Summary

Q9BTA0

Homolog: P17257.
Function: Protein FAM167B.

Statistics

Total GO Annotation: 82
Unique PROST Go: 82
Unique BLAST Go: 0

Total Homologs: 67
Unique PROST Homologs: 60
Unique BLAST Homologs: 1

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was P17257 (Protein FAM167B) with a FATCAT P-Value: 5.55e-16 and RMSD of 3.04 angstrom. The sequence alignment identity is 86.5%.
Structural alignment shown in left. Query protein Q9BTA0 colored as red in alignment, homolog P17257 colored as blue. Query protein Q9BTA0 is also shown in right top, homolog P17257 showed in right bottom. They are colored based on secondary structures. 

  Q9BTA0 MSLGLLKFQAVGEEDEEDEEGESLDSVKALTAKLQLQTRRPSYLEWTAQVQSQAWRRAQAKPGPGGPGDICGFDSMDSALEWLRRELREMQAQDRQLAGQ 100
  P17257 MSLGPLKFQAVGEKGEEDEE-ESLDSLKALTAKLQLQTRRPSYLEWTARVQSRAWYRAQARPEPVGPGAICGFDSMDSALEWLRRELQEMRAQDRQLAGQ 99

  Q9BTA0 LLRLRAQLHRLKMDQACHLHQELLDEAELELELEPGAGLALAPLLRHLGLTRMNISARRFTLC 163
  P17257 LLRLRARLHRLKVDQVCHLHQELLDEAELEMELESGTGLPLAPPLRHLGLTRMNISARRFTLC 162

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0001570 vasculogenesis
2. P GO:0030474 spindle pole body duplication
2. P GO:0019904 protein domain specific binding
2. P GO:0051028 mRNA transport
2. P GO:0019031 viral envelope
2. P GO:0003382 epithelial cell morphogenesis
2. P GO:0031083 BLOC-1 complex
2. P GO:0099078 BORC complex
2. P GO:0030430 host cell cytoplasm
2. P GO:0030172 troponin C binding
2. P GO:0006937 regulation of muscle contraction
2. P GO:0010375 stomatal complex patterning
2. P GO:0001980 regulation of systemic arterial blood pressure by ischemic conditions
2. P GO:0006941 striated muscle contraction
2. P GO:1990584 cardiac Troponin complex
2. P GO:0034080 CENP-A containing chromatin assembly
2. P GO:0030016 myofibril
2. P GO:0048306 calcium-dependent protein binding
2. P GO:0030010 establishment of cell polarity
2. P GO:0007507 heart development
2. P GO:0072384 organelle transport along microtubule
2. P GO:0061635 regulation of protein complex stability
2. P GO:0030027 lamellipodium
2. P GO:0010497 plasmodesmata-mediated intercellular transport
2. P GO:0043515 kinetochore binding
2. P GO:0051224 negative regulation of protein transport
2. P GO:0097512 cardiac myofibril
2. P GO:0005634 nucleus
2. P GO:0006940 regulation of smooth muscle contraction
2. P GO:0036064 ciliary basal body
2. P GO:0005929 cilium
2. P GO:0051382 kinetochore assembly
2. P GO:0030335 positive regulation of cell migration
2. P GO:0050885 neuromuscular process controlling balance
2. P GO:0042030 ATPase inhibitor activity
2. P GO:1903744 positive regulation of anterograde synaptic vesicle transport
2. P GO:0016239 positive regulation of macroautophagy
2. P GO:0051015 actin filament binding
2. P GO:0031224 intrinsic component of membrane
2. P GO:0043622 cortical microtubule organization
2. P GO:0060392 negative regulation of SMAD protein signal transduction
2. P GO:0070527 platelet aggregation
2. P GO:0044196 host cell nucleolus
2. P GO:0010882 regulation of cardiac muscle contraction by calcium ion signaling
2. P GO:0005861 troponin complex
2. P GO:0008089 anterograde axonal transport
2. P GO:0060047 heart contraction
2. P GO:0002230 positive regulation of defense response to virus by host
2. P GO:0061909 autophagosome-lysosome fusion
2. P GO:0005200 structural constituent of cytoskeleton
2. P GO:0019901 protein kinase binding
2. P GO:1903445 protein transport from ciliary membrane to plasma membrane
2. P GO:0060048 cardiac muscle contraction
2. P GO:0055010 ventricular cardiac muscle tissue morphogenesis
2. P GO:0005823 central plaque of spindle pole body
2. P GO:1904115 axon cytoplasm
2. P GO:0060271 cilium assembly
2. P GO:0003009 skeletal muscle contraction
2. P GO:0031175 neuron projection development
2. P GO:0007288 sperm axoneme assembly
2. P GO:0032418 lysosome localization
2. P GO:0000930 gamma-tubulin complex
2. P GO:0019855 calcium channel inhibitor activity
2. P GO:0005813 centrosome
2. P GO:0043015 gamma-tubulin binding
2. P GO:0006936 muscle contraction
2. P GO:0031014 troponin T binding
2. P GO:0051493 regulation of cytoskeleton organization
2. P GO:0006874 cellular calcium ion homeostasis
2. P GO:0003779 actin binding
2. P GO:0007130 synaptonemal complex assembly
2. P GO:0030512 negative regulation of transforming growth factor beta receptor signaling pathway
2. P GO:0032780 negative regulation of ATP-dependent activity
2. P GO:0048490 anterograde synaptic vesicle transport
2. P GO:0001222 transcription corepressor binding
2. P GO:0098574 cytoplasmic side of lysosomal membrane
2. P GO:0000776 kinetochore
2. P GO:0000801 central element
2. P GO:0043292 contractile fiber
2. P GO:0032438 melanosome organization
2. P GO:0030017 sarcomere
2. P GO:0005654 nucleoplasm

