Summary

Q9BU68

Homolog: Q3T183.
Function: Proline-rich protein 15-like protein.

Statistics

Total GO Annotation: 7
Unique PROST Go: 7
Unique BLAST Go: 0

Total Homologs: 12
Unique PROST Homologs: 5
Unique BLAST Homologs: 1

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q3T183 (Proline-rich protein 15-like protein) with a FATCAT P-Value: 5.06e-05 and RMSD of 3.22 angstrom. The sequence alignment identity is 84.5%.
Structural alignment shown in left. Query protein Q9BU68 colored as red in alignment, homolog Q3T183 colored as blue. Query protein Q9BU68 is also shown in right top, homolog Q3T183 showed in right bottom. They are colored based on secondary structures. 

  Q9BU68 MTTEIGWWKLTFLRKKKSTPKVLYEIPDTYAQTEGDAEPPRPDAGGPNSDFNTRLEKIVDKSTKGKHVKVSNSGRFKEKKKVRATLAENPNLFDDHEEGR 100
  Q3T183 M-TEVGWWKLTFLRKKKSTPKVLYEIPDTYTQSEGGAEPPRPDSGNPNSNFNTRLEKIVDKNTKGKHVKVSNSGRFKEKKKVRASLAENPNLFDDR-EGK 98

  Q9BU68 SSK 103
  Q3T183 GQ- 100

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:1902732 positive regulation of chondrocyte proliferation
2. P GO:0035988 chondrocyte proliferation
2. P GO:0042246 tissue regeneration
2. P GO:0010628 positive regulation of gene expression
2. P GO:0002062 chondrocyte differentiation
2. P GO:0032332 positive regulation of chondrocyte differentiation
2. P GO:1902730 positive regulation of proteoglycan biosynthetic process

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q566Z6 Proline-rich protein 15-like protein B 2.46e-04 2.12e-17 3.54e-28
1. PB Q9D1T5 Proline-rich protein 15 4.51e-01 2.82e-08 0.002
1. PB Q8JZM2 Proline-rich protein 15-like protein 5.58e-04 1.03e-36 1.47e-58
1. PB Q9BU68 Proline-rich protein 15-like protein 0 2.65e-133 5.45e-72
1. PB Q6DBU1 Proline-rich protein 15-like protein A 8.94e-04 2.52e-21 1.17e-32
1. PB Q3T183 Proline-rich protein 15-like protein 5.06e-05 3.01e-39 3.04e-59
2. P C1DJC2 Probable Fe(2+)-trafficking protein 6.45e-01 3.64e-02 NA
2. P Q32KU9 Musculoskeletal embryonic nuclear protein 1 4.21e-01 3.85e-02 NA
2. P P39427 Uncharacterized 8.1 kDa protein in modB-mrh intergenic region NA 3.00e-02 NA
2. P P60743 50S ribosomal protein L24 6.01e-01 4.71e-02 NA
2. P G2TRK1 Uncharacterized protein C17A5.19 2.93e-01 1.08e-02 NA
3. B Q8IV56 Proline-rich protein 15 5.67e-01 NA 0.006