Results | PROST

Summary

Q9BZ19

Homolog: Q9D2X0.
Function: Ankyrin repeat domain-containing protein 39.

Statistics

Total GO Annotation: 690
Unique PROST Go: 13
Unique BLAST Go: 668

Total Homologs: 557
Unique PROST Homologs: 3
Unique BLAST Homologs: 550

Structures and Sequence Alignment

The best structural homolog that predicted by 3. B was Q9D2X0 (Ankyrin repeat domain-containing protein 39) with a FATCAT P-Value: 5.24e-09 and RMSD of 2.01 angstrom. The sequence alignment identity is 20.4%.
Structural alignment shown in left. Query protein Q9BZ19 colored as red in alignment, homolog Q9D2X0 colored as blue. Query protein Q9BZ19 is also shown in right top, homolog Q9D2X0 showed in right bottom. They are colored based on secondary structures.

  Q9BZ19 MTRGRAWGMRRAAAGAGGARAAGPTGGASRLHPNAGRRSGARAGAQGCGGPRVGSADSRALPAQPLACARGRSQRLVCDPKAASALPDLAPDVFVLRVRL 100
  Q9D2X0 -----------------------------------------------------------------------------------MAAPHLCAD-------- 9

  Q9BZ19 EETGEMFRVANCRGDMTVRELKEELDLMVGIPFNLQRLQYLDEGVLMDDTTLKFHDVVPGGIISLCIWHHDGWTELVLAAVEGDPSKLSCLGLTEDSFYR 200
  Q9D2X0 ---G------SCCSHPS------------AVP-GVQ--QTLEE---MD-----F-D---RGI----------WS----AALNGD------LGRVK-YFIQ 52

  Q9BZ19 --TANSE-HFEGEKWKHWTSQRAFVALYVASHRGHFDAV-QYLLEHGASCLSRSPLGRTPLHVAAAMGRSDCIILLLQHGAS--IHDRDAKGETPISIAH 294
  Q9D2X0 KATDPSQPDSAG-----YT------ALHYASRNGHY-AVCQFLLESGAKCDAQTHGGATALHRASYCGHTEIARLLLSHGSNPWLVDND--GMT--SL-H 135

  Q9BZ19 RL---NHTLSERQMVLL-HRIAKSGIRD----LN-DLVMKNA-L-QRVKSGFRSEKMTMTPH 345
  Q9D2X0 KAAEKGH--EDICSLLLQHSPALKAVRDRKARLACDLLPCNSGLWDLLAS------------ 183

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
1. PB	GO:0043619	regulation of transcription from RNA polymerase II promoter in response to oxidative stress
1. PB	GO:0043422	protein kinase B binding
1. PB	GO:0061629	RNA polymerase II-specific DNA-binding transcription factor binding
1. PB	GO:0045662	negative regulation of myoblast differentiation
1. PB	GO:0042994	cytoplasmic sequestering of transcription factor
1. PB	GO:0001650	fibrillar center
1. PB	GO:0051726	regulation of cell cycle
1. PB	GO:0000062	fatty-acyl-CoA binding
1. PB	GO:0031674	I band
2. P	GO:0045296	cadherin binding
2. P	GO:0014866	skeletal myofibril assembly
2. P	GO:0006936	muscle contraction
2. P	GO:0007519	skeletal muscle tissue development
2. P	GO:0016605	PML body
2. P	GO:0008307	structural constituent of muscle
2. P	GO:0045445	myoblast differentiation
2. P	GO:0000791	euchromatin
2. P	GO:0071363	cellular response to growth factor stimulus
2. P	GO:0007517	muscle organ development
2. P	GO:2000288	positive regulation of myoblast proliferation
2. P	GO:0010629	negative regulation of gene expression
2. P	GO:0009791	post-embryonic development
3. B	GO:0005770	late endosome
3. B	GO:0034765	regulation of ion transmembrane transport
3. B	GO:0071625	vocalization behavior
3. B	GO:0000122	negative regulation of transcription by RNA polymerase II
3. B	GO:0048337	positive regulation of mesodermal cell fate specification
3. B	GO:0050729	positive regulation of inflammatory response
3. B	GO:0090037	positive regulation of protein kinase C signaling
3. B	GO:0048709	oligodendrocyte differentiation
3. B	GO:0006511	ubiquitin-dependent protein catabolic process
3. B	GO:0043011	myeloid dendritic cell differentiation
3. B	GO:0035148	tube formation
3. B	GO:0032045	guanyl-nucleotide exchange factor complex
3. B	GO:0032456	endocytic recycling
3. B	GO:0007205	protein kinase C-activating G protein-coupled receptor signaling pathway
3. B	GO:0010865	stipule development
3. B	GO:0005095	GTPase inhibitor activity
3. B	GO:0007507	heart development
3. B	GO:0001701	in utero embryonic development
3. B	GO:0072104	glomerular capillary formation
3. B	GO:1903779	regulation of cardiac conduction
3. B	GO:0030334	regulation of cell migration
3. B	GO:0001756	somitogenesis
3. B	GO:0032421	stereocilium bundle
3. B	GO:0003270	Notch signaling pathway involved in regulation of secondary heart field cardioblast proliferation
3. B	GO:0010812	negative regulation of cell-substrate adhesion
3. B	GO:0060412	ventricular septum morphogenesis
3. B	GO:2001259	positive regulation of cation channel activity
3. B	GO:0021514	ventral spinal cord interneuron differentiation
3. B	GO:0045663	positive regulation of myoblast differentiation
3. B	GO:0014044	Schwann cell development
3. B	GO:0097190	apoptotic signaling pathway
3. B	GO:0019903	protein phosphatase binding
3. B	GO:0006306	DNA methylation
3. B	GO:0106310	protein serine kinase activity
3. B	GO:0003252	negative regulation of cell proliferation involved in heart valve morphogenesis
3. B	GO:0085020	protein K6-linked ubiquitination
3. B	GO:0006959	humoral immune response
3. B	GO:0004842	ubiquitin-protein transferase activity
3. B	GO:0047499	calcium-independent phospholipase A2 activity
3. B	GO:0007140	male meiotic nuclear division
3. B	GO:0001837	epithelial to mesenchymal transition
3. B	GO:0051494	negative regulation of cytoskeleton organization
3. B	GO:0048259	regulation of receptor-mediated endocytosis
3. B	GO:0045070	positive regulation of viral genome replication
3. B	GO:0003950	NAD+ ADP-ribosyltransferase activity
3. B	GO:0032420	stereocilium
3. B	GO:0035264	multicellular organism growth
3. B	GO:0021519	spinal cord association neuron specification
3. B	GO:0001726	ruffle
3. B	GO:0051489	regulation of filopodium assembly
3. B	GO:0035622	intrahepatic bile duct development
3. B	GO:0045737	positive regulation of cyclin-dependent protein serine/threonine kinase activity
3. B	GO:0045036	protein targeting to chloroplast
3. B	GO:0043254	regulation of protein-containing complex assembly
3. B	GO:0016571	histone methylation
3. B	GO:0010765	positive regulation of sodium ion transport
3. B	GO:0035304	regulation of protein dephosphorylation
3. B	GO:0071546	pi-body
3. B	GO:0003162	atrioventricular node development
3. B	GO:0035690
3. B	GO:0007283	spermatogenesis
3. B	GO:0007492	endoderm development
3. B	GO:0048549	positive regulation of pinocytosis
3. B	GO:2001214	positive regulation of vasculogenesis
3. B	GO:0030534	adult behavior
3. B	GO:0031069	hair follicle morphogenesis
3. B	GO:0072659	protein localization to plasma membrane
3. B	GO:0086015	SA node cell action potential
3. B	GO:0032466	negative regulation of cytokinesis
3. B	GO:1990404	protein ADP-ribosylase activity
3. B	GO:0005903	brush border
3. B	GO:0061073	ciliary body morphogenesis
3. B	GO:0036464	cytoplasmic ribonucleoprotein granule
3. B	GO:0003151	outflow tract morphogenesis
3. B	GO:1902807	negative regulation of cell cycle G1/S phase transition
3. B	GO:0007520	myoblast fusion
3. B	GO:0006913	nucleocytoplasmic transport
3. B	GO:0072014	proximal tubule development
