Results | PROST

Summary

Q96N11

Homolog: Q54CL0.
Function: Apoptosis inhibitor 5 homolog.

Statistics

Total GO Annotation: 113
Unique PROST Go: 113
Unique BLAST Go: 0

Total Homologs: 70
Unique PROST Homologs: 67
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was Q54CL0 (Apoptosis inhibitor 5 homolog) with a FATCAT P-Value: 0.000564 and RMSD of 4.94 angstrom. The sequence alignment identity is 21.7%.
Structural alignment shown in left. Query protein Q96N11 colored as red in alignment, homolog Q54CL0 colored as blue. Query protein Q96N11 is also shown in right top, homolog Q54CL0 showed in right bottom. They are colored based on secondary structures.

  Q96N11 -------------------------------MSDIRHSLLRRDA-LSAAKEVLYHLDIYFSSQLQSAP-LPIVDKGPV--ELLEEFVFQVPKE-RSAQP- 63
  Q54CL0 METTTTTTTAAATKGTNDAMETSSSTTATPTTATVVPQVVRNDEYIN----TFY--DI--ANKLDTNPSFPDDDK--LFSKIIE--LSSKTKQTKKLSPQ 88

  Q96N11 ------KRLNSLQE------LQLLE------IM-----------CNYFQEQTKDSVRQI--IFSSLFSPQGNK--ADDSRMSL--LGKLVSMAVAVCRIP 128
  Q54CL0 FISKYFKRFPTLQEKAIDCLIDLFDSSDEDVIMRVNALKAIPTIC---RDN-PDHIAKLVDILSQLLNTD-SKVEAEHTKNSLIELYKLNSVTTLNSFLT 183

  Q96N11 VLECAASWLQRTPVVYCVRLA--KA----LV-DDYCCLVPGSIQT--------LKQIFSASPRFCCQFITSVTALYDLSSDDLIPPMDLLEMIVTWIFED 213
  Q54CL0 FLESEESSMEDQPASSTL-LSFLKESIIPLVRTEYS---KSSIETQTFFRVRILKLI--AK---C----TSTTEL------DLL--FQLLECFTQYKVQE 262

  Q96N11 PRLILITFLNTPIAAN-LPIGFLE---L-TPLVGLIRWCVKAPLAYKRKKKPPLSNGHV---SNKVTKD-------PGVG-MD--RDSHL--LYSKL--H 291
  Q54CL0 ----TITDLET----NVLPV--IESQSLDTIRKKLINF-TKI-LLFK-SKKP-----HTEINSNKLF-DLYLNKIFPKVNELDETNKTELVSVFSQVTPH 343

  Q96N11 LS--V-LQVL--------MT-----------LQLHLT--EKNLY-----G--------RL-G--LIL---FDHM--VPL-VEEI---NRLADE--LNPL- 339
  Q54CL0 MTQEISMQFLEPVYNLFKATVPSKTTTPVADVDLQFTIVEALLFALSSIGSKSTSSLCKLCGFKLVTGQPSD-MNADPVKYEDFLGRHRFLDEKCRETLG 442

  Q96N11 NASQEIELSL----DRLAQALQVAMASGALLCTRDDLRTLCSRL----PHNNLLQLVISGPV----QQSPHAALPPGFYP--HIH---TPPL------GY 416
  Q54CL0 KAKKAIP-NLGNPKDK-AQ-LKLAQKT--LLSTQNIL-TIMQNLLKSPPVTNINNLVISSTIFKGKQNLIH-NVSPVFKPQQHQHQHQQQQVQQKQYQKY 535

  Q96N11 GA-------VP--------AHPAAH---PALPTHPG--HTFI-----SGVTFPF------RPIR--------- 449
  Q54CL0 QAQQQQQQNIPIQRNQQQQQQQKSNRYQPYV-T-PGRRHQDLDKPKQDGVEVHYYSEKHNKPSSFKGRGPKSY 606

