e-06 NA 1.36e-06
3. B Q1LZ08 WD repeat-containing protein 48 homolog 1.09e-03 NA 0.003
3. B Q4V7A0 WD repeat-containing protein 61 9.42e-11 NA 0.002
3. B Q59WJ4 Polyadenylation factor subunit 2 3.78e-04 NA 0.045
3. B Q61011 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 8.78e-08 NA 2.11e-05
3. B Q5RDY7 Guanine nucleotide-binding protein subunit beta-5 6.62e-08 NA 0.011
3. B Q09715 Transcriptional repressor tup11 9.40e-04 NA 3.44e-07
3. B Q1HPW4 Eukaryotic translation initiation factor 3 subunit I 1.01e-09 NA 3.75e-04
3. B Q5H7C0 Cell division cycle protein 20 homolog 1.91e-03 NA 4.42e-05
3. B Q8K3E5 Jouberin 1.26e-03 NA 1.58e-04
3. B B5X3Z6 Lissencephaly-1 homolog A 4.10e-10 NA 4.06e-04
3. B Q39836 Guanine nucleotide-binding protein subunit beta-like protein 1.21e-07 NA 0.012
3. B Q9LV27 Target of rapamycin complex subunit LST8-1 1.74e-07 NA 4.03e-05
3. B Q9FND4 WD repeat-containing protein WDS homolog 2.35e-05 NA 0.005
3. B Q86VZ2 WD repeat-containing protein 5B 2.85e-07 NA 6.13e-05
3. B E9Q743 Cilia- and flagella-associated protein 251 7.05e-06 NA 0.008
3. B Q5REG7 Platelet-activating factor acetylhydrolase IB subunit alpha 2.53e-10 NA 0.001
3. B Q58CQ2 Actin-related protein 2/3 complex subunit 1B 3.40e-08 NA 0.009
3. B Q3UMY5 Echinoderm microtubule-associated protein-like 4 8.43e-09 NA 2.56e-18
3. B Q5FWQ6 Dynein assembly factor with WDR repeat domains 1 7.78e-06 NA 3.42e-05
3. B A9V790 Lissencephaly-1 homolog 4.11e-09 NA 1.79e-04
3. B Q7SZM9 F-box-like/WD repeat-containing protein TBL1XR1-A 3.42e-05 NA 0.003
3. B Q08122 Transducin-like enhancer protein 3 4.82e-04 NA 0.001
3. B P62874 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 5.18e-08 NA 0.011
3. B P49027 Guanine nucleotide-binding protein subunit beta-like protein A 3.19e-06 NA 7.70e-04
3. B P52287 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 7.56e-08 NA 3.19e-05
3. B Q62623 Cell division cycle protein 20 homolog 3.63e-04 NA 2.71e-07
3. B Q9AV81 Pre-mRNA-processing factor 19 3.40e-04 NA 7.62e-04
3. B Q5REE0 U3 small nucleolar RNA-associated protein 15 homolog 1.02e-04 NA 0.005
3. B Q8C4J7 Transducin beta-like protein 3 9.43e-08 NA 0.001
3. B P42527 Myosin heavy chain kinase A 1.88e-03 NA 6.81e-06
3. B P87053 F-box/WD repeat-containing protein pof1 8.38e-04 NA 0.002
3. B Q4WT34 Pre-mRNA-splicing factor prp46 6.59e-05 NA 3.71e-06
3. B Q39336 Guanine nucleotide-binding protein subunit beta-like protein 1.23e-07 NA 0.006
3. B Q6ZMW3 Echinoderm microtubule-associated protein-like 6 2.55e-07 NA 6.21e-15
3. B Q9JJ66 Cell division cycle protein 20 homolog 2.32e-04 NA 4.17e-07
3. B A7S338 Lissencephaly-1 homolog 2.33e-10 NA 4.57e-05
3. B P78972 WD repeat-containing protein slp1 8.84e-04 NA 2.20e-07
3. B Q676U5 Autophagy-related protein 16-1 1.27e-04 NA 4.30e-04
