Results | PROST

Summary

Q96NL0

Homolog: Q4R7B9.
Function: RUN domain-containing protein 3B.

Statistics

Total GO Annotation: 121
Unique PROST Go: 64
Unique BLAST Go: 28

Total Homologs: 58
Unique PROST Homologs: 23
Unique BLAST Homologs: 16

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q4R7B9 (RUN domain-containing protein 3B) with a FATCAT P-Value: 3.77e-15 and RMSD of 2.77 angstrom. The sequence alignment identity is 96.0%.
Structural alignment shown in left. Query protein Q96NL0 colored as red in alignment, homolog Q4R7B9 colored as blue. Query protein Q96NL0 is also shown in right top, homolog Q4R7B9 showed in right bottom. They are colored based on secondary structures.

  Q96NL0 MASRSLGGLSGIRGGGGGGGKKSLSARNAAVERRNLITVCRFSVKTLIDRSCFETIDDSSPEFNNFAAILEQILSHRLKEISQSCRWLAHLQIPLQGQVT 100
  Q4R7B9 MASRSLGGLSGIRGGGGGGGKKSLSSRNAAVERRNLITVCRFSVKTLIDRSCFETIDDSSPEFNNFAAILEQILSHRLK-----------------GQVT 83

  Q96NL0 WFGYESPRSFWDYIRVACRKVSQNCICSIENMENVSSSRAKGRAWIRVALMEKHLSEYISTALRDFKTTRRFYEDGAIVLGEEANMLAGMLLGLNAIDFS 200
  Q4R7B9 WFGYESPRSFWDYIRVACRKVSQNCICSIENMENVSSSRAKGRAWIRVALMEKHLSEYISTALRDFKTTRRFYEDGAIVLGEEANMLAGMLLGLNAIDFS 183

  Q96NL0 FCLKGEGLDGSFPAVIDYTPYLKYIQSSDSISSDEEELRTLGSSGSESSTPENVGPPFLMDENSWFNKCKRVKQKYQLTLEQKGYLEELLRLRENQLSES 300
  Q4R7B9 FCLKGEGLDGSFPAVIDYTPYLKYIQSSDSISSDEEELRTLGSSGSESSTPENVGPPFLMDENSWFNKCKRVKQKYQLTLEQKGYLEELLRLRENQLSES 283

  Q96NL0 VSQNKILLQRIEDSDLAHKLEKEQLEYIIVELQDQLTVLKNNDLRSRQELTAHLTNQWPSPGALDVNAVALDTLLYRKHNKQWYEKSYQSLDQLSAEVSL 400
  Q4R7B9 VSQNKILLQRIEDSDLAHKLEKEQLEYIIVELQDQLTVLKNNDLRSRQELTAHLTNQWPSPGALDVNAVALDTLLYRKHNKQWYEKSYQSLDQLSAEVSL 383

  Q96NL0 SQTSLDPGQSQEGDGKQDTLNVMSEGKEDTPSLLGLCGSLTSVASYKSLTSLKSNDYLASPTTEMTSPGLTPS 473
  Q4R7B9 SQTSLDPGQSQEGDGKQDTLNIMSEGKEDTPSLLGLCGSLTSVASYKSLTSLKSNDYLASPTTEMTSPGLTPS 456