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
2. P	GO:0017134	fibroblast growth factor binding
2. P	GO:1990403	embryonic brain development
2. P	GO:0000151	ubiquitin ligase complex
2. P	GO:0042771	intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
2. P	GO:0030174	regulation of DNA-dependent DNA replication initiation
2. P	GO:0045294	alpha-catenin binding
2. P	GO:0005654	nucleoplasm
2. P	GO:0006267	pre-replicative complex assembly involved in nuclear cell cycle DNA replication
2. P	GO:1905516	positive regulation of fertilization
2. P	GO:0008283	cell population proliferation
2. P	GO:0042809	vitamin D receptor binding
2. P	GO:1990834	response to odorant
2. P	GO:0034244	negative regulation of transcription elongation from RNA polymerase II promoter
2. P	GO:0035118	embryonic pectoral fin morphogenesis
2. P	GO:0000056	ribosomal small subunit export from nucleus
2. P	GO:0030901	midbrain development
2. P	GO:0003713	transcription coactivator activity
2. P	GO:0021986	habenula development
2. P	GO:0008022	protein C-terminus binding
2. P	GO:0000159	protein phosphatase type 2A complex
2. P	GO:0007507	heart development
2. P	GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process
2. P	GO:0019827	stem cell population maintenance
2. P	GO:2000270	negative regulation of fibroblast apoptotic process
2. P	GO:0030690	Noc1p-Noc2p complex
2. P	GO:2000142	regulation of DNA-templated transcription, initiation
2. P	GO:0048872	homeostasis of number of cells
2. P	GO:0039657	suppression by virus of host gene expression
2. P	GO:1902254	negative regulation of intrinsic apoptotic signaling pathway by p53 class mediator
2. P	GO:0039704	viral translational shunt
2. P	GO:0043067	regulation of programmed cell death
2. P	GO:0000138	Golgi trans cisterna
2. P	GO:0032021	NELF complex
2. P	GO:0001843	neural tube closure
2. P	GO:0000472	endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
2. P	GO:0039701	microtubule-dependent intracellular transport of viral material towards cell periphery
2. P	GO:0014044	Schwann cell development
2. P	GO:0014003	oligodendrocyte development
2. P	GO:0019903	protein phosphatase binding
2. P	GO:0005634	nucleus
2. P	GO:0036342	post-anal tail morphogenesis
2. P	GO:0001164	RNA polymerase I core promoter sequence-specific DNA binding
2. P	GO:0072542	protein phosphatase activator activity
2. P	GO:0007030	Golgi organization
2. P	GO:0001835	blastocyst hatching
2. P	GO:0019033	viral tegument
2. P	GO:0021915	neural tube development
2. P	GO:0014032	neural crest cell development
2. P	GO:0000221	vacuolar proton-transporting V-type ATPase, V1 domain
2. P	GO:0019888	protein phosphatase regulator activity
2. P	GO:0008287	protein serine/threonine phosphatase complex
2. P	GO:0003723	RNA binding
2. P	GO:0050935	iridophore differentiation
2. P	GO:0046589	ribonuclease T1 activity
2. P	GO:0000480	endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
2. P	GO:0005681	spliceosomal complex
2. P	GO:0043066	negative regulation of apoptotic process
2. P	GO:0032515	negative regulation of phosphoprotein phosphatase activity
2. P	GO:0021982	pineal gland development
2. P	GO:0090245	axis elongation involved in somitogenesis
2. P	GO:0046966	thyroid hormone receptor binding
2. P	GO:0048702	embryonic neurocranium morphogenesis
2. P	GO:0080163	regulation of protein serine/threonine phosphatase activity
2. P	GO:0003682	chromatin binding
2. P	GO:0009088	threonine biosynthetic process
2. P	GO:0000775	chromosome, centromeric region
2. P	GO:0048863	stem cell differentiation
2. P	GO:0016342	catenin complex
2. P	GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest
2. P	GO:0006357	regulation of transcription by RNA polymerase II
2. P	GO:0007028	cytoplasm organization
2. P	GO:0005667	transcription regulator complex
2. P	GO:0043583	ear development
2. P	GO:0021510	spinal cord development
2. P	GO:0007492	endoderm development
2. P	GO:0002761	regulation of myeloid leukocyte differentiation
2. P	GO:0005794	Golgi apparatus
2. P	GO:0001181	RNA polymerase I general transcription initiation factor activity
2. P	GO:0008278	cohesin complex
2. P	GO:0021591	ventricular system development
2. P	GO:0019068	virion assembly
2. P	GO:0031952	regulation of protein autophosphorylation
2. P	GO:0021654	rhombomere boundary formation
2. P	GO:0021954	central nervous system neuron development
2. P	GO:0001042	RNA polymerase I core binding
2. P	GO:0007288	sperm axoneme assembly
2. P	GO:0006915	apoptotic process
2. P	GO:2000737	negative regulation of stem cell differentiation
2. P	GO:0006470	protein dephosphorylation
2. P	GO:0003712	transcription coregulator activity
2. P	GO:0006364	rRNA processing
2. P	GO:0007000	nucleolus organization
2. P	GO:0097344	Rix1 complex
2. P	GO:0048703	embryonic viscerocranium morphogenesis
2. P	GO:0005797	Golgi medial cisterna
2. P	GO:0016592	mediator complex
2. P	GO:0042048	olfactory behavior
2. P	GO:0042176	regulation of protein catabolic process
2. P	GO:0006361	transcription initiation from RNA polymerase I promoter
2. P	GO:0043666	regulation of phosphoprotein phosphatase activity
2. P	GO:0045944	positive regulation of transcription by RNA polymerase II
2. P	GO:0060071	Wnt signaling pathway, planar cell polarity pathway
2. P	GO:0060070	canonical Wnt signaling pathway
2. P	GO:0048477	oogenesis
2. P	GO:0045893	positive regulation of transcription, DNA-templated
2. P	GO:0019060	intracellular transport of viral protein in host cell
2. P	GO:0005730	nucleolus
2. P	GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic
2. P	GO:0044177	host cell Golgi apparatus
2. P	GO:0010976	positive regulation of neuron projection development
2. P	GO:0008013	beta-catenin binding
2. P	GO:1902093	positive regulation of flagellated sperm motility
2. P	GO:0060261	positive regulation of transcription initiation from RNA polymerase II promoter

