Summary

Q9BXH1

Homolog: Q80ZG6.
Function: Bcl-2-binding component 3.

Statistics

Total GO Annotation: 100
Unique PROST Go: 67
Unique BLAST Go: 2

Total Homologs: 28
Unique PROST Homologs: 25
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q80ZG6 (Bcl-2-binding component 3) with a FATCAT P-Value: 3.75e-07 and RMSD of 4.07 angstrom. The sequence alignment identity is 90.8%.
Structural alignment shown in left. Query protein Q9BXH1 colored as red in alignment, homolog Q80ZG6 colored as blue. Query protein Q9BXH1 is also shown in right top, homolog Q80ZG6 showed in right bottom. They are colored based on secondary structures. 

  Q9BXH1 MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPTLLPAAYLCAPTAPPAVTAALGGSRWPGGPRSRPRGPRPDGPQPSLSLA 100
  Q80ZG6 MARARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGGHRSRPRGPRPDGPQPSLSPA 100

  Q9BXH1 EQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPR--GHRAPEMEPN 193
  Q80ZG6 QQHLESPVPSAPEALAGGPTQAAPGVRVEEEEWAREIGAQLRRMADDLNAQYERRRQEEQHRHRPSPWRVMYNLFMGLLPLPRDPG--APEMEPN 193

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:1902237 positive regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway
1. PB GO:2001244 positive regulation of intrinsic apoptotic signaling pathway
1. PB GO:1900740 positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway
1. PB GO:0042771 intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
1. PB GO:0071479 cellular response to ionizing radiation
1. PB GO:1903896 positive regulation of IRE1-mediated unfolded protein response
1. PB GO:0045926 negative regulation of growth
1. PB GO:0006919 activation of cysteine-type endopeptidase activity involved in apoptotic process
1. PB GO:0032471 negative regulation of endoplasmic reticulum calcium ion concentration
1. PB GO:0051117 ATPase binding
1. PB GO:0031334 positive regulation of protein-containing complex assembly
1. PB GO:0034976 response to endoplasmic reticulum stress
1. PB GO:0051209 release of sequestered calcium ion into cytosol
1. PB GO:0043065 positive regulation of apoptotic process
1. PB GO:0005783 endoplasmic reticulum
1. PB GO:0006915 apoptotic process
1. PB GO:0071456 cellular response to hypoxia
1. PB GO:0090200 positive regulation of release of cytochrome c from mitochondria
1. PB GO:0070059 intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress
1. PB GO:0008340 determination of adult lifespan
1. PB GO:0001836 release of cytochrome c from mitochondria
1. PB GO:0097190 apoptotic signaling pathway
1. PB GO:1901998 toxin transport
1. PB GO:0006974 cellular response to DNA damage stimulus
1. PB GO:0070245 positive regulation of thymocyte apoptotic process
1. PB GO:0043525 positive regulation of neuron apoptotic process
1. PB GO:0097194 execution phase of apoptosis
1. PB GO:2001056 positive regulation of cysteine-type endopeptidase activity
1. PB GO:0005740 mitochondrial envelope
1. PB GO:0072332 intrinsic apoptotic signaling pathway by p53 class mediator
1. PB GO:0032464 positive regulation of protein homooligomerization
2. P GO:0071391 cellular response to estrogen stimulus
2. P GO:0051562 negative regulation of mitochondrial calcium ion concentration
2. P GO:1904646 cellular response to amyloid-beta
2. P GO:0030879 mammary gland development
2. P GO:0043029 T cell homeostasis
2. P GO:0007160 cell-matrix adhesion
2. P GO:0033650 host cell mitochondrion
2. P GO:0007420 brain development
2. P GO:0032798 Swi5-Sfr1 complex
2. P GO:0008584 male gonad development
2. P GO:0043583 ear development
2. P GO:0007127 meiosis I
2. P GO:0048066 developmental pigmentation
2. P GO:0000724 double-strand break repair via homologous recombination
2. P GO:0002260 lymphocyte homeostasis
2. P GO:0031625 ubiquitin protein ligase binding
2. P GO:0001822 kidney development
2. P GO:0035148 tube formation
2. P GO:0010942 positive regulation of cell death
2. P GO:0044233 mitochondria-associated endoplasmic reticulum membrane
2. P GO:0048070 regulation of developmental pigmentation
2. P GO:0039592 suppression by virus of G2/M transition of host mitotic cell cycle
2. P GO:0048538 thymus development
2. P GO:0043280 positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
2. P GO:0019079 viral genome replication
2. P GO:0005163 nerve growth factor receptor binding
2. P GO:0048536 spleen development
2. P GO:0042981 regulation of apoptotic process
2. P GO:0046332 SMAD binding
2. P GO:0097141 BIM-BCL-2 complex
2. P GO:0001701 in utero embryonic development
2. P GO:0008630 intrinsic apoptotic signaling pathway in response to DNA damage
2. P GO:0071392 cellular response to estradiol stimulus
2. P GO:0042475 odontogenesis of dentin-containing tooth
2. P GO:1902110 positive regulation of mitochondrial membrane permeability involved in apoptotic process
2. P GO:0042025 host cell nucleus
2. P GO:0097140 BIM-BCL-xl complex
2. P GO:0060139 positive regulation of apoptotic process by virus
2. P GO:0003714 transcription corepressor activity
2. P GO:0034974 Swi5-Swi2 complex
2. P GO:0019898 extrinsic component of membrane
2. P GO:0097136 Bcl-2 family protein complex
2. P GO:2000271 positive regulation of fibroblast apoptotic process
2. P GO:0097192 extrinsic apoptotic signaling pathway in absence of ligand
2. P GO:0007517 muscle organ development
2. P GO:0045787 positive regulation of cell cycle
2. P GO:0009791 post-embryonic development
2. P GO:0002262 myeloid cell homeostasis
2. P GO:0008017 microtubule binding
2. P GO:0042127 regulation of cell population proliferation
2. P GO:1902263 apoptotic process involved in embryonic digit morphogenesis
2. P GO:0030512 negative regulation of transforming growth factor beta receptor signaling pathway
2. P GO:0007183 SMAD protein complex assembly
2. P GO:0001776 leukocyte homeostasis
2. P GO:0007181 transforming growth factor beta receptor complex assembly
2. P GO:0001782 B cell homeostasis
2. P GO:0048563 post-embryonic animal organ morphogenesis
2. P GO:0008625 extrinsic apoptotic signaling pathway via death domain receptors
2. P GO:0039652 induction by virus of host NF-kappaB cascade
2. P GO:0005741 mitochondrial outer membrane
2. P GO:0070242 thymocyte apoptotic process
2. P GO:0046620 regulation of organ growth
2. P GO:0050699 WW domain binding
2. P GO:0008656 cysteine-type endopeptidase activator activity involved in apoptotic process
2. P GO:0034263 positive regulation of autophagy in response to ER overload
2. P GO:0017015 regulation of transforming growth factor beta receptor signaling pathway
2. P GO:0006351 transcription, DNA-templated
3. B GO:0005739 mitochondrion
3. B GO:0030308 negative regulation of cell growth