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
1. PB	GO:0050772	positive regulation of axonogenesis
1. PB	GO:0005768	endosome
1. PB	GO:0007015	actin filament organization
1. PB	GO:0016020	membrane
1. PB	GO:0017124	SH3 domain binding
1. PB	GO:0030175	filopodium
1. PB	GO:0030054	cell junction
1. PB	GO:0030100	regulation of endocytosis
1. PB	GO:0050770	regulation of axonogenesis
1. PB	GO:0090316	positive regulation of intracellular protein transport
1. PB	GO:0043231	intracellular membrane-bounded organelle
1. PB	GO:0007264	small GTPase mediated signal transduction
1. PB	GO:0030424	axon
1. PB	GO:0043025	neuronal cell body
1. PB	GO:2000114	regulation of establishment of cell polarity
1. PB	GO:0030027	lamellipodium
1. PB	GO:0012505	endomembrane system
1. PB	GO:0030426	growth cone
1. PB	GO:0030425	dendrite
1. PB	GO:0005829	cytosol
1. PB	GO:0006897	endocytosis
1. PB	GO:0031901	early endosome membrane
1. PB	GO:0042169	SH2 domain binding
1. PB	GO:0043204	perikaryon
1. PB	GO:0030335	positive regulation of cell migration
1. PB	GO:0030695	GTPase regulator activity
1. PB	GO:0050771	negative regulation of axonogenesis
1. PB	GO:0045773	positive regulation of axon extension
1. PB	GO:0010753	positive regulation of cGMP-mediated signaling
2. P	GO:1905626	positive regulation of L-methionine import across plasma membrane
2. P	GO:0045132	meiotic chromosome segregation
2. P	GO:0021508	floor plate formation
2. P	GO:0050680	negative regulation of epithelial cell proliferation
2. P	GO:0035082	axoneme assembly
2. P	GO:0008608	attachment of spindle microtubules to kinetochore
2. P	GO:0019904	protein domain specific binding
2. P	GO:1901970	positive regulation of mitotic sister chromatid separation
2. P	GO:0051301	cell division
2. P	GO:0008356	asymmetric cell division
2. P	GO:1905561	positive regulation of kinetochore assembly
2. P	GO:0051315	attachment of mitotic spindle microtubules to kinetochore
2. P	GO:0034501	protein localization to kinetochore
2. P	GO:1903394	protein localization to kinetochore involved in kinetochore assembly
2. P	GO:0005814	centriole
2. P	GO:0035262	gonad morphogenesis
2. P	GO:0007098	centrosome cycle
2. P	GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process
2. P	GO:2000134	negative regulation of G1/S transition of mitotic cell cycle
2. P	GO:0007079	mitotic chromosome movement towards spindle pole
2. P	GO:0046907	intracellular transport
2. P	GO:0030992	intraciliary transport particle B
2. P	GO:0000922	spindle pole
2. P	GO:0051383	kinetochore organization
2. P	GO:0042981	regulation of apoptotic process
2. P	GO:0032391	photoreceptor connecting cilium
2. P	GO:0030991	intraciliary transport particle A
2. P	GO:0097546	ciliary base
2. P	GO:0001947	heart looping