3. B	GO:0002437	inflammatory response to antigenic stimulus
3. B	GO:0002039	p53 binding
3. B	GO:0031286	negative regulation of sorocarp stalk cell differentiation
3. B	GO:0002052	positive regulation of neuroblast proliferation
3. B	GO:0080173	male-female gamete recognition during double fertilization forming a zygote and endosperm
3. B	GO:1902309	negative regulation of peptidyl-serine dephosphorylation
3. B	GO:0031462	Cul2-RING ubiquitin ligase complex
3. B	GO:0048715	negative regulation of oligodendrocyte differentiation
3. B	GO:0010564	regulation of cell cycle process
3. B	GO:0034142	toll-like receptor 4 signaling pathway
3. B	GO:0005123	death receptor binding
3. B	GO:0032426	stereocilium tip
3. B	GO:0043409	negative regulation of MAPK cascade
3. B	GO:0043008	ATP-dependent protein binding
3. B	GO:0003160	endocardium morphogenesis
3. B	GO:0043086	negative regulation of catalytic activity
3. B	GO:0022011	myelination in peripheral nervous system
3. B	GO:0007249	I-kappaB kinase/NF-kappaB signaling
3. B	GO:0010313	phytochrome binding
3. B	GO:0050894	determination of affect
3. B	GO:0045638	negative regulation of myeloid cell differentiation
3. B	GO:0001709	cell fate determination
3. B	GO:0000209	protein polyubiquitination
3. B	GO:0035116	embryonic hindlimb morphogenesis
3. B	GO:0001947	heart looping
3. B	GO:0097546	ciliary base
3. B	GO:0090201	negative regulation of release of cytochrome c from mitochondria
3. B	GO:0002027	regulation of heart rate
3. B	GO:2000178	negative regulation of neural precursor cell proliferation
3. B	GO:1904970	brush border assembly
3. B	GO:0044325	transmembrane transporter binding
3. B	GO:0008593	regulation of Notch signaling pathway
3. B	GO:0030496	midbody
3. B	GO:0005634	nucleus
3. B	GO:0098891	extrinsic component of presynaptic active zone membrane
3. B	GO:0072116	pronephros formation
3. B	GO:0072574	hepatocyte proliferation
3. B	GO:0019888	protein phosphatase regulator activity
3. B	GO:0046875	ephrin receptor binding
3. B	GO:0010366	negative regulation of ethylene biosynthetic process
3. B	GO:0072044	collecting duct development
3. B	GO:0046826	negative regulation of protein export from nucleus
3. B	GO:1900246	positive regulation of RIG-I signaling pathway
3. B	GO:0070528	protein kinase C signaling
3. B	GO:0097129	cyclin D2-CDK4 complex
3. B	GO:0007253	cytoplasmic sequestering of NF-kappaB
3. B	GO:0005516	calmodulin binding
3. B	GO:0060999	positive regulation of dendritic spine development
3. B	GO:0045603	positive regulation of endothelial cell differentiation
3. B	GO:0010875	positive regulation of cholesterol efflux
3. B	GO:0045746	negative regulation of Notch signaling pathway
3. B	GO:0035774	positive regulation of insulin secretion involved in cellular response to glucose stimulus
3. B	GO:0070213	protein auto-ADP-ribosylation
3. B	GO:0004672	protein kinase activity
3. B	GO:0046427	positive regulation of receptor signaling pathway via JAK-STAT
3. B	GO:0043330	response to exogenous dsRNA
3. B	GO:0055016	hypochord development
3. B	GO:0031877	somatostatin receptor binding
3. B	GO:0048812	neuron projection morphogenesis
3. B	GO:0033292	T-tubule organization
3. B	GO:0010923	negative regulation of phosphatase activity
3. B	GO:0005769	early endosome
3. B	GO:0071356	cellular response to tumor necrosis factor
3. B	GO:0045665	negative regulation of neuron differentiation
3. B	GO:0055074	calcium ion homeostasis
3. B	GO:0048699	generation of neurons
3. B	GO:0071372	cellular response to follicle-stimulating hormone stimulus
3. B	GO:0005525	GTP binding
3. B	GO:1900245	positive regulation of MDA-5 signaling pathway
3. B	GO:0045747	positive regulation of Notch signaling pathway
3. B	GO:0035898	parathyroid hormone secretion
3. B	GO:0035924	cellular response to vascular endothelial growth factor stimulus
3. B	GO:0106311
3. B	GO:0014832	urinary bladder smooth muscle contraction
3. B	GO:0071889	14-3-3 protein binding
3. B	GO:0009644	response to high light intensity
3. B	GO:0040028	regulation of vulval development
3. B	GO:0031436	BRCA1-BARD1 complex
3. B	GO:0010227	floral organ abscission
3. B	GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process
3. B	GO:0006469	negative regulation of protein kinase activity
3. B	GO:0045944	positive regulation of transcription by RNA polymerase II
3. B	GO:0050768	negative regulation of neurogenesis
3. B	GO:0099092	postsynaptic density, intracellular component
3. B	GO:0045893	positive regulation of transcription, DNA-templated
3. B	GO:0005249	voltage-gated potassium channel activity
3. B	GO:0045211	postsynaptic membrane
3. B	GO:0010838	positive regulation of keratinocyte proliferation
3. B	GO:0046834	lipid phosphorylation
3. B	GO:0090083	regulation of inclusion body assembly
3. B	GO:0010976	positive regulation of neuron projection development
3. B	GO:0031941	filamentous actin
3. B	GO:0030017	sarcomere
3. B	GO:0032270	positive regulation of cellular protein metabolic process
3. B	GO:0043491	protein kinase B signaling
3. B	GO:0005902	microvillus
3. B	GO:0036336	dendritic cell migration
3. B	GO:0016055	Wnt signaling pathway
3. B	GO:0048873	homeostasis of number of cells within a tissue
3. B	GO:0051967	negative regulation of synaptic transmission, glutamatergic
3. B	GO:0061195	taste bud formation
3. B	GO:0031398	positive regulation of protein ubiquitination
3. B	GO:0018345	protein palmitoylation
3. B	GO:1904106	protein localization to microvillus
3. B	GO:0032288	myelin assembly
3. B	GO:0021515	cell differentiation in spinal cord
3. B	GO:0015271	outward rectifier potassium channel activity
3. B	GO:0002011	morphogenesis of an epithelial sheet
3. B	GO:0014807	regulation of somitogenesis
3. B	GO:0031670	cellular response to nutrient
3. B	GO:0030279	negative regulation of ossification
3. B	GO:0090090	negative regulation of canonical Wnt signaling pathway
3. B	GO:0048663	neuron fate commitment
3. B	GO:0030016	myofibril
3. B	GO:0060743	epithelial cell maturation involved in prostate gland development
3. B	GO:0003182	coronary sinus valve morphogenesis
3. B	GO:0055117	regulation of cardiac muscle contraction
3. B	GO:1902339	positive regulation of apoptotic process involved in morphogenesis
3. B	GO:0035307	positive regulation of protein dephosphorylation
3. B	GO:0007409	axonogenesis
3. B	GO:0045171	intercellular bridge
3. B	GO:0035255	ionotropic glutamate receptor binding
3. B	GO:1902260	negative regulation of delayed rectifier potassium channel activity
3. B	GO:0031013	troponin I binding
3. B	GO:0031430	M band
3. B	GO:0050678	regulation of epithelial cell proliferation
3. B	GO:0008306	associative learning
3. B	GO:0043046	DNA methylation involved in gamete generation
3. B	GO:0070198	protein localization to chromosome, telomeric region
