Results | PROST

Summary

Q9BXQ6

Homolog: Q99MX7.
Function: Transmembrane protein 121B.

Statistics

Total GO Annotation: 109
Unique PROST Go: 109
Unique BLAST Go: 0

Total Homologs: 51
Unique PROST Homologs: 49
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q99MX7 (Transmembrane protein 121B) with a FATCAT P-Value: 5.35e-14 and RMSD of 3.46 angstrom. The sequence alignment identity is 86.8%.
Structural alignment shown in left. Query protein Q9BXQ6 colored as red in alignment, homolog Q99MX7 colored as blue. Query protein Q9BXQ6 is also shown in right top, homolog Q99MX7 showed in right bottom. They are colored based on secondary structures.

  Q9BXQ6 MRPALGHPRSVSSASGSFPPPPAAARLQPLFLRGGSFRGRRGSGDSSTSTSTSRGGGGGRRGGGGGSPSSSTGAEREDDDESLSVSKPLVPNAALL-GPP 99
  Q99MX7 MHPALGHPRALSSAPASFPPPPAAARLQPLFLRGGSSRGRRGSGDSSTSTSTSRGGCGGRRGGGGGSPSSSTGAEREDDDESISISKPLVPAAAALPGPP 100

  Q9BXQ6 AQVGAPAGPAPVAFSSSAATSSSTSTPTSSCSMTAADFGGGAAAGAVGGPGSRSAGGAGGTGTGSGASCCPCCCCCGC--PDRPGRRGRRRGCAPSPRCR 197
  Q99MX7 AQ-G---G-VPVSATAPAA-ASSTSTPTSSCSMTAADFGAGAAAGTVGGPGSRSAVGAGGTGTGGAASCCSCCCCC-CGRPTRSGRRGRRRGCSPSPGCR 193

  Q9BXQ6 WGYQALSVVLLLAQGGLLDLYLIAVTDLYWCSWIATDLVVVVGWAIFFAKNSRGRRGGAASGAHNHH-LHHHHAAPPLHLPAPSAATAGAKARGARGGAG 296
  Q99MX7 WGYQALSVVLLLAQGGLLDLYLIAVTDLYWCSWIATDLVVVVGWAIFFAKNSRGRRGGPANSMHNHHQL-HHHSAPPLHLSAAASAGAGAKARGGRGGSG 292

  Q9BXQ6 GAGGGLGAAAAAGEFAFAYLAWLIYSIAFTPKVVLILGTSILDLIELRAPFGTTGFRLTMALSVPLLYSLVRAISEAGAPPGSAGPLLLQPQRHRAAGCF 396
  Q99MX7 GSGAGPGTTGAAGEFAFAYLAWLIYSIAFTPKVVLILGTSILDLIELRAPFGTTGFRLTMALSVPLLYSLVRAISEAGAPPGSAGPLLLQPQQHRAAGCF 392

  Q9BXQ6 LGTCLDLLDSFTLVELMLEGRVPLPAHLRYLLIAVYFLTLASPVLWLYELNAAAAAAASWGQASGPGSCSRLLRLLGGCLVDVPLLALRCLLVVSYQQPL 496
  Q99MX7 LGTCLDLLDSFTLVELMLDGRVPLPAHLRYLLIAVYFLTLASPVLWLYELN-TATAAPSWGQTSGPGSCSRLLRLLGGCLVDVPLLALRSLLVVSYQQPL 491

  Q9BXQ6 SIFMLKNLFFLGCRGLEALEGCWDRGNRASPSRARGGYGAPPSA-PPPPPPPPQGGSQLGHCISENEGGAHGYVNTLAVASQN 578
  Q99MX7 SIFMLKNLFFLGCRGLEALEGCWDRGSWVSPSRARSSYGAPPSAPPPPPPPPPQGGSQRGHL--ENEGGPHGYVNTLAVASQN 572