2. P	GO:0031262	Ndc80 complex
2. P	GO:0060972	left/right pattern formation
2. P	GO:0051310	metaphase plate congression
2. P	GO:0012510	trans-Golgi network transport vesicle membrane
2. P	GO:0006915	apoptotic process
2. P	GO:0005813	centrosome
2. P	GO:0010457	centriole-centriole cohesion
2. P	GO:0044877	protein-containing complex binding
2. P	GO:0008104	protein localization
2. P	GO:0033596	TSC1-TSC2 complex
2. P	GO:0000779	condensed chromosome, centromeric region
2. P	GO:0023052	signaling
2. P	GO:0001843	neural tube closure
2. P	GO:0030496	midbody
2. P	GO:0042073	intraciliary transport
2. P	GO:0044458	motile cilium assembly
2. P	GO:1905534	positive regulation of leucine import across plasma membrane
2. P	GO:0007099	centriole replication
2. P	GO:0036064	ciliary basal body
2. P	GO:1905589	positive regulation of L-arginine import across plasma membrane
2. P	GO:0007052	mitotic spindle organization
2. P	GO:0044292	dendrite terminus
2. P	GO:0008017	microtubule binding
2. P	GO:0005929	cilium
2. P	GO:1905515	non-motile cilium assembly
2. P	GO:0005930	axoneme
2. P	GO:0051726	regulation of cell cycle
2. P	GO:0007224	smoothened signaling pathway
2. P	GO:0097542	ciliary tip
2. P	GO:0032007	negative regulation of TOR signaling
2. P	GO:0090267	positive regulation of mitotic cell cycle spindle assembly checkpoint
2. P	GO:0000776	kinetochore
2. P	GO:0042802	identical protein binding
2. P	GO:1905342	positive regulation of protein localization to kinetochore
2. P	GO:0007059	chromosome segregation
3. B	GO:0044754	autolysosome
3. B	GO:0010977	negative regulation of neuron projection development
3. B	GO:0045780	positive regulation of bone resorption
3. B	GO:0061909	autophagosome-lysosome fusion
3. B	GO:0005085	guanyl-nucleotide exchange factor activity
3. B	GO:0010008	endosome membrane
3. B	GO:0032880	regulation of protein localization
3. B	GO:0005764	lysosome
3. B	GO:1902774	late endosome to lysosome transport
3. B	GO:0035091	phosphatidylinositol binding
3. B	GO:0005802	trans-Golgi network
3. B	GO:0031267	small GTPase binding
3. B	GO:0031902	late endosome membrane
3. B	GO:0032418	lysosome localization
3. B	GO:0019894	kinesin binding
3. B	GO:0015031	protein transport
3. B	GO:0008289	lipid binding
3. B	GO:0007030	Golgi organization
3. B	GO:1903527	positive regulation of membrane tubulation
3. B	GO:0016607	nuclear speck
3. B	GO:0000139	Golgi membrane
3. B	GO:0035556	intracellular signal transduction
3. B	GO:1905885	positive regulation of triglyceride transport
3. B	GO:1900029	positive regulation of ruffle assembly
3. B	GO:0030904	retromer complex
3. B	GO:0042267	natural killer cell mediated cytotoxicity
3. B	GO:0042147	retrograde transport, endosome to Golgi
3. B	GO:0005765	lysosomal membrane