3. B	GO:0090238	positive regulation of arachidonic acid secretion
3. B	GO:0031253	cell projection membrane
3. B	GO:0072576	liver morphogenesis
3. B	GO:0007030	Golgi organization
3. B	GO:0045838	positive regulation of membrane potential
3. B	GO:0005929	cilium
3. B	GO:1902263	apoptotic process involved in embryonic digit morphogenesis
3. B	GO:0036371	protein localization to T-tubule
3. B	GO:0003344	pericardium morphogenesis
3. B	GO:0060076	excitatory synapse
3. B	GO:0070742	C2H2 zinc finger domain binding
3. B	GO:0140627	ubiquitin-dependent protein catabolic process via the C-end degron rule pathway
3. B	GO:0003208	cardiac ventricle morphogenesis
3. B	GO:0003214	cardiac left ventricle morphogenesis
3. B	GO:0014731	spectrin-associated cytoskeleton
3. B	GO:0005737	cytoplasm
3. B	GO:0098978	glutamatergic synapse
3. B	GO:2000001	regulation of DNA damage checkpoint
3. B	GO:0055013	cardiac muscle cell development
3. B	GO:0072114	pronephros morphogenesis
3. B	GO:0071560	cellular response to transforming growth factor beta stimulus
3. B	GO:0061630	ubiquitin protein ligase activity
3. B	GO:0010882	regulation of cardiac muscle contraction by calcium ion signaling
3. B	GO:0043005	neuron projection
3. B	GO:0098871	postsynaptic actin cytoskeleton
3. B	GO:0097435	supramolecular fiber organization
3. B	GO:0097120	receptor localization to synapse
3. B	GO:0014704	intercalated disc
3. B	GO:0030308	negative regulation of cell growth
3. B	GO:0019901	protein kinase binding
3. B	GO:0046959	habituation
3. B	GO:0001955	blood vessel maturation
3. B	GO:0099519	dense core granule cytoskeletal transport
3. B	GO:0032013	negative regulation of ARF protein signal transduction
3. B	GO:0007219	Notch signaling pathway
3. B	GO:0035994	response to muscle stretch
3. B	GO:0038023	signaling receptor activity
3. B	GO:0060354	negative regulation of cell adhesion molecule production
3. B	GO:0010881	regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion
3. B	GO:0031441	negative regulation of mRNA 3'-end processing
3. B	GO:0032232	negative regulation of actin filament bundle assembly
3. B	GO:0034638	phosphatidylcholine catabolic process
3. B	GO:0021546	rhombomere development
3. B	GO:0003332	negative regulation of extracellular matrix constituent secretion
3. B	GO:0033280	response to vitamin D
3. B	GO:0046976	histone methyltransferase activity (H3-K27 specific)
3. B	GO:1905274	regulation of modification of postsynaptic actin cytoskeleton
3. B	GO:0120163	negative regulation of cold-induced thermogenesis
3. B	GO:0005856	cytoskeleton
3. B	GO:0031047	gene silencing by RNA
3. B	GO:0042048	olfactory behavior
3. B	GO:0071447	cellular response to hydroperoxide
3. B	GO:0032580	Golgi cisterna membrane
3. B	GO:0035914	skeletal muscle cell differentiation
3. B	GO:0000731	DNA synthesis involved in DNA repair
3. B	GO:0016529	sarcoplasmic reticulum
3. B	GO:0071800	podosome assembly
3. B	GO:0000082	G1/S transition of mitotic cell cycle
3. B	GO:0005096	GTPase activator activity
3. B	GO:0030034	microvillar actin bundle assembly
3. B	GO:0045672	positive regulation of osteoclast differentiation
3. B	GO:1904743	negative regulation of telomeric DNA binding
3. B	GO:1900383	regulation of synaptic plasticity by receptor localization to synapse
3. B	GO:0003241	growth involved in heart morphogenesis
3. B	GO:0072660	maintenance of protein location in plasma membrane
3. B	GO:0015629	actin cytoskeleton
3. B	GO:0009967	positive regulation of signal transduction
3. B	GO:0086004	regulation of cardiac muscle cell contraction
3. B	GO:0055007	cardiac muscle cell differentiation
3. B	GO:2000134	negative regulation of G1/S transition of mitotic cell cycle
3. B	GO:0043197	dendritic spine
3. B	GO:0005112	Notch binding
3. B	GO:0003198	epithelial to mesenchymal transition involved in endocardial cushion formation
3. B	GO:0102991	myristoyl-CoA hydrolase activity
3. B	GO:1901187	regulation of ephrin receptor signaling pathway
3. B	GO:0061028	establishment of endothelial barrier
3. B	GO:0001889	liver development
3. B	GO:0008285	negative regulation of cell population proliferation
3. B	GO:0045197	establishment or maintenance of epithelial cell apical/basal polarity
3. B	GO:0009944	polarity specification of adaxial/abaxial axis
3. B	GO:0060674	placenta blood vessel development
3. B	GO:0033209	tumor necrosis factor-mediated signaling pathway
3. B	GO:0036309	protein localization to M-band
3. B	GO:0048439	flower morphogenesis
3. B	GO:0010254	nectary development
3. B	GO:0050750	low-density lipoprotein particle receptor binding
3. B	GO:0060317	cardiac epithelial to mesenchymal transition
3. B	GO:0060948	cardiac vascular smooth muscle cell development
3. B	GO:0086069	bundle of His cell to Purkinje myocyte communication
3. B	GO:0045732	positive regulation of protein catabolic process
3. B	GO:0034446	substrate adhesion-dependent cell spreading
3. B	GO:0002357	defense response to tumor cell
3. B	GO:0002070	epithelial cell maturation
3. B	GO:0031432	titin binding
3. B	GO:0034112	positive regulation of homotypic cell-cell adhesion
3. B	GO:0060442	branching involved in prostate gland morphogenesis
3. B	GO:0043679	axon terminus
3. B	GO:0006471	protein ADP-ribosylation
3. B	GO:0070531	BRCA1-A complex
3. B	GO:0030154	cell differentiation
3. B	GO:0060842	arterial endothelial cell differentiation
3. B	GO:0086070	SA node cell to atrial cardiac muscle cell communication
3. B	GO:1900452	regulation of long-term synaptic depression
3. B	GO:0009411	response to UV
3. B	GO:0042327	positive regulation of phosphorylation
3. B	GO:0045955	negative regulation of calcium ion-dependent exocytosis
3. B	GO:0070972	protein localization to endoplasmic reticulum
3. B	GO:0090160	Golgi to lysosome transport
3. B	GO:2001027	negative regulation of endothelial cell chemotaxis
3. B	GO:0038180	nerve growth factor signaling pathway
3. B	GO:0043268	positive regulation of potassium ion transport
3. B	GO:0016021	integral component of membrane
3. B	GO:0031267	small GTPase binding
3. B	GO:0060035	notochord cell development
3. B	GO:0002193	MAML1-RBP-Jkappa- ICN1 complex
3. B	GO:0046579	positive regulation of Ras protein signal transduction
3. B	GO:0045685	regulation of glial cell differentiation
3. B	GO:0030513	positive regulation of BMP signaling pathway
3. B	GO:2000737	negative regulation of stem cell differentiation
3. B	GO:0048754	branching morphogenesis of an epithelial tube
3. B	GO:0004861	cyclin-dependent protein serine/threonine kinase inhibitor activity
3. B	GO:0010001	glial cell differentiation
3. B	GO:1902531	regulation of intracellular signal transduction
3. B	GO:1900827	positive regulation of membrane depolarization during cardiac muscle cell action potential