3. B O13166 Transducin-like enhancer protein 3-A 1.81e-03 NA 0.002
3. B Q2HJH6 U5 small nuclear ribonucleoprotein 40 kDa protein 2.68e-05 NA 1.44e-05
3. B Q9GL51 Platelet-activating factor acetylhydrolase IB subunit alpha 4.75e-10 NA 1.74e-04
3. B B8NGT5 Probable E3 ubiquitin ligase complex SCF subunit sconB 4.36e-03 NA 5.45e-04
3. B Q6DFF9 Mitogen-activated protein kinase-binding protein 1 1.45e-10 NA 7.33e-04
3. B Q6PFM9 WD repeat-containing protein 48 5.88e-04 NA 1.46e-04
3. B Q9UTN4 Polyadenylation factor subunit 2 1.04e-04 NA 0.015
3. B Q5BK30 Dynein assembly factor with WDR repeat domains 1 1.83e-05 NA 5.87e-06
3. B O94423 Meiotic fizzy-related protein 1 6.84e-07 NA 0.013
3. B Q9I9H8 Apoptotic protease-activating factor 1 3.19e-07 NA 1.45e-05
3. B O13168 Transducin-like enhancer protein 3-B 1.85e-03 NA 0.001
3. B Q5RB58 Mitotic checkpoint protein BUB3 3.92e-08 NA 0.011
3. B P38129 Transcription initiation factor TFIID subunit 5 4.89e-04 NA 2.21e-09
3. B P23232 Guanine nucleotide-binding protein subunit beta 6.71e-08 NA 7.74e-04
3. B Q8W117 Suppressor of mec-8 and unc-52 protein homolog 1 1.55e-06 NA 0.047
3. B Q8N1V2 Cilia- and flagella-associated protein 52 0.00e+00 NA 4.76e-04
3. B Q5DFU0 Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog 4.89e-10 NA 4.19e-08
3. B Q9SXY1 Chromatin assembly factor 1 subunit FAS2 1.03e-05 NA 0.012
3. B P0CY34 Transcriptional repressor TUP1 2.30e-04 NA 2.38e-04
3. B B0XTS1 Probable E3 ubiquitin ligase complex SCF subunit sconB 8.43e-03 NA 0.002
3. B P61964 WD repeat-containing protein 5 3.12e-06 NA 0.002
3. B O14170 WD repeat-containing protein pop2 6.24e-03 NA 0.031
3. B P36408 Guanine nucleotide-binding protein subunit beta 5.78e-11 NA 1.23e-04
3. B P0CS42 Nuclear distribution protein PAC1 1.23e-07 NA 2.74e-05
3. B Q95JL5 Cilia- and flagella-associated protein 52 2.33e-15 NA 7.11e-06
3. B O35142 Coatomer subunit beta' 4.38e-05 NA 0.025
3. B Q9QXE7 F-box-like/WD repeat-containing protein TBL1X 2.86e-05 NA 6.82e-04
3. B P0CS47 Polyadenylation factor subunit 2 1.08e-03 NA 4.98e-04
3. B Q9BZK7 F-box-like/WD repeat-containing protein TBL1XR1 4.78e-05 NA 0.003
3. B P90648 Myosin heavy chain kinase B 4.81e-02 NA 0.002
3. B Q5F201 Cilia- and flagella-associated protein 52 0.00e+00 NA 2.08e-05
3. B Q6TMK6 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 NA NA 0.003
3. B Q54S59 WD repeat-containing protein 61 homolog 3.49e-10 NA 0.001
3. B Q9DAJ4 WD repeat domain-containing protein 83 1.01e-06 NA 0.008
3. B Q05946 U3 small nucleolar RNA-associated protein 13 8.09e-09 NA 7.62e-04
3. B Q9HC35 Echinoderm microtubule-associated protein-like 4 4.82e-10 NA 4.67e-14
3. B A0A1P8AW69 Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.1 1.28e-04 NA 2.14e-07
3. B Q4R7Y4 Guanine nucleotide-binding protein subunit beta-2-like 1 1.21e-07 NA 0.005