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	Q96N11	Uncharacterized protein C7orf26	0	3.16e-154	0.0
1. PB	Q8BGA7	Uncharacterized protein C7orf26 homolog	0.00e+00	3.53e-99	0.0
1. PB	Q7ZTY6	Uncharacterized protein C7orf26 homolog	0.00e+00	1.50e-28	0.0
2. P	P11823	Shutoff protein	NA	7.57e-03	NA
2. P	Q8C0Y0	Serine/threonine-protein phosphatase 4 regulatory subunit 4	8.40e-03	7.88e-03	NA
2. P	A8E1G1	Protein M35	NA	6.89e-05	NA
2. P	P36714	Shutoff protein	NA	1.28e-03	NA
2. P	E3M3V1	Guanyl-specific ribonuclease pgl-1	2.63e-02	4.55e-03	NA
2. P	Q6DDM4	Apoptosis inhibitor 5-A	6.55e-04	6.25e-03	NA
2. P	O74447	Uncharacterized protein C16C4.02c	1.10e-03	2.59e-04	NA
2. P	Q86YW9	Mediator of RNA polymerase II transcription subunit 12-like protein	2.54e-01	4.33e-03	NA
2. P	Q8WX92	Negative elongation factor B	1.49e-03	8.08e-05	NA
2. P	Q28651	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform	1.70e-03	8.78e-04	NA
2. P	Q9V431	Apoptosis inhibitor 5 homolog	7.72e-04	4.84e-03	NA
2. P	P84405	Inner tegument protein	NA	2.01e-02	NA
2. P	Q54CL0	Apoptosis inhibitor 5 homolog	5.64e-04	1.10e-03	NA
2. P	O13776	Ubp5-interacting protein ftp105	1.13e-01	3.20e-02	NA
2. P	P38883	Pre-rRNA-processing protein RIX1	6.27e-03	7.42e-03	NA
2. P	A2AGH6	Mediator of RNA polymerase II transcription subunit 12	3.10e-01	4.54e-04	NA
2. P	A6ZTA3	Pre-rRNA-processing protein RIX1	4.75e-03	1.03e-02	NA
2. P	Q7YQK8	Mediator of RNA polymerase II transcription subunit 12	2.57e-01	4.93e-02	NA
2. P	A5DLL7	Pre-rRNA-processing protein RIX1	4.55e-03	3.90e-04	NA
2. P	Q9W1X7	Mediator of RNA polymerase II transcription subunit 23	1.42e-01	3.75e-03	NA
2. P	Q6AXP3	Protein FAM227B	9.84e-03	5.15e-03	NA
2. P	Q8C4Y3	Negative elongation factor B	2.21e-03	1.23e-05	NA
2. P	Q2QCI8	Mediator of RNA polymerase II transcription subunit 12	2.60e-01	3.84e-02	NA
2. P	P25355	Copper transport protein 86	3.69e-03	1.42e-02	NA
2. P	A8XDF8	Probable V-type proton ATPase subunit H 1	1.26e-03	1.18e-03	NA
2. P	Q2UG94	Mediator of RNA polymerase II transcription subunit 5	1.30e-01	2.99e-02	NA
2. P	Q10669	Mediator of RNA polymerase II transcription subunit 23	1.01e-01	1.58e-02	NA
2. P	Q9BZZ5	Apoptosis inhibitor 5	8.73e-04	4.37e-03	NA
2. P	Q9QJ55	Protein U4	NA	2.46e-02	NA
2. P	Q9Y113	Negative elongation factor B	3.06e-03	8.06e-04	NA
2. P	O36021	Uncharacterized protein C4F10.09c	5.03e-03	9.16e-03	NA
2. P	Q5AGE5	Copper transport protein 86	1.41e-03	3.39e-02	NA