3. B	GO:0031960	response to corticosteroid
3. B	GO:0060074	synapse maturation
3. B	GO:0003256	regulation of transcription from RNA polymerase II promoter involved in myocardial precursor cell differentiation
3. B	GO:1901201	regulation of extracellular matrix assembly
3. B	GO:0048892	lateral line nerve development
3. B	GO:0032049	cardiolipin biosynthetic process
3. B	GO:0045807	positive regulation of endocytosis
3. B	GO:0008093	cytoskeletal anchor activity
3. B	GO:0010667	negative regulation of cardiac muscle cell apoptotic process
3. B	GO:0042802	identical protein binding
3. B	GO:0005938	cell cortex
3. B	GO:0045773	positive regulation of axon extension
3. B	GO:0048708	astrocyte differentiation
3. B	GO:0005654	nucleoplasm
3. B	GO:0001708	cell fate specification
3. B	GO:0034058	endosomal vesicle fusion
3. B	GO:0003222	ventricular trabecula myocardium morphogenesis
3. B	GO:0030326	embryonic limb morphogenesis
3. B	GO:0060740	prostate gland epithelium morphogenesis
3. B	GO:0071286	cellular response to magnesium ion
3. B	GO:0060411	cardiac septum morphogenesis
3. B	GO:0050775	positive regulation of dendrite morphogenesis
3. B	GO:0045967	negative regulation of growth rate
3. B	GO:0043034	costamere
3. B	GO:0099147	extrinsic component of postsynaptic density membrane
3. B	GO:0048786	presynaptic active zone
3. B	GO:0021986	habenula development
3. B	GO:0031297	replication fork processing
3. B	GO:0030046	parallel actin filament bundle assembly
3. B	GO:0016567	protein ubiquitination
3. B	GO:0051059	NF-kappaB binding
3. B	GO:0046469	platelet activating factor metabolic process
3. B	GO:0007605	sensory perception of sound
3. B	GO:0039022	pronephric duct development
3. B	GO:0044877	protein-containing complex binding
3. B	GO:0070986	left/right axis specification
3. B	GO:0005576	extracellular region
3. B	GO:0019887	protein kinase regulator activity
3. B	GO:0046974	histone methyltransferase activity (H3-K9 specific)
3. B	GO:0018024	histone-lysine N-methyltransferase activity
3. B	GO:0010468	regulation of gene expression
3. B	GO:0021915	neural tube development
3. B	GO:0008021	synaptic vesicle
3. B	GO:0030018	Z disc
3. B	GO:0098879	structural constituent of postsynaptic specialization
3. B	GO:0097431	mitotic spindle pole
3. B	GO:0009864	induced systemic resistance, jasmonic acid mediated signaling pathway
3. B	GO:0036377	arbuscular mycorrhizal association
3. B	GO:0043063	intercellular bridge organization
3. B	GO:0046473	phosphatidic acid metabolic process
3. B	GO:0099612	protein localization to axon
3. B	GO:0007221	positive regulation of transcription of Notch receptor target
3. B	GO:1902041	regulation of extrinsic apoptotic signaling pathway via death domain receptors
3. B	GO:0005524	ATP binding
3. B	GO:0061419	positive regulation of transcription from RNA polymerase II promoter in response to hypoxia
3. B	GO:0098703	calcium ion import across plasma membrane
3. B	GO:0045669	positive regulation of osteoblast differentiation
3. B	GO:0071803	positive regulation of podosome assembly
3. B	GO:0010582	floral meristem determinacy
3. B	GO:0046338	phosphatidylethanolamine catabolic process
3. B	GO:0097422	tubular endosome
3. B	GO:0018027	peptidyl-lysine dimethylation
3. B	GO:0006654	phosphatidic acid biosynthetic process
3. B	GO:0010960	magnesium ion homeostasis
3. B	GO:2001204	regulation of osteoclast development
3. B	GO:0005547	phosphatidylinositol-3,4,5-trisphosphate binding
3. B	GO:0042826	histone deacetylase binding
3. B	GO:0097060	synaptic membrane
3. B	GO:1990090	cellular response to nerve growth factor stimulus
3. B	GO:0035418	protein localization to synapse
3. B	GO:0042325	regulation of phosphorylation
3. B	GO:0010614	negative regulation of cardiac muscle hypertrophy
3. B	GO:0021675	nerve development
3. B	GO:0035646	endosome to melanosome transport
3. B	GO:0044232	organelle membrane contact site
3. B	GO:0090212	negative regulation of establishment of blood-brain barrier
3. B	GO:0001841	neural tube formation
3. B	GO:0048899	anterior lateral line development
3. B	GO:0001222	transcription corepressor binding
3. B	GO:0062043	positive regulation of cardiac epithelial to mesenchymal transition
3. B	GO:0010434	bract formation
3. B	GO:0007009	plasma membrane organization
3. B	GO:0045607	regulation of inner ear auditory receptor cell differentiation
3. B	GO:0043292	contractile fiber
3. B	GO:0043517	positive regulation of DNA damage response, signal transduction by p53 class mediator
3. B	GO:0051492	regulation of stress fiber assembly
3. B	GO:0019843	rRNA binding
3. B	GO:0070212	protein poly-ADP-ribosylation
3. B	GO:2000048	negative regulation of cell-cell adhesion mediated by cadherin
3. B	GO:0060979	vasculogenesis involved in coronary vascular morphogenesis
3. B	GO:0009066	aspartate family amino acid metabolic process
3. B	GO:0000151	ubiquitin ligase complex
3. B	GO:2000209	regulation of anoikis
3. B	GO:0030160	synaptic receptor adaptor activity
3. B	GO:0019228	neuronal action potential
3. B	GO:0072017	distal tubule development
3. B	GO:0046339	diacylglycerol metabolic process
3. B	GO:0042659	regulation of cell fate specification
3. B	GO:0007440	foregut morphogenesis
3. B	GO:0048711	positive regulation of astrocyte differentiation
3. B	GO:0045859	regulation of protein kinase activity
3. B	GO:0004622	lysophospholipase activity
3. B	GO:0072357	PTW/PP1 phosphatase complex
3. B	GO:0007386	compartment pattern specification
3. B	GO:0010650	positive regulation of cell communication by electrical coupling
3. B	GO:0003181	atrioventricular valve morphogenesis
3. B	GO:0090051	negative regulation of cell migration involved in sprouting angiogenesis
3. B	GO:0042663	regulation of endodermal cell fate specification
3. B	GO:0010638	positive regulation of organelle organization
3. B	GO:0061000	negative regulation of dendritic spine development
3. B	GO:0045874	positive regulation of sevenless signaling pathway
3. B	GO:0060768	regulation of epithelial cell proliferation involved in prostate gland development
3. B	GO:0060998	regulation of dendritic spine development
3. B	GO:2000811	negative regulation of anoikis
3. B	GO:0048102	autophagic cell death
3. B	GO:0006897	endocytosis
3. B	GO:0032934	sterol binding
3. B	GO:0070650	actin filament bundle distribution
3. B	GO:0045608	negative regulation of inner ear auditory receptor cell differentiation
3. B	GO:0055008	cardiac muscle tissue morphogenesis
3. B	GO:1901339	regulation of store-operated calcium channel activity
3. B	GO:0099402	plant organ development
3. B	GO:0014066	regulation of phosphatidylinositol 3-kinase signaling
3. B	GO:0006887	exocytosis
3. B	GO:0000242	pericentriolar material
3. B	GO:2000096	positive regulation of Wnt signaling pathway, planar cell polarity pathway