3. B Q6CBI8 Probable cytosolic iron-sulfur protein assembly protein 1 2.83e-09 NA 0.025
3. B Q91WQ5 TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L 7.72e-03 NA 3.30e-06
3. B Q803D2 Lissencephaly-1 homolog B 7.56e-06 NA 4.47e-04
3. B Q54WA3 Peroxisomal targeting signal 2 receptor 6.05e-09 NA 6.99e-07
3. B B4J8H6 WD repeat-containing protein 48 homolog 1.33e-03 NA 3.67e-04
3. B Q26544 WD repeat-containing protein SL1-17 NA NA 0.004
3. B Q28D01 WD repeat-containing protein 26 1.11e-03 NA 0.014
3. B Q8JZX3 POC1 centriolar protein homolog A 6.96e-08 NA 1.44e-08
3. B Q6ED65 Echinoderm microtubule-associated protein-like 5 2.52e-07 NA 5.34e-12
3. B P40968 Pre-mRNA-processing factor 17 3.36e-04 NA 0.001
3. B Q9VLN1 WD repeat-containing protein 82 5.01e-06 NA 8.86e-04
3. B Q8NBT0 POC1 centriolar protein homolog A 3.61e-08 NA 1.10e-08
3. B O24076 Guanine nucleotide-binding protein subunit beta-like protein 1.20e-07 NA 0.003
3. B Q9BV38 WD repeat-containing protein 18 4.88e-06 NA 0.005
3. B P49695 Probable serine/threonine-protein kinase PkwA 8.71e-05 NA 7.10e-12
3. B Q9Y1C1 77 kDa echinoderm microtubule-associated protein (Fragment) 0.00e+00 NA 2.92e-18
3. B Q8TBY9 Cilia- and flagella-associated protein 251 3.30e-06 NA 5.74e-04
3. B Q95RJ9 F-box-like/WD repeat-containing protein ebi 1.12e-04 NA 2.87e-04
3. B O74319 Transcription initiation factor TFIID subunit taf73 5.58e-04 NA 1.11e-08
3. B Q05B17 WD repeat-containing protein 48 5.78e-03 NA 3.51e-04
3. B Q32P44 Echinoderm microtubule-associated protein-like 3 4.32e-09 NA 5.59e-10
3. B Q4R8E7 Dynein assembly factor with WDR repeat domains 1 1.45e-05 NA 6.12e-08
3. B P17343 Guanine nucleotide-binding protein subunit beta-1 6.40e-08 NA 3.36e-05
3. B B4KRQ4 WD repeat-containing protein 48 homolog 1.77e-03 NA 3.01e-04
3. B Q4VBE8 WD repeat-containing protein 18 1.26e-05 NA 0.001
3. B P61965 WD repeat-containing protein 5 1.92e-05 NA 0.002
3. B Q93134 Guanine nucleotide-binding protein subunit beta-2-like 1 1.36e-07 NA 0.015
3. B C5DJH6 Spindle pole body component 110 1.25e-05 NA 0.043
3. B Q6GL39 WD repeat-containing protein 82 5.76e-06 NA 8.79e-04
3. B A7RM20 Eukaryotic translation initiation factor 3 subunit I 8.40e-10 NA 0.049
3. B Q96J01 THO complex subunit 3 2.31e-05 NA 0.004
3. B F6ZT52 POC1 centriolar protein homolog B 4.39e-09 NA 9.08e-08
3. B P29829 Guanine nucleotide-binding protein subunit beta-2 5.55e-08 NA 0.009
3. B Q9S7I8 Cell division cycle 20.2, cofactor of APC complex 2.28e-04 NA 0.018
3. B Q5U2W5 Transducin beta-like protein 3 3.87e-08 NA 6.34e-04
3. B Q32PG3 WD repeat-containing protein 48 5.79e-03 NA 7.05e-04
3. B P43033 Platelet-activating factor acetylhydrolase IB subunit beta 4.31e-10 NA 5.27e-04
3. B Q6FJS0 Polyadenylation factor subunit 2 1.36e-04 NA 0.006
3. B Q8C0J2 Autophagy-related protein 16-1 1.96e-04 NA 1.23e-04