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q6P1G6 Protein FAM167A 8.06e-05 3.21e-15 4.49e-32
1. PB Q9BTA0 Protein FAM167B 0 6.64e-139 4.03e-114
1. PB P17257 Protein FAM167B 5.55e-16 7.38e-57 2.28e-75
1. PB Q5RFZ7 Protein FAM167A 6.04e-06 2.62e-14 1.66e-34
1. PB Q96KS9 Protein FAM167A 2.31e-05 3.74e-13 4.89e-31
1. PB Q0V7M8 Protein FAM167A 1.13e-05 1.25e-17 2.31e-35
2. P P0CU25 Uncharacterized protein SPAC29A4.23 1.70e-05 2.02e-03 NA
2. P Q08BG7 Short coiled-coil protein A 3.82e-04 1.77e-06 NA
2. P P27672 Troponin I, cardiac muscle 5.60e-03 1.93e-02 NA
2. P P19429 Troponin I, cardiac muscle 7.20e-04 1.26e-03 NA
2. P P23693 Troponin I, cardiac muscle 1.84e-03 8.94e-05 NA
2. P A6ZWC8 Spindle pole component 29 4.90e-03 8.98e-03 NA
2. P Q6AXY9 Spermatogenic leucine zipper protein 1 9.29e-03 1.09e-03 NA
2. P Q13352 Centromere protein R 5.95e-03 1.97e-02 NA
2. P C8ZIQ5 Spindle pole component 29 3.25e-02 2.40e-03 NA
2. P E7KVI3 Spindle pole component 29 4.85e-03 2.40e-03 NA
2. P A4IIZ9 Mediator of RNA polymerase II transcription subunit 28 1.55e-03 5.31e-03 NA
2. P Q5PYI0 Troponin I, cardiac muscle 6.73e-04 5.22e-05 NA
2. P Q6Q0N2 Protein FAM89A 3.50e-04 3.69e-08 NA
2. P P20919 Protein Rev NA 4.45e-03 NA
2. P P02646 Troponin I, cardiac muscle 8.17e-04 6.39e-03 NA
2. P Q78YZ6 Short coiled-coil protein 5.46e-04 6.37e-05 NA
2. P Q2TBN4 Mediator of RNA polymerase II transcription subunit 28 3.88e-03 1.06e-02 NA
2. P P48787 Troponin I, cardiac muscle 3.23e-03 1.34e-04 NA
2. P E7M1C7 Spindle pole component 29 1.10e-02 2.40e-03 NA
2. P P24097 Protein Rev NA 4.23e-05 NA
2. P C7GJ78 Spindle pole component 29 1.12e-02 2.40e-03 NA
2. P A6QQF7 Protein FAM89A 7.32e-03 2.32e-06 NA
2. P Q8TDM0 Breast carcinoma-amplified sequence 4 7.18e-05 3.58e-03 NA
2. P Q96GI7 Protein FAM89A 2.31e-03 2.04e-08 NA
2. P Q566R4 Leucine repeat adapter protein 25 1.09e-03 6.67e-09 NA
2. P Q3UNU4 Glutamate-rich protein 4 4.49e-04 1.77e-02 NA
2. P E7QLB7 Spindle pole component 29 NA 3.61e-03 NA
2. P Q9QUI1 Leucine repeat adapter protein 25 2.03e-03 4.02e-10 NA
2. P Q6AYA0 RILP-like protein 2 7.45e-03 2.83e-02 NA