3. B	GO:0003197	endocardial cushion development
3. B	GO:0016604	nuclear body
3. B	GO:0098685	Schaffer collateral - CA1 synapse
3. B	GO:1903589	positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis
3. B	GO:0098907	regulation of SA node cell action potential
3. B	GO:0003203	endocardial cushion morphogenesis
3. B	GO:0008157	protein phosphatase 1 binding
3. B	GO:0003408	optic cup formation involved in camera-type eye development
3. B	GO:1905383	protein localization to presynapse
3. B	GO:1900026	positive regulation of substrate adhesion-dependent cell spreading
3. B	GO:0035965	cardiolipin acyl-chain remodeling
3. B	GO:0003677	DNA binding
3. B	GO:0048471	perinuclear region of cytoplasm
3. B	GO:0030155	regulation of cell adhesion
3. B	GO:0086014	atrial cardiac muscle cell action potential
3. B	GO:0016409	palmitoyltransferase activity
3. B	GO:0008270	zinc ion binding
3. B	GO:0003184	pulmonary valve morphogenesis
3. B	GO:0030507	spectrin binding
3. B	GO:0043518	negative regulation of DNA damage response, signal transduction by p53 class mediator
3. B	GO:0003169	coronary vein morphogenesis
3. B	GO:1904908	negative regulation of maintenance of mitotic sister chromatid cohesion, telomeric
3. B	GO:0060528	secretory columnal luminar epithelial cell differentiation involved in prostate glandular acinus development
3. B	GO:0047389	glycerophosphocholine phosphodiesterase activity
3. B	GO:0010832	negative regulation of myotube differentiation
3. B	GO:0002315	marginal zone B cell differentiation
3. B	GO:0071532	ankyrin repeat binding
3. B	GO:0070682	proteasome regulatory particle assembly
3. B	GO:0070936	protein K48-linked ubiquitination
3. B	GO:0070412	R-SMAD binding
3. B	GO:0051438	regulation of ubiquitin-protein transferase activity
3. B	GO:0045648	positive regulation of erythrocyte differentiation
3. B	GO:0031143	pseudopodium
3. B	GO:0051017	actin filament bundle assembly
3. B	GO:0032495	response to muramyl dipeptide
3. B	GO:0007368	determination of left/right symmetry
3. B	GO:0060982	coronary artery morphogenesis
3. B	GO:0014069	postsynaptic density
3. B	GO:0045687	positive regulation of glial cell differentiation
3. B	GO:0007616	long-term memory
3. B	GO:0070431	nucleotide-binding oligomerization domain containing 2 signaling pathway
3. B	GO:0001954	positive regulation of cell-matrix adhesion
3. B	GO:0014912	negative regulation of smooth muscle cell migration
3. B	GO:0031359	integral component of chloroplast outer membrane
3. B	GO:0010780	meiotic DNA double-strand break formation involved in reciprocal meiotic recombination
3. B	GO:0071407	cellular response to organic cyclic compound
3. B	GO:0031867	EP4 subtype prostaglandin E2 receptor binding
3. B	GO:0015248	sterol transporter activity
3. B	GO:0048103	somatic stem cell division
3. B	GO:1902412	regulation of mitotic cytokinesis
3. B	GO:0043266	regulation of potassium ion transport
3. B	GO:0060843	venous endothelial cell differentiation
3. B	GO:2000651	positive regulation of sodium ion transmembrane transporter activity
3. B	GO:0006528	asparagine metabolic process
3. B	GO:0032496	response to lipopolysaccharide
3. B	GO:0014065	phosphatidylinositol 3-kinase signaling
3. B	GO:0140031	phosphorylation-dependent protein binding
3. B	GO:0001934	positive regulation of protein phosphorylation
3. B	GO:0051306	mitotic sister chromatid separation
3. B	GO:0003207	cardiac chamber formation
3. B	GO:0061384	heart trabecula morphogenesis
3. B	GO:0048060	negative gravitaxis
3. B	GO:0072015	glomerular visceral epithelial cell development
3. B	GO:2000304	positive regulation of ceramide biosynthetic process
3. B	GO:0019208	phosphatase regulator activity
3. B	GO:0030315	T-tubule
3. B	GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process
3. B	GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
3. B	GO:0003209	cardiac atrium morphogenesis
3. B	GO:1905936	regulation of germ cell proliferation
3. B	GO:0090263	positive regulation of canonical Wnt signaling pathway
3. B	GO:1903670	regulation of sprouting angiogenesis
3. B	GO:0021531	spinal cord radial glial cell differentiation
3. B	GO:0010888	negative regulation of lipid storage
3. B	GO:0035308	negative regulation of protein dephosphorylation
3. B	GO:0010761	fibroblast migration
3. B	GO:0005262	calcium channel activity
3. B	GO:0017020	myosin phosphatase regulator activity
3. B	GO:0102545	phosphatidyl phospholipase B activity
3. B	GO:0097062	dendritic spine maintenance
3. B	GO:0031901	early endosome membrane
3. B	GO:0031672	A band
3. B	GO:0003213	cardiac right atrium morphogenesis
3. B	GO:0050793	regulation of developmental process
3. B	GO:0098910	regulation of atrial cardiac muscle cell action potential
3. B	GO:0043194	axon initial segment
3. B	GO:0009912	auditory receptor cell fate commitment
3. B	GO:0030941	chloroplast targeting sequence binding
3. B	GO:0099527	postsynapse to nucleus signaling pathway
3. B	GO:0046849	bone remodeling
3. B	GO:2000249	regulation of actin cytoskeleton reorganization
3. B	GO:0016279	protein-lysine N-methyltransferase activity
3. B	GO:0043066	negative regulation of apoptotic process
3. B	GO:0007165	signal transduction
3. B	GO:1904355	positive regulation of telomere capping
3. B	GO:0010745	negative regulation of macrophage derived foam cell differentiation
3. B	GO:0033270	paranode region of axon
3. B	GO:0045184	establishment of protein localization
3. B	GO:0031466	Cul5-RING ubiquitin ligase complex
3. B	GO:1901223	negative regulation of NIK/NF-kappaB signaling
3. B	GO:0097543	ciliary inversin compartment
3. B	GO:0017124	SH3 domain binding
3. B	GO:0003847	1-alkyl-2-acetylglycerophosphocholine esterase activity
3. B	GO:0016020	membrane
3. B	GO:0046822	regulation of nucleocytoplasmic transport
3. B	GO:0003219	cardiac right ventricle formation
3. B	GO:0001658	branching involved in ureteric bud morphogenesis
3. B	GO:0017171	serine hydrolase activity
3. B	GO:0072144	glomerular mesangial cell development
3. B	GO:0060956	endocardial cell differentiation
3. B	GO:1902230	negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage
3. B	GO:0042383	sarcolemma
3. B	GO:1901189	positive regulation of ephrin receptor signaling pathway
3. B	GO:0070427	nucleotide-binding oligomerization domain containing 1 signaling pathway
3. B	GO:0030030	cell projection organization
3. B	GO:0050931	pigment cell differentiation
3. B	GO:0060038	cardiac muscle cell proliferation
3. B	GO:0030029	actin filament-based process
3. B	GO:0032212	positive regulation of telomere maintenance via telomerase
3. B	GO:0002040	sprouting angiogenesis
3. B	GO:0007569	cell aging
3. B	GO:0061001	regulation of dendritic spine morphogenesis