3. B P35605 Coatomer subunit beta' 5.53e-05 NA 0.009
3. B Q00808 Vegetative incompatibility protein HET-E-1 1.84e-05 NA 5.26e-07
3. B Q5ZJH5 WD repeat-containing protein 61 6.72e-11 NA 1.54e-04
3. B P63246 Receptor of activated protein C kinase 1 1.13e-07 NA 0.005
3. B Q9C0C7 Activating molecule in BECN1-regulated autophagy protein 1 1.15e-01 NA 0.044
3. B Q2TAF3 Echinoderm microtubule-associated protein-like 4 2.87e-10 NA 4.81e-16
3. B C0S902 Nuclear distribution protein PAC1 7.19e-06 NA 7.91e-05
3. B Q8N136 Dynein assembly factor with WDR repeat domains 1 1.39e-05 NA 3.36e-07
3. B B3NSK1 WD repeat-containing protein 48 homolog 9.78e-04 NA 0.002
3. B Q6NS57 Mitogen-activated protein kinase-binding protein 1 9.15e-11 NA 0.017
3. B Q7ZVF0 POC1 centriolar protein homolog A 2.40e-07 NA 7.25e-08
3. B Q8H0T9 Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.4 6.08e-05 NA 5.12e-07
3. B Q6BVZ3 Polyadenylation factor subunit 2 8.51e-05 NA 0.041
3. B O75083 WD repeat-containing protein 1 2.30e-12 NA 0.017
3. B Q4V7Y7 Katanin p80 WD40 repeat-containing subunit B1 1.22e-03 NA 0.002
3. B P87060 WD repeat-containing protein pop1 9.96e-03 NA 0.014
3. B A8XZJ9 Lissencephaly-1 homolog 1.59e-10 NA 1.76e-05
3. B P0CS43 Nuclear distribution protein PAC1 1.29e-07 NA 2.74e-05
3. B Q7TNG5 Echinoderm microtubule-associated protein-like 2 0.00e+00 NA 2.85e-15
3. B B4HND9 WD repeat-containing protein 48 homolog 5.06e-04 NA 3.12e-04
3. B Q8N0X2 Sperm-associated antigen 16 protein 3.29e-04 NA 6.95e-08
3. B Q5GIS3 Guanine nucleotide-binding protein subunit beta 6.64e-08 NA 4.66e-04
3. B Q8BHJ5 F-box-like/WD repeat-containing protein TBL1XR1 2.91e-05 NA 0.003
3. B Q5EBD9 Elongator complex protein 2 8.21e-07 NA 0.035
3. B Q61ZF6 Guanine nucleotide-binding protein subunit beta-1 6.39e-08 NA 3.36e-05
3. B A8IZG4 Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog 8.05e-10 NA 0.001
3. B Q6GMD2 WD repeat-containing protein 61 1.07e-10 NA 0.006
3. B Q8K450 Sperm-associated antigen 16 protein 1.38e-04 NA 8.25e-05
3. B Q4ICM0 Nuclear distribution protein PAC1 2.48e-08 NA 0.024
3. B P70483 Striatin 1.52e-02 NA 0.011
3. B A2AH22 Activating molecule in BECN1-regulated autophagy protein 1 4.50e-01 NA 0.042
3. B B0XFT7 Eukaryotic translation initiation factor 3 subunit I 1.21e-09 NA 0.001
3. B P62873 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 7.18e-08 NA 0.011
3. B Q5F3K4 WD repeat-containing protein 48 8.67e-04 NA 5.90e-04
3. B Q99LC2 Cleavage stimulation factor subunit 1 4.53e-05 NA 0.002
3. B Q4V7Z1 POC1 centriolar protein homolog B 4.31e-09 NA 2.06e-07
3. B Q5SQM0 Echinoderm microtubule-associated protein-like 6 1.97e-07 NA 5.01e-16
3. B Q54DM1 Mitotic checkpoint protein bub3 8.58e-06 NA 0.013
3. B A0A1L8HX76 WD repeat-containing protein 18 4.67e-06 NA 0.002