2. P	P11824	Shutoff protein	NA	4.48e-02	NA
2. P	Q7TSI3	Serine/threonine-protein phosphatase 6 regulatory subunit 1	1.52e-02	4.70e-02	NA
2. P	Q5RCU2	Mediator of RNA polymerase II transcription subunit 12	3.05e-01	3.81e-04	NA
2. P	P34266	P granule abnormality protein 2	4.50e-03	1.75e-02	NA
2. P	Q5K6N0	Transmembrane protein 232	6.07e-03	2.42e-03	NA
2. P	Q93074	Mediator of RNA polymerase II transcription subunit 12	3.41e-01	5.96e-04	NA
2. P	O35841	Apoptosis inhibitor 5	6.43e-04	2.32e-03	NA
2. P	Q6Z6S1	Apoptosis inhibitor 5-like protein API5	1.00e-02	1.37e-03	NA
2. P	P52521	Protein U4	NA	4.55e-03	NA
2. P	P53185	Uncharacterized protein YGL036W	1.40e-02	1.71e-02	NA
2. P	B0G194	Dymeclin	8.70e-03	3.71e-03	NA
2. P	Q20666	Probable V-type proton ATPase subunit H 1	1.15e-03	6.00e-03	NA
2. P	Q0USP2	Mediator of RNA polymerase II transcription subunit 5	2.36e-02	2.97e-05	NA
2. P	Q9NYV6	RNA polymerase I-specific transcription initiation factor RRN3	5.23e-03	5.47e-03	NA
2. P	Q5ZMW3	Apoptosis inhibitor 5	1.03e-03	7.12e-03	NA
2. P	Q7ZY79	Apoptosis inhibitor 5-B	1.86e-03	9.44e-03	NA
2. P	P28956	Inner tegument protein	NA	2.01e-02	NA
2. P	Q9DGN0	Cohesin subunit SA-2	1.58e-02	4.31e-02	NA
2. P	B2RS91	RNA polymerase I-specific transcription initiation factor RRN3	1.71e-03	1.69e-05	NA
2. P	Q60996	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform	1.85e-03	1.40e-03	NA
2. P	C9JQI7	Transmembrane protein 232	4.66e-03	1.88e-04	NA
2. P	Q54I66	Putative uncharacterized protein DDB_G0288973	2.03e-03	3.08e-03	NA
2. P	B1WBT0	Transmembrane protein 232	2.57e-02	2.42e-07	NA
2. P	Q13362	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform	5.46e-03	9.17e-04	NA
2. P	Q5R4N9	RNA polymerase I-specific transcription initiation factor RRN3	5.79e-03	2.03e-02	NA
2. P	Q196Z9	Uncharacterized protein 061R	NA	1.52e-04	NA
2. P	Q3U1D0	Protein Lines homolog 1	3.55e-03	1.33e-03	NA
2. P	Q0U154	Nucleolar protein 9	1.33e-02	2.71e-02	NA
2. P	Q28BM0	Dymeclin	2.84e-02	2.26e-02	NA
2. P	Q6BU68	DNA mismatch repair protein HSM3	4.40e-03	3.80e-02	NA
2. P	Q8BQM9	Mediator of RNA polymerase II transcription subunit 12-like protein	2.63e-01	1.77e-03	NA
2. P	A8XBZ8	Beta-catenin/armadillo-related protein 1	5.61e-03	1.73e-02	NA
2. P	A3GF61	Pre-rRNA-processing protein RIX1	1.34e-03	3.11e-03	NA
2. P	Q5R644	Apoptosis inhibitor 5	3.54e-03	4.55e-03	NA
2. P	A5D8W1	Cilia- and flagella-associated protein 69	3.08e-02	3.84e-02	NA