3. B	GO:0060236	regulation of mitotic spindle organization
3. B	GO:2000279	negative regulation of DNA biosynthetic process
3. B	GO:0051966	regulation of synaptic transmission, glutamatergic
3. B	GO:0061025	membrane fusion
3. B	GO:1990393	3M complex
3. B	GO:0045618	positive regulation of keratinocyte differentiation
3. B	GO:0003180	aortic valve morphogenesis
3. B	GO:1990705	cholangiocyte proliferation
3. B	GO:0060013	righting reflex
3. B	GO:0042246	tissue regeneration
3. B	GO:0003157	endocardium development
3. B	GO:0007229	integrin-mediated signaling pathway
3. B	GO:0090314	positive regulation of protein targeting to membrane
3. B	GO:1903343	positive regulation of meiotic DNA double-strand break formation
3. B	GO:0090029	negative regulation of pheromone-dependent signal transduction involved in conjugation with cellular fusion
3. B	GO:0046533	negative regulation of photoreceptor cell differentiation
3. B	GO:0097150	neuronal stem cell population maintenance
3. B	GO:0060045	positive regulation of cardiac muscle cell proliferation
3. B	GO:0048013	ephrin receptor signaling pathway
3. B	GO:1901019	regulation of calcium ion transmembrane transporter activity
3. B	GO:0031625	ubiquitin protein ligase binding
3. B	GO:0004067	asparaginase activity
3. B	GO:1903849	positive regulation of aorta morphogenesis
3. B	GO:0045162	clustering of voltage-gated sodium channels
3. B	GO:0060413	atrial septum morphogenesis
3. B	GO:0051865	protein autoubiquitination
3. B	GO:0050728	negative regulation of inflammatory response
3. B	GO:0003192	mitral valve formation
3. B	GO:0043065	positive regulation of apoptotic process
3. B	GO:0030027	lamellipodium
3. B	GO:0008139	nuclear localization sequence binding
3. B	GO:0033268	node of Ranvier
3. B	GO:0090200	positive regulation of release of cytochrome c from mitochondria
3. B	GO:0003264	regulation of cardioblast proliferation
3. B	GO:0043596	nuclear replication fork
3. B	GO:1903527	positive regulation of membrane tubulation
3. B	GO:0061314	Notch signaling involved in heart development
3. B	GO:0071709	membrane assembly
3. B	GO:0045921	positive regulation of exocytosis
3. B	GO:1990756	ubiquitin ligase-substrate adaptor activity
3. B	GO:0060992	response to fungicide
3. B	GO:2000463	positive regulation of excitatory postsynaptic potential
3. B	GO:0016290	palmitoyl-CoA hydrolase activity
3. B	GO:0014732	skeletal muscle atrophy
3. B	GO:0030673	axolemma
3. B	GO:0019899	enzyme binding
3. B	GO:1902647	negative regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate biosynthetic process
3. B	GO:0060361	flight
3. B	GO:0099173	postsynapse organization
3. B	GO:0034587	piRNA metabolic process
3. B	GO:0004857	enzyme inhibitor activity
3. B	GO:2000974	negative regulation of pro-B cell differentiation
3. B	GO:0060997	dendritic spine morphogenesis
3. B	GO:0048845	venous blood vessel morphogenesis
3. B	GO:1901018	positive regulation of potassium ion transmembrane transporter activity
3. B	GO:0004143	diacylglycerol kinase activity
3. B	GO:0050714	positive regulation of protein secretion
3. B	GO:0060135	maternal process involved in female pregnancy
3. B	GO:0031663	lipopolysaccharide-mediated signaling pathway
3. B	GO:2000311	regulation of AMPA receptor activity
3. B	GO:0086066	atrial cardiac muscle cell to AV node cell communication
3. B	GO:1901021	positive regulation of calcium ion transmembrane transporter activity
3. B	GO:1901224	positive regulation of NIK/NF-kappaB signaling
3. B	GO:0060253	negative regulation of glial cell proliferation
3. B	GO:0005925	focal adhesion
3. B	GO:0060271	cilium assembly
3. B	GO:0006621	protein retention in ER lumen
3. B	GO:0033256	I-kappaB/NF-kappaB complex
3. B	GO:0014031	mesenchymal cell development
3. B	GO:0051151	negative regulation of smooth muscle cell differentiation
3. B	GO:0032991	protein-containing complex
3. B	GO:0005829	cytosol
3. B	GO:0046872	metal ion binding
3. B	GO:0035544	negative regulation of SNARE complex assembly
3. B	GO:0035508	positive regulation of myosin-light-chain-phosphatase activity
3. B	GO:0007528	neuromuscular junction development
3. B	GO:0000139	Golgi membrane
3. B	GO:0035556	intracellular signal transduction
3. B	GO:0042326	negative regulation of phosphorylation
3. B	GO:0019706	protein-cysteine S-palmitoyltransferase activity
3. B	GO:0003273	cell migration involved in endocardial cushion formation
3. B	GO:0048916	posterior lateral line development
3. B	GO:0070168	negative regulation of biomineral tissue development
3. B	GO:0044354	macropinosome
3. B	GO:0035507	regulation of myosin-light-chain-phosphatase activity
3. B	GO:0009877	nodulation
3. B	GO:1904357	negative regulation of telomere maintenance via telomere lengthening
3. B	GO:0061344	regulation of cell adhesion involved in heart morphogenesis
3. B	GO:0032088	negative regulation of NF-kappaB transcription factor activity

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	Q7ZT11	Ankyrin repeat domain-containing protein 1	6.71e-04	1.24e-02	9.42e-07
1. PB	Q9GZV1	Ankyrin repeat domain-containing protein 2	1.69e-03	3.39e-03	1.37e-05
1. PB	Q4V8X4	Acyl-CoA-binding domain-containing protein 6	7.94e-04	1.58e-02	8.92e-04
1. PB	Q9BZ19	Ankyrin repeat domain-containing protein 60	0	3.42e-127	0.0
2. P	O14562	Ubiquitin domain-containing protein UBFD1	4.09e-03	2.27e-03	NA
2. P	O00221	NF-kappa-B inhibitor epsilon	2.23e-03	3.84e-11	NA
2. P	Q78JW9	Ubiquitin domain-containing protein UBFD1	3.02e-03	6.38e-04	NA
3. B	Q8N9V6	Ankyrin repeat domain-containing protein 53	2.61e-03	NA	8.14e-08
3. B	Q8VHS6	Ankyrin repeat and SOCS box protein 15	4.97e-03	NA	2.01e-06
3. B	Q1RGM2	Putative ankyrin repeat protein RBE_1411	2.35e-05	NA	5.09e-04
3. B	Q54KA7	Ankyrin repeat, PH and SEC7 domain containing protein secG	6.38e-02	NA	3.23e-06
3. B	Q0V8G2	GA-binding protein subunit beta-2	3.16e-03	NA	2.14e-05
3. B	O14974	Protein phosphatase 1 regulatory subunit 12A	1.36e-01	NA	0.002
3. B	Q99NH0	Ankyrin repeat domain-containing protein 17	4.05e-01	NA	2.98e-05
3. B	Q7ZYD9	Ankyrin repeat domain-containing protein 13C-B	3.31e-02	NA	0.015
3. B	Q2QL84	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	3.04e-03	NA	0.040
3. B	A9JR78	Tonsoku-like protein	4.40e-01	NA	8.20e-05
3. B	P57078	Receptor-interacting serine/threonine-protein kinase 4	1.26e-02	NA	2.35e-04
3. B	Q9Y575	Ankyrin repeat and SOCS box protein 3	5.76e-03	NA	4.15e-05
3. B	Q1LZC5	Ankyrin repeat domain-containing protein 54	6.38e-05	NA	3.93e-07
3. B	P0C6P7	Protein fem-1 homolog B	1.85e-02	NA	0.002
3. B	Q8CEF1	Protein fem-1 homolog C	8.86e-03	NA	0.010
3. B	Q4FE45	E3 ubiquitin-protein ligase XBAT33	2.48e-03	NA	8.30e-04
3. B	D3J162	Protein VAPYRIN	1.51e-02	NA	1.34e-06
3. B	Q0P5B9	Ankyrin repeat domain-containing protein 39	5.74e-04	NA	3.46e-08