3. B Q15542 Transcription initiation factor TFIID subunit 5 4.66e-04 NA 9.66e-08
3. B Q01369 Guanine nucleotide-binding protein subunit beta-like protein 8.25e-08 NA 2.06e-04
3. B Q5RBZ3 WD repeat-containing protein 89 2.25e-04 NA 0.032
3. B Q5RFF8 Notchless protein homolog 1 2.20e-04 NA 0.034
3. B Q22006 Pre-rRNA-processing protein pro-1 2.61e-06 NA 7.57e-04
3. B O35353 Guanine nucleotide-binding protein subunit beta-4 2.65e-07 NA 0.002
3. B B4GIJ0 WD repeat-containing protein 48 homolog 1.04e-03 NA 0.002
3. B Q5IH81 Eukaryotic translation initiation factor 3 subunit I 3.10e-09 NA 0.003
3. B Q96WV5 Putative coatomer subunit alpha 5.68e-06 NA 0.003
3. B O14775 Guanine nucleotide-binding protein subunit beta-5 1.45e-04 NA 0.014
3. B P87314 Protein hir1 2.01e-02 NA 0.020
3. B Q9YGY3 Mitotic checkpoint protein BUB3 1.22e-07 NA 0.014
3. B P49026 Guanine nucleotide-binding protein subunit beta-like protein 1.28e-07 NA 0.006
3. B Q5RF51 U5 small nuclear ribonucleoprotein 40 kDa protein 2.14e-05 NA 6.30e-04
3. B Q5BLX8 WD repeat domain-containing protein 83 1.19e-05 NA 0.016
3. B P62871 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 4.98e-08 NA 0.011
3. B Q3Y8L7 Dynein assembly factor with WDR repeat domains 1 3.94e-05 NA 8.71e-04
3. B P63004 Platelet-activating factor acetylhydrolase IB subunit alpha 3.26e-09 NA 3.16e-04
3. B Q6PNB6 Guanine nucleotide-binding protein subunit beta-5 6.50e-08 NA 0.014
3. B P35458 Dynactin subunit 1 NA NA 0.022
3. B O42248 Guanine nucleotide-binding protein subunit beta-2-like 1 2.40e-06 NA 0.003
3. B G5EEG7 Smu-1 suppressor of mec-8 and unc-52 protein 2.82e-06 NA 4.00e-04
3. B Q8L3Z8 Protein FIZZY-RELATED 2 1.00e-04 NA 0.015
3. B Q38942 Protein RAE1 5.29e-08 NA 0.013
3. B Q9Y7S2 UPF0612 protein C569.003 5.78e-01 NA 0.001
3. B Q2GT28 Nuclear distribution protein PAC1-2 2.37e-09 NA 1.42e-04
3. B Q8MY12 Myosin heavy chain kinase C 3.21e-03 NA 0.010
3. B O74184 Target of rapamycin complex subunit wat1 2.27e-07 NA 0.003
3. B Q8N157 Jouberin 5.51e-03 NA 0.001
3. B Q2KIG2 WD repeat-containing protein 5 3.66e-06 NA 0.002
3. B A1C7E4 Probable E3 ubiquitin ligase complex SCF subunit sconB 3.10e-03 NA 5.87e-04
3. B O55029 Coatomer subunit beta' 2.84e-06 NA 0.007
3. B P97499 Telomerase protein component 1 7.44e-04 NA 0.004
3. B Q94BR4 Pre-mRNA-processing factor 19 homolog 1 1.82e-04 NA 2.48e-05
3. B Q9LV28 Receptor for activated C kinase 1C 1.25e-07 NA 0.002
3. B P62880 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 2.73e-07 NA 8.72e-04
3. B B4QB64 WD repeat-containing protein 48 homolog 9.82e-04 NA 3.40e-04
3. B O43017 Set1 complex component swd3 4.01e-05 NA 0.035
3. B Q9BRX9 WD repeat domain-containing protein 83 1.13e-05 NA 0.025
3. B B5X3C4 Lissencephaly-1 homolog B 4.56e-10 NA 3.19e-04
3. B A3LX18 Eukaryotic translation initiation factor 3 subunit I 1.15e-06 NA 0.002