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
2. P	GO:0009306	protein secretion
2. P	GO:0110134	meiotic drive
2. P	GO:0030173	integral component of Golgi membrane
2. P	GO:0043652	engulfment of apoptotic cell
2. P	GO:0044853	plasma membrane raft
2. P	GO:0030659	cytoplasmic vesicle membrane
2. P	GO:0015680	protein maturation by copper ion transfer
2. P	GO:0006672	ceramide metabolic process
2. P	GO:0000422	autophagy of mitochondrion
2. P	GO:0005375	copper ion transmembrane transporter activity
2. P	GO:0006882	cellular zinc ion homeostasis
2. P	GO:0045294	alpha-catenin binding
2. P	GO:0005381	iron ion transmembrane transporter activity
2. P	GO:0044351	macropinocytosis
2. P	GO:0061436	establishment of skin barrier
2. P	GO:0071212	subsynaptic reticulum
2. P	GO:0097658	Asi complex
2. P	GO:0061245	establishment or maintenance of bipolar cell polarity
2. P	GO:0005891	voltage-gated calcium channel complex
2. P	GO:0045121	membrane raft
2. P	GO:0018230	peptidyl-L-cysteine S-palmitoylation
2. P	GO:0007399	nervous system development
2. P	GO:0070268	cornification
2. P	GO:0036360	sorocarp stalk morphogenesis
2. P	GO:0002250	adaptive immune response
2. P	GO:0006873	cellular ion homeostasis
2. P	GO:0070782	phosphatidylserine exposure on apoptotic cell surface
2. P	GO:1902742	apoptotic process involved in development
2. P	GO:0051495	positive regulation of cytoskeleton organization
2. P	GO:0090155	negative regulation of sphingolipid biosynthetic process
2. P	GO:0046843	dorsal appendage formation
2. P	GO:0051059	NF-kappaB binding
2. P	GO:0030285	integral component of synaptic vesicle membrane
2. P	GO:0034975	protein folding in endoplasmic reticulum
2. P	GO:0047493	ceramide cholinephosphotransferase activity
2. P	GO:0033188	sphingomyelin synthase activity
2. P	GO:0030426	growth cone
2. P	GO:0005262	calcium channel activity
2. P	GO:0045751	negative regulation of Toll signaling pathway
2. P	GO:0030728	ovulation
2. P	GO:0031901	early endosome membrane
2. P	GO:0042335	cuticle development
2. P	GO:0031149	sorocarp stalk cell differentiation
2. P	GO:0006829	zinc ion transport
2. P	GO:0015279	store-operated calcium channel activity
2. P	GO:0051645	Golgi localization
2. P	GO:0002789	negative regulation of antifungal peptide production
2. P	GO:0005789	endoplasmic reticulum membrane
2. P	GO:0002070	epithelial cell maturation
2. P	GO:0051924	regulation of calcium ion transport
2. P	GO:0070886	positive regulation of calcineurin-NFAT signaling cascade
2. P	GO:0005246	calcium channel regulator activity
2. P	GO:0045055	regulated exocytosis
2. P	GO:0007253	cytoplasmic sequestering of NF-kappaB
2. P	GO:0045684	positive regulation of epidermis development
2. P	GO:1900060	negative regulation of ceramide biosynthetic process
2. P	GO:0099180	zinc ion import into synaptic vesicle
2. P	GO:0005765	lysosomal membrane
2. P	GO:0017128	phospholipid scramblase activity
2. P	GO:0045611	negative regulation of hemocyte differentiation
2. P	GO:0051928	positive regulation of calcium ion transport
2. P	GO:0031594	neuromuscular junction
2. P	GO:0034045	phagophore assembly site membrane
2. P	GO:0044671	sorocarp spore cell differentiation
2. P	GO:0016020	membrane
2. P	GO:0051642	centrosome localization
2. P	GO:0008308	voltage-gated anion channel activity
2. P	GO:0016323	basolateral plasma membrane
2. P	GO:0035339	SPOTS complex
2. P	GO:0097708	intracellular vesicle
2. P	GO:0070588	calcium ion transmembrane transport
2. P	GO:0043949	regulation of cAMP-mediated signaling
2. P	GO:0036369	transcription factor catabolic process
2. P	GO:0002115	store-operated calcium entry
2. P	GO:0055074	calcium ion homeostasis
2. P	GO:0034497	protein localization to phagophore assembly site
2. P	GO:0006686	sphingomyelin biosynthetic process
2. P	GO:0035437	maintenance of protein localization in endoplasmic reticulum
2. P	GO:0005776	autophagosome
2. P	GO:0005794	Golgi apparatus
2. P	GO:0009950	dorsal/ventral axis specification
2. P	GO:0061180	mammary gland epithelium development
2. P	GO:0010183	pollen tube guidance
2. P	GO:0016021	integral component of membrane
2. P	GO:0034755	iron ion transmembrane transport
2. P	GO:0140509	epithelium-like organization
2. P	GO:0038023	signaling receptor activity
2. P	GO:0031069	hair follicle morphogenesis
2. P	GO:0005783	endoplasmic reticulum
2. P	GO:0045762	positive regulation of adenylate cyclase activity
2. P	GO:0000407	phagophore assembly site
2. P	GO:0006612	protein targeting to membrane
2. P	GO:0034704	calcium channel complex
2. P	GO:0045180	basal cortex
2. P	GO:0044805	late nucleophagy
2. P	GO:0031154	culmination involved in sorocarp development
2. P	GO:0000139	Golgi membrane
2. P	GO:0032588	trans-Golgi network membrane
2. P	GO:0015677	copper ion import
2. P	GO:0090156	cellular sphingolipid homeostasis
2. P	GO:0030176	integral component of endoplasmic reticulum membrane
2. P	GO:0006986	response to unfolded protein
2. P	GO:0019706	protein-cysteine S-palmitoyltransferase activity
2. P	GO:0031566	actomyosin contractile ring maintenance
2. P	GO:0031150	sorocarp stalk development
2. P	GO:0019730	antimicrobial humoral response
2. P	GO:0070509	calcium ion import
2. P	GO:0042802	identical protein binding
2. P	GO:0006914	autophagy