3. B	Q06527	Ankyrin homolog	1.25e-03	NA	7.04e-04
3. B	Q8N7Z5	Ankyrin repeat domain-containing protein 31	3.29e-01	NA	0.001
3. B	Q566C8	Ankyrin repeat domain-containing protein 54	8.08e-05	NA	2.04e-06
3. B	P14585	Protein lin-12	1.76e-01	NA	4.28e-04
3. B	Q96T49	Protein phosphatase 1 regulatory inhibitor subunit 16B	1.82e-03	NA	2.73e-05
3. B	Q9M1I7	Regulatory protein NPR6	1.74e-02	NA	0.034
3. B	O14593	DNA-binding protein RFXANK	1.64e-05	NA	4.10e-04
3. B	Q8LSQ2	Probable signal recognition particle 43 kDa protein, chloroplastic	2.36e-03	NA	0.002
3. B	Q8K4M9	Oxysterol-binding protein-related protein 1	4.99e-02	NA	5.68e-06
3. B	Q07E41	Cortactin-binding protein 2	1.95e-01	NA	7.65e-05
3. B	Q00PJ3	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.20e-02	NA	0.020
3. B	Q9Y576	Ankyrin repeat and SOCS box protein 1	4.93e-03	NA	0.036
3. B	Q9Z2X2	26S proteasome non-ATPase regulatory subunit 10	1.04e-04	NA	1.09e-05
3. B	Q95N27	Protein phosphatase 1 regulatory inhibitor subunit 16B	7.87e-03	NA	2.15e-05
3. B	P97819	85/88 kDa calcium-independent phospholipase A2	4.39e-02	NA	3.71e-07
3. B	Q8N6S4	Ankyrin repeat domain-containing protein 13C	2.09e-02	NA	0.014
3. B	Q9WV06	Ankyrin repeat domain-containing protein 2	1.81e-04	NA	0.002
3. B	Q02357	Ankyrin-1	2.99e-01	NA	5.94e-13
3. B	O44997	Death-associated protein kinase dapk-1	9.88e-02	NA	0.002
3. B	Q5FVC7	Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2	9.69e-03	NA	3.71e-05
3. B	Q2QLC6	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	2.61e-02	NA	0.023
3. B	Q8N8A2	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B	3.19e-02	NA	7.88e-06
3. B	Q9NU02	Ankyrin repeat and EF-hand domain-containing protein 1	1.10e-02	NA	8.09e-04
3. B	Q29RM5	Protein fem-1 homolog A	1.87e-02	NA	5.38e-04
3. B	Q5ZK62	Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2	3.78e-03	NA	1.19e-04
3. B	Q5TYM7	CARD- and ANK-domain containing inflammasome adapter protein	2.49e-02	NA	2.65e-05
3. B	Q5U312	Ankycorbin	1.14e-02	NA	3.99e-05
3. B	Q65XV2	E3 ubiquitin-protein ligase XB3	1.74e-03	NA	1.08e-04
3. B	Q21920	Ankyrin repeat and KH domain-containing protein mask-1	7.36e-01	NA	0.013
3. B	Q5R6D7	Ankyrin repeat and SOCS box protein 8	5.97e-04	NA	0.006
3. B	A1ZBY1	Protein fem-1 homolog B	6.99e-03	NA	3.85e-04
3. B	Q08353	NF-kappa-B inhibitor alpha	1.05e-03	NA	0.009
3. B	Q4JHE0	Probable E3 ubiquitin-protein ligase XBOS36	8.40e-04	NA	0.006
3. B	A6QL64	Ankyrin repeat domain-containing protein 36A	2.58e-01	NA	0.029
3. B	Q9VUX2	E3 ubiquitin-protein ligase mind-bomb	4.66e-01	NA	3.87e-04
3. B	Q2HW56	BTB/POZ domain and ankyrin repeat-containing protein NOOT1	2.56e-02	NA	0.001
3. B	P53356	Tyrosine-protein kinase HTK16	2.19e-02	NA	0.002
3. B	Q7T0Q1	Myotrophin	1.00e-08	NA	0.004
3. B	Q6NRD0	Ankyrin repeat domain-containing protein 13C-A	2.10e-02	NA	0.015
3. B	Q6P6B7	Ankyrin repeat domain-containing protein 16	5.49e-04	NA	0.047
3. B	A2AQH4	BCL-6 corepressor-like protein 1	1.88e-01	NA	0.042
3. B	O70511	Ankyrin-3	5.96e-01	NA	4.50e-08
3. B	Q90623	Protein phosphatase 1 regulatory subunit 12A	1.38e-01	NA	0.001
3. B	Q3U0D9	E3 ubiquitin-protein ligase HACE1	2.20e-02	NA	0.006
3. B	G8GTN7	BTB/POZ domain and ankyrin repeat-containing protein COCH	1.41e-02	NA	0.001
3. B	Q5R8C8	Ankyrin repeat domain-containing protein 46	9.51e-06	NA	0.028
3. B	Q9Z2X3	26S proteasome non-ATPase regulatory subunit 10	1.04e-04	NA	1.00e-04
3. B	Q7Z8U2	Palmitoyltransferase akr1	1.81e-02	NA	0.002
3. B	Q7T163	Kinase D-interacting substrate of 220 kDa B	2.35e-01	NA	7.18e-06
3. B	Q68DC2	Ankyrin repeat and SAM domain-containing protein 6	7.59e-02	NA	0.004
3. B	A1X154	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	3.65e-03	NA	0.003
3. B	Q7XUW4	Potassium channel KOR2	2.08e-02	NA	0.006
3. B	Q15057	Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2	3.88e-03	NA	3.43e-05
3. B	Q1RMI3	GA-binding protein subunit beta-1	2.24e-05	NA	6.47e-07
3. B	Q9WV48	SH3 and multiple ankyrin repeat domains protein 1	1.21e-01	NA	0.002
3. B	Q8N2N9	Ankyrin repeat domain-containing protein 36B	5.79e-02	NA	0.001
3. B	D3J163	Protein VAPYRIN-LIKE	1.99e-03	NA	7.33e-04
3. B	Q28C34	Ankyrin repeat domain-containing protein 13C	5.57e-03	NA	0.014
3. B	Q10311	Ankyrin repeat-containing protein C6C3.08	6.24e-04	NA	0.006
3. B	Q07DW4	Cortactin-binding protein 2	1.59e-01	NA	9.50e-05
3. B	A2A690	Protein TANC2	4.32e-01	NA	1.93e-04
3. B	Q6KAE5	Probable E3 ubiquitin-protein ligase XBOS32	1.02e-02	NA	1.62e-06
3. B	Q4R3S3	Ankyrin repeat domain-containing protein 7	1.76e-04	NA	0.032
3. B	Q38898	Potassium channel AKT2/3	2.05e-02	NA	6.00e-06
3. B	Q7T3P8	Protein fem-1 homolog C	9.15e-03	NA	5.14e-05
3. B	P17221	Sex-determining protein fem-1	1.10e-02	NA	0.013
3. B	Q8WXK4	Ankyrin repeat and SOCS box protein 12	1.95e-03	NA	0.002
3. B	A7MB89	Protein fem-1 homolog C	8.79e-03	NA	0.010
3. B	Q9D2J7	Ankyrin repeat and EF-hand domain-containing protein 1	1.03e-02	NA	4.83e-05
3. B	Q9D119	Protein phosphatase 1 regulatory subunit 27	3.44e-05	NA	0.002
3. B	Q9H2K2	Poly [ADP-ribose] polymerase tankyrase-2	5.76e-02	NA	1.74e-06
3. B	Q9D061	Acyl-CoA-binding domain-containing protein 6	8.28e-04	NA	0.002
3. B	Q06547	GA-binding protein subunit beta-1	1.68e-05	NA	7.14e-07
3. B	Q91ZT7	Ankyrin repeat and SOCS box protein 10	3.42e-03	NA	3.60e-05
3. B	A6NHY2	Ankyrin repeat and death domain-containing protein 1B	7.92e-03	NA	0.004
3. B	P55273	Cyclin-dependent kinase 4 inhibitor D	2.57e-05	NA	0.002
3. B	Q5RCK5	Ankyrin repeat and SOCS box protein 7	3.77e-03	NA	0.002
3. B	Q8UVC1	Inversin	3.90e-02	NA	0.001
3. B	Q2IBD4	Cortactin-binding protein 2	1.44e-01	NA	1.79e-06
3. B	P46530	Neurogenic locus notch homolog protein 1	5.42e-01	NA	1.77e-04
3. B	Q6ZVZ8	Ankyrin repeat and SOCS box protein 18	7.30e-03	NA	0.007
3. B	Q6TGW5	Osteoclast-stimulating factor 1	1.14e-03	NA	3.13e-04
3. B	Q2IBE3	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	3.55e-03	NA	0.025
3. B	Q63618	Espin	3.89e-02	NA	1.14e-05
3. B	B9EJA2	Cortactin-binding protein 2	2.63e-01	NA	1.46e-06
3. B	Q8MJ50	Osteoclast-stimulating factor 1	1.99e-04	NA	0.002
3. B	Q8CGB3	Uveal autoantigen with coiled-coil domains and ankyrin repeats	1.02e-01	NA	0.001
3. B	Q3UES3	Poly [ADP-ribose] polymerase tankyrase-2	1.13e-01	NA	7.20e-07
3. B	Q91ZT9	Ankyrin repeat and SOCS box protein 8	2.74e-04	NA	0.003
3. B	Q9Y2G4	Ankyrin repeat domain-containing protein 6	1.54e-02	NA	0.004
3. B	F1LTE0	Protein TANC2	4.14e-01	NA	1.68e-04
3. B	B1AK53	Espin	3.30e-02	NA	3.87e-05
3. B	Q9ERC1	Unconventional myosin-XVI	4.21e-01	NA	0.001
3. B	Q9P2R3	Rabankyrin-5	8.27e-02	NA	0.001
3. B	Q8BZ25	Ankyrin repeat and protein kinase domain-containing protein 1	2.08e-02	NA	8.32e-07
3. B	Q8UVC3	Inversin	1.04e-01	NA	0.008
3. B	Q9SCX5	Probable potassium channel AKT5	6.24e-02	NA	2.38e-05