3. B Q9WVA3 Mitotic checkpoint protein BUB3 9.54e-08 NA 0.033
3. B Q3SZD4 WD repeat-containing protein 18 6.89e-06 NA 0.003
3. B P36104 COMPASS component SWD2 2.57e-06 NA 0.026
3. B Q25189 Guanine nucleotide-binding protein subunit beta-like protein 1.03e-07 NA 0.001
3. B A2QCU8 Probable E3 ubiquitin ligase complex SCF subunit sconB 5.29e-03 NA 7.73e-05
3. B Q9C4Z6 Receptor for activated C kinase 1B 1.26e-07 NA 0.006
3. B Q10051 Pre-mRNA-processing factor 19 2.98e-04 NA 0.017
3. B Q6L4F8 Guanine nucleotide-binding protein subunit beta-like protein B 1.73e-07 NA 1.76e-04
3. B Q54D08 Protein LST8 homolog 2.16e-07 NA 0.002
3. B Q6TNS2 p21-activated protein kinase-interacting protein 1-like 2.32e-05 NA 3.38e-04
3. B Q229Z6 POC1 centriolar protein homolog 1.79e-04 NA 3.61e-06
3. B C1GB49 Nuclear distribution protein PAC1 1.29e-05 NA 2.40e-04
3. B Q2KID6 Pleiotropic regulator 1 2.87e-04 NA 1.86e-05
3. B O14435 Guanine nucleotide-binding protein subunit beta 7.43e-11 NA 0.010
3. B Q7KWL3 DDB1- and CUL4-associated factor 13 1.66e-06 NA 0.048
3. B Q9BVA0 Katanin p80 WD40 repeat-containing subunit B1 1.88e-04 NA 9.80e-06
3. B Q80ZD0 Guanine nucleotide-binding protein subunit beta-5 6.73e-08 NA 0.011
3. B O13282 Transcription initiation factor TFIID subunit 5 6.79e-04 NA 2.82e-09
3. B O43660 Pleiotropic regulator 1 3.46e-04 NA 1.91e-05
3. B B3S4I5 Lissencephaly-1 homolog 4.90e-08 NA 0.006
3. B Q4P9P9 Nuclear distribution protein PAC1 1.34e-10 NA 0.036
3. B P25387 Guanine nucleotide-binding protein subunit beta-like protein 7.30e-08 NA 6.19e-05
3. B P79147 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 7.21e-08 NA 3.64e-05
3. B B6GZA1 Probable E3 ubiquitin ligase complex SCF subunit sconB 5.38e-03 NA 0.011
3. B Q5RFQ3 Periodic tryptophan protein 2 homolog 7.02e-06 NA 0.043
3. B Q8VC03 Echinoderm microtubule-associated protein-like 3 3.83e-09 NA 2.75e-12
3. B Q9UUG8 Transcriptional repressor tup12 5.78e-04 NA 8.42e-05
3. B Q20059 WD repeat-containing protein 48 homolog 8.37e-04 NA 3.94e-05
3. B Q8BQM8 Echinoderm microtubule-associated protein-like 5 3.54e-07 NA 5.48e-12
3. B Q25306 Guanine nucleotide-binding protein subunit beta-like protein 1.26e-07 NA 2.14e-06
3. B B4MFM2 WD repeat-containing protein 48 homolog 1.90e-03 NA 3.26e-04
3. B O13046 WD repeat and HMG-box DNA-binding protein 1 1.22e-02 NA 0.001
3. B Q6P5M2 WD repeat-containing protein 61 7.27e-11 NA 4.79e-04
3. B Q9VU65 POC1 centriolar protein homolog 8.90e-07 NA 2.78e-04
3. B Q9USN3 Probable U3 small nucleolar RNA-associated protein 13 2.82e-08 NA 1.08e-05
3. B Q9FMU5 U3 small nucleolar RNA-associated protein 18 homolog 1.87e-03 NA 0.009
3. B B3MET8 WD repeat-containing protein 48 homolog 3.98e-04 NA 0.002
3. B Q9LXN4 Protein HIRA 1.16e-02 NA 0.024
3. B Q15269 Periodic tryptophan protein 2 homolog 7.27e-08 NA 0.015