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	Q99MX7	Transmembrane protein 121B	5.35e-14	2.07e-71	0.0
1. PB	Q9BXQ6	Transmembrane protein 121B	0	6.78e-140	0.0
2. P	P40988	Low-affinity Fe(2+) transport protein	1.16e-02	3.34e-02	NA
2. P	Q8BH10	Protein orai-2	5.33e-04	4.58e-02	NA
2. P	Q9VWK6	Post-GPI attachment to proteins factor 2-like	4.15e-04	1.38e-03	NA
2. P	Q616J1	Protein orai	2.41e-03	1.25e-03	NA
2. P	Q5E9U3	Transmembrane protein 79	6.12e-04	2.97e-06	NA
2. P	Q54I71	Protein aardvark	7.60e-02	1.13e-02	NA
2. P	Q54LC9	Uncharacterized Golgi apparatus membrane protein-like protein 2	1.23e-02	3.11e-02	NA
2. P	Q550C1	Protein TAPT1 homolog	3.79e-03	1.62e-04	NA
2. P	Q9U6B8	Calcium release-activated calcium channel protein 1	3.92e-03	2.29e-04	NA
2. P	Q9BSE2	Transmembrane protein 79	1.56e-02	1.17e-05	NA
2. P	Q6GLN7	Transmembrane protein 163	4.79e-04	1.02e-03	NA
2. P	F2E2E4	CASP-like protein 4B1	2.42e-03	2.97e-02	NA
2. P	Q54DE8	Presenilin-B	2.96e-03	1.45e-02	NA
2. P	Q88940	ORF-B protein	NA	6.69e-05	NA
2. P	Q7SFL7	Palmitoyltransferase erf2	2.64e-02	3.86e-02	NA
2. P	Q5M848	Calcium release-activated calcium channel protein 1	5.21e-04	2.24e-02	NA
2. P	A0A1X9Q9F0	Meiotic driver cw9	3.65e-03	7.78e-03	NA
2. P	Q5B3W7	Palmitoyltransferase erf2	1.82e-01	1.71e-02	NA
2. P	P53224	Protein ORM1	2.19e-01	7.63e-03	NA
2. P	Q5GH59	XK-related protein 4	4.91e-04	1.11e-04	NA
2. P	Q9FLV9	S-type anion channel SLAH3	1.84e-02	2.87e-04	NA
2. P	Q9U3D4	Phosphatidylcholine:ceramide cholinephosphotransferase 1	4.10e-02	5.41e-03	NA
2. P	Q4WWN2	Palmitoyltransferase erf2	5.17e-02	1.75e-03	NA
2. P	O60067	Endoplasmic reticulum membrane protein 65	9.08e-04	1.54e-02	NA
2. P	Q2M2E3	Outer dense fiber protein 4	1.39e-02	1.96e-02	NA
2. P	Q8BWG9	Calcium release-activated calcium channel protein 1	2.65e-04	1.16e-02	NA
2. P	A6NNE9	E3 ubiquitin-protein ligase MARCHF11	1.19e-02	2.38e-02	NA
2. P	A9CMA6	Transmembrane protein 163	2.28e-04	2.41e-02	NA
2. P	Q8C996	Transmembrane protein 163	3.45e-04	3.08e-02	NA
2. P	Q4P683	Autophagy-related protein 9	4.68e-02	1.32e-02	NA
2. P	O74312	Autophagy-related protein 9	2.63e-02	4.38e-06	NA
2. P	Q9D709	Transmembrane protein 79	1.18e-02	1.05e-05	NA
2. P	Q07959	ADIPOR-like receptor IZH3	8.49e-03	1.08e-06	NA
2. P	Q5GH73	XK-related protein 6	9.60e-03	1.57e-02	NA
2. P	P53895	Protein ASI2	3.47e-04	7.63e-03	NA
2. P	Q96WS1	Wtf element wtf11	4.26e-03	1.04e-05	NA
2. P	F4HVJ3	Protein POLLEN DEFECTIVE IN GUIDANCE 1	2.25e-03	3.06e-05	NA
2. P	Q3T1H8	Transmembrane protein 79	4.64e-03	4.67e-04	NA
2. P	Q75F81	ADIPOR-like receptor IZH3	3.31e-03	1.75e-03	NA
2. P	Q8LDS3	Reticulon-like protein B18	1.34e-02	2.06e-02	NA
2. P	P53735	Protein ZRG17	7.77e-03	4.21e-04	NA
2. P	P0CS96	UPF0328 protein ECU05_0030	2.34e-03	3.39e-04	NA
2. P	P0CS97	UPF0328 protein ECU10_1870	3.21e-03	4.91e-04	NA
2. P	Q8TC26	Transmembrane protein 163	9.94e-04	1.42e-02	NA
2. P	Q06144	Protein ORM2	1.46e-01	4.03e-05	NA
2. P	Q09232	Protein orai	4.72e-03	7.56e-03	NA
2. P	Q03017	NF-kappa-B inhibitor cactus	1.98e-01	3.08e-02	NA
2. P	P83757	NF-kappa-B inhibitor cactus	NA	1.26e-02	NA
2. P	P0C150	Protoheme IX farnesyltransferase, mitochondrial	3.65e-03	1.06e-04	NA