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	Q17QK1	RUN domain-containing protein 3A	9.42e-11	1.31e-57	1.23e-154
1. PB	Q5U3W3	RUN domain-containing protein 3B	2.36e-11	2.31e-59	0.0
1. PB	Q8BIJ7	RUN and FYVE domain-containing protein 1	1.64e-06	2.81e-06	1.13e-18
1. PB	Q5R4V2	Protein RUFY3	4.16e-09	7.45e-15	5.42e-26
1. PB	Q3B7K9	RUN domain-containing protein 3B	6.25e-14	3.87e-77	0.0
1. PB	Q08E29	RUN domain-containing protein 3B	5.60e-11	2.25e-75	0.0
1. PB	Q5FVJ0	Protein RUFY3	4.86e-10	8.80e-15	1.06e-25
1. PB	Q4R7B9	RUN domain-containing protein 3B	3.77e-15	2.32e-110	0.0
1. PB	O08576	RUN domain-containing protein 3A	1.28e-09	3.95e-55	1.70e-153
1. PB	Q9D394	Protein RUFY3	7.93e-10	6.40e-15	1.78e-25
1. PB	Q7L099	Protein RUFY3	4.98e-10	1.58e-14	5.37e-26
1. PB	Q96T51	RUN and FYVE domain-containing protein 1	6.70e-08	4.33e-05	3.65e-20
1. PB	Q96NL0	RUN domain-containing protein 3B	0	2.45e-168	0.0
1. PB	Q59EK9	RUN domain-containing protein 3A	1.86e-11	5.97e-55	1.26e-154
1. PB	A7YDW0	RUN domain-containing protein 3A	1.29e-09	1.33e-61	1.47e-131
1. PB	Q0V9V7	RUN domain-containing protein 3A	7.48e-09	4.04e-58	4.42e-152
1. PB	Q5R565	RUN domain-containing protein 3A	3.31e-12	2.00e-54	1.26e-154
1. PB	Q6PDC0	RUN domain-containing protein 3B	7.51e-11	1.17e-67	0.0
1. PB	Q5NVC2	RUN domain-containing protein 3B	7.64e-13	3.92e-109	0.0
2. P	Q5HZK1	Centrosomal protein of 44 kDa	9.78e-02	1.83e-02	NA
2. P	Q9NWB7	Intraflagellar transport protein 57 homolog	1.75e-01	6.85e-03	NA
2. P	O75901	Ras association domain-containing protein 9	3.30e-03	4.82e-02	NA
2. P	Q17635	Kinetochore protein ndc-80	1.40e-03	1.47e-02	NA
2. P	Q6P047	Uncharacterized protein C8orf74	5.75e-03	1.17e-02	NA
2. P	Q6GQ71	Kinetochore protein Nuf2-B	4.18e-03	4.21e-02	NA
2. P	Q6AYJ5	Clusterin-associated protein 1	5.66e-02	1.05e-02	NA
2. P	A2RVA7	Centrosomal protein of 44 kDa	1.65e-02	8.82e-06	NA
2. P	Q99P69	Kinetochore protein Nuf2	3.03e-03	6.24e-03	NA
2. P	Q5U4X5	Kinetochore protein NDC80 homolog	7.33e-03	3.04e-02	NA
2. P	Q0P4I1	Centrosomal protein of 44 kDa	1.49e-01	3.56e-08	NA
2. P	Q8AWF5	Kinetochore protein NDC80 homolog	1.81e-02	7.75e-03	NA
2. P	Q5EA95	Intraflagellar transport protein 57 homolog	3.49e-03	3.53e-02	NA
2. P	Q60P76	Spindle assembly abnormal protein 6	5.31e-01	2.67e-04	NA
2. P	O62479	Spindle assembly abnormal protein 6	4.19e-03	1.29e-03	NA
2. P	Q8BXG3	Intraflagellar transport protein 57 homolog	2.16e-01	6.05e-03	NA
2. P	Q6CNF3	Probable kinetochore protein NDC80	2.35e-03	1.18e-02	NA
2. P	Q6AYL9	Kinetochore protein Nuf2	1.65e-03	1.45e-03	NA
2. P	Q9C635	Heat stress transcription factor B-4	1.92e-01	4.50e-02	NA
2. P	P40460	Kinetochore protein NDC80	1.55e-02	2.55e-02	NA
2. P	Q09778	Tuberous sclerosis 1 protein homolog	8.07e-02	3.45e-04	NA
2. P	Q9BZD4	Kinetochore protein Nuf2	1.60e-03	2.29e-02	NA
2. P	Q5A1Q5	Probable kinetochore protein NUF2	2.56e-03	4.76e-03	NA
3. B	A2RSQ0	DENN domain-containing protein 5B	3.60e-02	NA	1.20e-04
3. B	Q9Y4G2	Pleckstrin homology domain-containing family M member 1	4.31e-01	NA	0.008
3. B	Q6ZUT9	DENN domain-containing protein 5B	2.22e-02	NA	1.11e-04
3. B	Q8R4C2	RUN and FYVE domain-containing protein 2	1.93e-07	NA	7.93e-23
3. B	Q9D3S3	Sorting nexin-29	1.16e-01	NA	1.56e-09
3. B	G3V7Q0	DENN domain-containing protein 5A	5.06e-02	NA	4.05e-04
3. B	Q6IQ26	DENN domain-containing protein 5A	3.62e-02	NA	3.88e-04
3. B	Q6PAL8	DENN domain-containing protein 5A	3.09e-02	NA	4.19e-04
3. B	Q8WXA3	RUN and FYVE domain-containing protein 2	7.35e-08	NA	4.55e-21
3. B	Q80TQ5	Pleckstrin homology domain-containing family M member 2	1.48e-01	NA	0.009
3. B	Q8IWE5	Pleckstrin homology domain-containing family M member 2	3.28e-02	NA	0.025
3. B	Q8TEQ0	Sorting nexin-29	2.20e-03	NA	2.04e-09
3. B	Q5PQS0	Pleckstrin homology domain-containing family M member 1	6.72e-02	NA	0.015
3. B	Q08DX0	Sorting nexin-29	5.01e-04	NA	2.57e-10
3. B	Q6NXD8	DENN domain-containing protein 5B	6.49e-02	NA	1.23e-04
3. B	Q5R5R4	RUN and FYVE domain-containing protein 2	1.85e-08	NA	2.28e-20