3. B Q54PE0 Periodic tryptophan protein 2 homolog 3.18e-08 NA 0.001
3. B Q9M2Z2 COMPASS-like H3K4 histone methylase component WDR5A 1.32e-09 NA 2.46e-08
3. B Q16MY0 WD repeat-containing protein 48 homolog 1.15e-03 NA 0.001
3. B Q6ZPG2 WD repeat-containing protein 90 6.26e-10 NA 0.007
3. B Q9AYE4 Target of rapamycin complex subunit LST8 2.52e-07 NA 4.32e-04
3. B P63005 Platelet-activating factor acetylhydrolase IB subunit beta 3.79e-09 NA 3.16e-04
3. B P63243 Receptor of activated protein C kinase 1 1.24e-07 NA 0.005
3. B Q09855 F-box/WD repeat-containing protein pof11 1.29e-03 NA 4.86e-06
3. B O13615 Pre-mRNA-splicing factor prp5 1.03e-04 NA 9.51e-07
3. B Q9FUY2 Transcriptional corepressor LEUNIG 4.04e-03 NA 2.69e-04
3. B P93340 Guanine nucleotide-binding protein subunit beta-like protein 1.22e-07 NA 5.75e-04
3. B Q26613 77 kDa echinoderm microtubule-associated protein 0.00e+00 NA 3.19e-14
3. B Q00659 Probable E3 ubiquitin ligase complex SCF subunit sconB 2.46e-03 NA 0.002
3. B Q60675 Laminin subunit alpha-2 NA NA 0.014
3. B Q9ERF3 WD repeat-containing protein 61 8.43e-11 NA 4.19e-04
3. B Q6NVM2 Katanin p80 WD40 repeat-containing subunit B1 1.70e-02 NA 0.004
3. B Q92614 Unconventional myosin-XVIIIa 1.32e-02 NA 0.013
3. B Q5JTN6 WD repeat-containing protein 38 3.05e-06 NA 6.30e-06
3. B Q5RD06 POC1 centriolar protein homolog B 7.11e-09 NA 3.49e-08
3. B Q7KWK5 Pre-mRNA-processing factor 19 1.17e-04 NA 0.001
3. B Q9Z1Z2 Serine-threonine kinase receptor-associated protein 5.18e-06 NA 0.036
3. B Q6NV31 WD repeat-containing protein 82 6.36e-06 NA 8.11e-06
3. B P62879 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 2.72e-07 NA 8.72e-04
3. B Q55563 Uncharacterized WD repeat-containing protein sll0163 1.34e-06 NA 2.79e-07
3. B Q7QJ33 Ribosome biogenesis protein WDR12 homolog 2.05e-05 NA 0.038
3. B D3ZW91 POC1 centriolar protein homolog B 3.20e-08 NA 5.10e-07
3. B O62621 Coatomer subunit beta' 7.62e-06 NA 0.022
3. B P59328 WD repeat and HMG-box DNA-binding protein 1 1.01e-03 NA 0.005
3. B O42249 Guanine nucleotide-binding protein subunit beta-2-like 1 1.09e-07 NA 0.010
3. B O62471 Protein qui-1 3.97e-05 NA 2.44e-09
3. B P68040 Receptor of activated protein C kinase 1 4.09e-07 NA 0.005
3. B A1CUD6 Nuclear distribution protein nudF 1 4.50e-09 NA 0.009
3. B A8ILK1 Cilia- and flagella-associated protein 52 0.00e+00 NA 4.77e-05
3. B Q9WUC8 Pleiotropic regulator 1 8.73e-05 NA 4.18e-05
3. B Q15291 Retinoblastoma-binding protein 5 1.35e-03 NA 0.037
3. B Q5RKI0 WD repeat-containing protein 1 2.86e-12 NA 0.027
3. B O61585 Katanin p80 WD40 repeat-containing subunit B1 2.17e-02 NA 0.009
3. B Q5EBE8 Eukaryotic translation initiation factor 3 subunit I 1.86e-09 NA 0.007
3. B Q5ZME8 WD40 repeat-containing protein SMU1 2.43e-06 NA 0.019