2. P Q9VTE0 Biogenesis of lysosome-related organelles complex 1 subunit 2 1.33e-04 4.89e-02 NA
2. P Q9NUP1 Biogenesis of lysosome-related organelles complex 1 subunit 4 2.67e-03 2.04e-05 NA
2. P A6NGS2 Glutamate-rich protein 4 1.11e-03 3.20e-02 NA
2. P P50754 Troponin I, cardiac muscle 4.03e-03 2.08e-03 NA
2. P B2RV13 Sperm axonemal maintenance protein CFAP97D1 2.10e-03 1.91e-02 NA
2. P E7QAA9 Spindle pole component 29 1.05e-02 8.98e-03 NA
2. P Q1T763 Centromere protein R 1.01e-02 1.42e-02 NA
2. P Q14BJ1 Protein FAM89A 3.23e-03 1.16e-09 NA
2. P Q9LEZ4 Protein MICROTUBULE BINDING PROTEIN 2C 8.12e-03 2.83e-02 NA
2. P Q8N5H3 Leucine repeat adapter protein 25 2.74e-04 6.93e-09 NA
2. P Q969X0 RILP-like protein 2 2.73e-03 2.57e-03 NA
2. P Q08AY9 Protein FAM89A 1.13e-03 3.24e-11 NA
2. P P32543 Protein Rev NA 4.45e-03 NA
2. P A4IFK7 RILP-like protein 2 2.91e-03 1.19e-02 NA
2. P P11305 Protein Rev NA 1.43e-03 NA
2. P Q8C963 Coiled-coil domain-containing protein 159 8.33e-03 2.78e-02 NA
2. P Q90ZF9 Centromere protein H 1.22e-03 3.74e-02 NA
2. P Q6YXX9 Guanine nucleotide-binding protein subunit gamma 2 1.64e-02 1.18e-03 NA
2. P Q863B6 Troponin I, cardiac muscle 8.63e-04 4.80e-04 NA
2. P B5VT41 Spindle pole component 29 3.51e-03 2.40e-03 NA
2. P Q5RJZ6 Short coiled-coil protein 8.26e-04 7.59e-05 NA
2. P B3LKV0 Spindle pole component 29 2.64e-03 2.40e-03 NA
2. P Q9LZX5 Protein LITTLE ZIPPER 2 1.01e-05 2.56e-02 NA
2. P P33419 Spindle pole component 29 5.91e-03 2.40e-03 NA
2. P Q8VED2 Biogenesis of lysosome-related organelles complex 1 subunit 4 3.12e-03 2.64e-08 NA
2. P P08057 Troponin I, cardiac muscle 5.83e-04 2.68e-03 NA
2. P A2X0N9 Guanine nucleotide-binding protein subunit gamma 2 1.89e-02 1.18e-03 NA
2. P Q3UYG1 Coiled-coil domain-containing protein 160 7.19e-04 3.64e-02 NA
2. P Q5XIX8 BLOC-1-related complex subunit 5 3.09e-03 1.67e-02 NA
2. P Q6PIF2 Synaptonemal complex central element protein 2 2.02e-03 1.47e-02 NA
2. P Q9DA44 TSSK6-activating co-chaperone protein 2.25e-02 3.64e-02 NA
3. B A1L168 Uncharacterized protein C20orf202 2.61e-03 NA 0.049