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q99ML1 Bcl-2-binding component 3 2.17e-06 2.52e-65 2.36e-107
1. PB Q9BXH1 Bcl-2-binding component 3, isoforms 1/2 0 7.21e-141 5.42e-132
1. PB Q80ZG6 Bcl-2-binding component 3 3.75e-07 4.96e-71 5.32e-108
2. P Q6X7S9 EP300-interacting inhibitor of differentiation 2 1.40e-02 1.45e-02 NA
2. P Q9PXA2 Protein X NA 1.04e-02 NA
2. P Q00994 Protein BEX3 3.74e-03 2.70e-02 NA
2. P Q8JMZ5 Protein X NA 2.16e-03 NA
2. P P0C686 Protein X NA 1.48e-02 NA
2. P O20173 Uncharacterized 27.9 kDa protein in trnR-minE intergenic region 1.21e-01 2.80e-03 NA
2. P Q69027 Protein X NA 4.33e-02 NA
2. P Q8BP27 Swi5-dependent recombination DNA repair protein 1 homolog 9.32e-03 2.33e-02 NA
2. P P24834 Probable protein E5 NA 3.57e-02 NA
2. P Q95LA0 Fetal and adult testis-expressed transcript protein homolog 2.11e-03 1.72e-04 NA
2. P Q569G3 Uncharacterized protein C5orf47 8.51e-03 2.44e-04 NA
2. P Q0II70 MAPK regulated corepressor interacting protein 2 2.76e-02 2.63e-02 NA
2. P Q95LB4 Fetal and adult testis-expressed transcript protein homolog 1.15e-03 4.14e-04 NA
2. P O88498 Bcl-2-like protein 11 3.96e-02 2.10e-03 NA
2. P Q8N6I1 EP300-interacting inhibitor of differentiation 2 1.28e-02 4.21e-03 NA
2. P Q913A9 Protein X NA 1.19e-02 NA
2. P A6NJI1 Uncharacterized protein C11orf86 3.52e-02 1.06e-02 NA
2. P Q24JP4 Uncharacterized protein C5orf47 homolog 4.37e-03 2.51e-03 NA
2. P O71302 Protein X NA 3.22e-02 NA
2. P Q8JMY5 Protein X NA 7.94e-03 NA
2. P Q69604 Protein X NA 2.39e-02 NA
2. P O54918 Bcl-2-like protein 11 6.35e-02 2.03e-03 NA
2. P P20977 Protein X NA 6.05e-03 NA
2. P Q3T020 Transcription elongation factor A protein-like 8 4.90e-03 6.61e-05 NA
2. P Q1ZZU3 DNA repair protein SWI5 homolog 1.95e-03 1.88e-02 NA