3. B Q2TBP4 POC1 centriolar protein homolog A 6.83e-10 NA 2.89e-09
3. B P74598 Uncharacterized WD repeat-containing protein sll1491 3.65e-05 NA 5.57e-05
3. B Q5AI86 Eukaryotic translation initiation factor 3 subunit I 8.30e-07 NA 0.043
3. B P93397 Guanine nucleotide-binding protein subunit beta-1 5.09e-10 NA 0.045
3. B Q6PH57 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 2.82e-07 NA 6.39e-05
3. B P20053 U4/U6 small nuclear ribonucleoprotein PRP4 2.93e-05 NA 4.87e-05
3. B Q5RE95 WD repeat-containing protein 5B 5.19e-06 NA 5.05e-05
3. B Q9Y3F4 Serine-threonine kinase receptor-associated protein 3.76e-06 NA 0.008
3. B Q4V8C4 WD repeat-containing protein 5B 2.43e-07 NA 0.001
3. B Q96FK6 WD repeat-containing protein 89 8.27e-04 NA 0.045
3. B P33750 Protein SOF1 3.09e-05 NA 0.004
3. B Q6PBD6 WD repeat-containing protein 61 1.21e-10 NA 6.70e-04
3. B A8XXC7 WD repeat and FYVE domain-containing protein 2 1.62e-04 NA 0.009
3. B P69103 Guanine nucleotide-binding protein subunit beta-like protein 1.45e-07 NA 8.05e-06
3. B P29387 Guanine nucleotide-binding protein subunit beta-4 2.63e-07 NA 0.002
3. B B4P7H8 WD repeat-containing protein 48 homolog 2.62e-03 NA 0.002
3. B B7PS00 Lissencephaly-1 homolog 9.70e-08 NA 1.34e-05
3. B Q7ZUV2 Katanin p80 WD40 repeat-containing subunit B1 3.01e-04 NA 8.73e-04
3. B Q8C7V3 U3 small nucleolar RNA-associated protein 15 homolog 1.55e-04 NA 5.46e-04
3. B Q05BC3 Echinoderm microtubule-associated protein-like 1 0.00e+00 NA 1.19e-07
3. B P16520 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 7.10e-08 NA 8.61e-05
3. B B4JB43 Eukaryotic translation initiation factor 3 subunit I 3.26e-09 NA 0.020
3. B Q05BV3 Echinoderm microtubule-associated protein-like 5 3.36e-07 NA 3.41e-12
3. B P43034 Platelet-activating factor acetylhydrolase IB subunit beta 4.57e-10 NA 3.57e-04
3. B P11017 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 2.68e-07 NA 8.72e-04
3. B Q9UT85 Uncharacterized WD repeat-containing protein C343.04c 3.91e-06 NA 0.045
3. B O75717 WD repeat and HMG-box DNA-binding protein 1 3.10e-03 NA 0.002
3. B Q5RE88 Cilia- and flagella-associated protein 251 7.56e-06 NA 0.002
3. B Q640J6 WD repeat-containing protein 82-A 5.74e-06 NA 0.016
3. B Q8L828 Coatomer subunit beta'-3 2.09e-06 NA 0.013
3. B A1DHW6 Probable E3 ubiquitin ligase complex SCF subunit sconB 3.00e-03 NA 0.002
3. B O14727 Apoptotic protease-activating factor 1 6.02e-08 NA 1.17e-05
3. B O45487 Echinoderm microtubule-associated protein-like elp-1 2.22e-16 NA 3.50e-05
3. B Q6GNU1 Actin-related protein 2/3 complex subunit 1B-B 1.03e-07 NA 0.019
3. B Q4RJN5 Lissencephaly-1 homolog 4.33e-10 NA 0.001
3. B O45040 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 7.21e-08 NA 0.005
3. B B2B766 Nuclear distribution protein PAC1-2 2.75e-05 NA 0.006
3. B Q2KJH4 WD repeat-containing protein 1 3.94e-12 NA 0.001