Summary

Q96PS1

Homolog: Q32KZ5.
Function: FANCD2 opposite strand protein.

Statistics

Total GO Annotation: 37
Unique PROST Go: 37
Unique BLAST Go: 0

Total Homologs: 12
Unique PROST Homologs: 9
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q32KZ5 (FANCD2 opposite strand protein) with a FATCAT P-Value: 5.62e-07 and RMSD of 2.97 angstrom. The sequence alignment identity is 96.1%.
Structural alignment shown in left. Query protein Q96PS1 colored as red in alignment, homolog Q32KZ5 colored as blue. Query protein Q96PS1 is also shown in right top, homolog Q32KZ5 showed in right bottom. They are colored based on secondary structures. 

  Q96PS1 MAGYQLWSPWTPLDESFQWLRHTTPTPSSKHPFKASPCFPHTPSDLEVQLCFQEVTLVLDSPFLESGVSPKLPCHTSELRTMNN-KGLVRKPQPIRLSGV 99
  Q32KZ5 MAGYQLWSPWTPLDESFQWLRHTTPTPSSKHPFRASPCFPHTPSDLEVQLCFQEVTLVLDSPFLEPGVSPKLPYHTSELRTMNNKKGLVRKPQPVRLSGV 100

  Q96PS1 DSVFGRVITAQPPKWTGTFRVSDKSAFCKIISREHQWPIGLKEPQIQMTVTMCKQMLRSILLLYATYKKCTFALQHSK 177
  Q32KZ5 DSVFGRVITAQPPKWTGTFRVSEKSAFCKIISREHQWPTGLKEPQIQMTVTMCKQMLRSILLLYATYKKCTFALQHSK 178

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0001764 neuron migration
2. P GO:1902532 negative regulation of intracellular signal transduction
2. P GO:0032984 protein-containing complex disassembly
2. P GO:0048011 neurotrophin TRK receptor signaling pathway
2. P GO:0042771 intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
2. P GO:0007420 brain development
2. P GO:0006473 protein acetylation
2. P GO:0097009 energy homeostasis
2. P GO:0008217 regulation of blood pressure
2. P GO:0045820 negative regulation of glycolytic process
2. P GO:0001678 cellular glucose homeostasis
2. P GO:0001666 response to hypoxia
2. P GO:0048705 skeletal system morphogenesis
2. P GO:0016407 acetyltransferase activity
2. P GO:0061182 negative regulation of chondrocyte development
2. P GO:0033137 negative regulation of peptidyl-serine phosphorylation
2. P GO:0032432 actin filament bundle
2. P GO:0006915 apoptotic process
2. P GO:0045444 fat cell differentiation
2. P GO:0009267 cellular response to starvation
2. P GO:1901216 positive regulation of neuron death
2. P GO:0005739 mitochondrion
2. P GO:0010801 negative regulation of peptidyl-threonine phosphorylation
2. P GO:0061572 actin filament bundle organization
2. P GO:0031005 filamin binding
2. P GO:0071889 14-3-3 protein binding
2. P GO:0001659 temperature homeostasis
2. P GO:1900158 negative regulation of bone mineralization involved in bone maturation
2. P GO:0097746 blood vessel diameter maintenance
2. P GO:0072593 reactive oxygen species metabolic process
2. P GO:0032007 negative regulation of TOR signaling
2. P GO:0000282 cellular bud site selection
2. P GO:0032006 regulation of TOR signaling
2. P GO:0070417 cellular response to cold
2. P GO:0071549 cellular response to dexamethasone stimulus
2. P GO:0051607 defense response to virus
2. P GO:0030182 neuron differentiation

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q9D4K4 FANCD2 opposite strand protein 6.49e-07 4.63e-47 2.41e-119
1. PB Q96PS1 FANCD2 opposite strand protein 0 1.11e-135 1.02e-130
1. PB Q32KZ5 FANCD2 opposite strand protein 5.62e-07 2.18e-57 1.61e-124
2. P Q7TS73 Refilin-A 7.08e-01 4.95e-02 NA
2. P P85052 Bud site selection protein 25 2.31e-01 5.75e-03 NA
2. P P21857 Urotensin-2 (Fragments) 1.42e-01 9.33e-03 NA
2. P Q8CBW7 Cysteine-rich hydrophobic domain-containing protein 1 6.35e-02 2.36e-03 NA
2. P Q08E62 DNA damage-inducible transcript 4 protein 3.59e-01 5.96e-04 NA
2. P Q9D3F7 DNA damage-inducible transcript 4 protein 4.14e-01 2.76e-03 NA
2. P Q8VHZ9 DNA damage-inducible transcript 4 protein 3.10e-01 2.25e-03 NA
2. P Q9NX09 DNA damage-inducible transcript 4 protein 3.80e-01 4.07e-03 NA
2. P P0DJI6 Foxo1-corepressor 4.18e-01 2.13e-02 NA