3. B	Q05823	2-5A-dependent ribonuclease	2.65e-02	NA	5.68e-04
3. B	P57044	Integrin-linked protein kinase	5.75e-05	NA	0.017
3. B	Q8ZWC4	Putative ankyrin repeat protein PAE1861	8.08e-05	NA	1.80e-04
3. B	Q91XL9	Oxysterol-binding protein-related protein 1	5.81e-02	NA	1.53e-04
3. B	Q75HP9	Potassium channel AKT2	2.01e-02	NA	0.004
3. B	Q4X251	Palmitoyltransferase akr1	1.31e-02	NA	0.007
3. B	Q8WMX7	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.85e-02	NA	0.027
3. B	Q2QXZ2	BTB/POZ domain and ankyrin repeat-containing protein NH5.2	4.89e-02	NA	0.002
3. B	Q96BM1	Ankyrin repeat domain-containing protein 9	1.98e-03	NA	0.005
3. B	Q08E43	Ankyrin repeat and SOCS box protein 8	4.01e-04	NA	0.003
3. B	Q8VBX0	Ankyrin repeat and SOCS box protein 13	1.76e-03	NA	0.002
3. B	Q9BXW6	Oxysterol-binding protein-related protein 1	5.73e-02	NA	4.03e-06
3. B	Q9Z205	DNA-binding protein RFXANK	3.06e-05	NA	0.008
3. B	Q5ZLC8	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C	8.97e-02	NA	2.26e-07
3. B	Q01484	Ankyrin-2	NA	NA	7.43e-09
3. B	Q9UK73	Protein fem-1 homolog B	1.56e-02	NA	0.002
3. B	Q9WV71	Ankyrin repeat and SOCS box protein 4	6.09e-03	NA	1.15e-04
3. B	F8W2M1	E3 ubiquitin-protein ligase HACE1	3.90e-02	NA	0.017
3. B	Q2QLH1	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.54e-02	NA	0.036
3. B	Q4R739	Ankyrin repeat domain-containing protein 53	4.30e-04	NA	5.47e-08
3. B	Q9DBR7	Protein phosphatase 1 regulatory subunit 12A	1.40e-01	NA	0.002
3. B	Q9Y283	Inversin	7.13e-02	NA	0.049
3. B	Q495B1	Ankyrin repeat and death domain-containing protein 1A	4.27e-04	NA	0.011
3. B	Q9M8S6	Potassium channel SKOR	2.85e-02	NA	0.012
3. B	Q9ULH0	Kinase D-interacting substrate of 220 kDa	3.14e-01	NA	1.31e-06
3. B	G3I6Z6	Neurogenic locus notch homolog protein 1	NA	NA	4.96e-04
3. B	Q9BGT9	Ankyrin repeat and SOCS box protein 7	5.58e-04	NA	0.002
3. B	O70445	BRCA1-associated RING domain protein 1	1.12e-02	NA	2.30e-04
3. B	Q4UKJ3	Putative ankyrin repeat protein RF_1087	1.88e-08	NA	0.006
3. B	Q3U0L2	Ankyrin repeat domain-containing protein 33B	4.65e-03	NA	0.002
3. B	Q09YK6	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	3.61e-03	NA	0.010
3. B	Q9WV72	Ankyrin repeat and SOCS box protein 3	6.19e-03	NA	9.57e-05
3. B	Q86SG2	Ankyrin repeat domain-containing protein 23	3.77e-04	NA	9.85e-05
3. B	Q91WK7	Ankyrin repeat domain-containing protein 54	3.33e-05	NA	2.17e-06
3. B	Q80SY4	E3 ubiquitin-protein ligase MIB1	9.59e-02	NA	0.004
3. B	Q876L5	Palmitoyltransferase AKR1	6.20e-02	NA	0.025
3. B	Q4I8B6	Palmitoyltransferase AKR1	1.04e-02	NA	0.003
3. B	P16157	Ankyrin-1	3.08e-01	NA	8.23e-13
3. B	O88202	60 kDa lysophospholipase	1.70e-02	NA	0.010
3. B	Q502M6	Ankyrin repeat domain-containing protein 29	6.68e-04	NA	1.36e-06
3. B	Q337A0	Probable E3 ubiquitin-protein ligase XBOS33	7.35e-04	NA	5.81e-05
3. B	Q96I34	Protein phosphatase 1 regulatory subunit 16A	6.21e-03	NA	1.55e-04
3. B	A0A072VIM5	BTB/POZ domain and ankyrin repeat-containing protein NOOT2	2.28e-02	NA	0.015
3. B	Q0VGY8	Protein TANC1	1.25e-01	NA	8.37e-05
3. B	P0C0T2	Ankyrin repeat and SAM domain-containing protein 6	2.30e-02	NA	0.003
3. B	O95271	Poly [ADP-ribose] polymerase tankyrase-1	6.48e-02	NA	9.22e-06
3. B	Q9P2G1	Ankyrin repeat and IBR domain-containing protein 1	1.23e-01	NA	0.041
3. B	G0LXV8	Alpha-latrotoxin-Lh1a (Fragment)	1.54e-01	NA	1.15e-04
3. B	Q8WWX0	Ankyrin repeat and SOCS box protein 5	2.27e-03	NA	0.005
3. B	Q15027	Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1	1.42e-02	NA	6.09e-04
3. B	Q9Y566	SH3 and multiple ankyrin repeat domains protein 1	1.16e-01	NA	0.003
3. B	Q653P0	Potassium channel KOR1	3.13e-02	NA	0.005
3. B	Q6PFX9	Poly [ADP-ribose] polymerase tankyrase-1	1.90e-01	NA	7.46e-06
3. B	Q9J5I3	Putative ankyrin repeat protein FPV018	NA	NA	0.002
3. B	Q94B55	Putative E3 ubiquitin-protein ligase XBAT31	5.59e-03	NA	0.003
3. B	Q6P1S6	Myotrophin	1.25e-08	NA	0.017
3. B	C7B178	Protein VAPYRIN	2.34e-03	NA	3.75e-05
3. B	Q9D1A4	Ankyrin repeat and SOCS box protein 5	2.29e-03	NA	0.015
3. B	Q29Q26	Ankyrin repeat domain-containing protein 2B	2.96e-03	NA	8.61e-08
3. B	Q8VHK2	Caskin-1	2.01e-01	NA	3.69e-04
3. B	Q71S21	Inversin-B	5.59e-02	NA	0.010
3. B	Q6DGX3	Ankyrin repeat domain-containing protein 54	7.82e-05	NA	7.69e-06
3. B	Q5JPF3	Ankyrin repeat domain-containing protein 36C	1.63e-01	NA	0.005
3. B	Q9P0K7	Ankycorbin	2.57e-02	NA	0.001
3. B	Q3V096	Ankyrin repeat domain-containing protein 42	6.14e-03	NA	3.35e-05
3. B	A0A3L7I2I8	85/88 kDa calcium-independent phospholipase A2	3.88e-02	NA	4.82e-06
3. B	Q5RFS1	Ankyrin repeat and SOCS box protein 11	3.02e-04	NA	0.006
3. B	Q5DU14	Unconventional myosin-XVI	5.82e-01	NA	6.31e-04
3. B	Q923M0	Protein phosphatase 1 regulatory subunit 16A	1.99e-02	NA	7.40e-04
3. B	Q5UQY4	Putative ankyrin repeat protein R886 (Fragment)	NA	NA	0.013
3. B	Q8N9B4	Ankyrin repeat domain-containing protein 42	2.05e-03	NA	5.23e-05
3. B	G5EDE9	ANK repeat-containing protein nipk-1	5.50e-03	NA	0.002
3. B	Q07E28	Cortactin-binding protein 2	1.46e-01	NA	1.61e-06
3. B	Q8WXK3	Ankyrin repeat and SOCS box protein 13	1.60e-03	NA	0.001
3. B	Q5GIG6	Serine/threonine-protein kinase TNNI3K	5.34e-02	NA	2.55e-05
3. B	Q92625	Ankyrin repeat and SAM domain-containing protein 1A	1.18e-01	NA	0.013
3. B	Q09YI3	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.69e-03	NA	0.006
3. B	A0M8T5	Cortactin-binding protein 2	2.68e-01	NA	1.64e-06
3. B	Q5ZM55	Protein fem-1 homolog B	1.80e-02	NA	0.002
3. B	Q2KI79	Ankyrin repeat family A protein 2	1.92e-03	NA	0.008
3. B	Q6UB98	Ankyrin repeat domain-containing protein 12	2.49e-01	NA	1.10e-05
3. B	Q07E15	Cortactin-binding protein 2	2.14e-01	NA	1.21e-05
3. B	A6QPE7	Ankyrin repeat domain-containing protein 65	4.96e-03	NA	5.20e-06
3. B	Q9XZC0	Alpha-latrocrustotoxin-Lt1a (Fragment)	1.58e-01	NA	6.69e-05
3. B	O75912	Diacylglycerol kinase iota	4.65e-02	NA	0.003
3. B	Q94A76	Potassium channel GORK	2.61e-02	NA	1.33e-04
3. B	Q8Q0U0	Putative ankyrin repeat protein MM_0045	1.69e-03	NA	6.05e-05
3. B	Q7EZ44	Probable E3 ubiquitin-protein ligase XBOS35	5.42e-03	NA	8.39e-04
3. B	O35516	Neurogenic locus notch homolog protein 2	5.91e-01	NA	3.35e-06
3. B	A6NCL7	Ankyrin repeat domain-containing protein 33B	8.25e-03	NA	1.55e-04
3. B	Q755Y0	Palmitoyltransferase AKR1	3.33e-02	NA	0.040
3. B	Q6XJU9	Osteoclast-stimulating factor 1	1.30e-03	NA	4.83e-04
3. B	Q6P686	Osteoclast-stimulating factor 1	2.50e-04	NA	0.003
3. B	Q91WD2	Transient receptor potential cation channel subfamily V member 6	2.43e-02	NA	0.047
3. B	Q5M9H0	Ankyrin repeat and SAM domain-containing protein 3	1.21e-02	NA	1.43e-05
3. B	Q8VD46	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	2.80e-03	NA	0.005
3. B	A0M8S4	Cortactin-binding protein 2	1.80e-01	NA	2.58e-05
3. B	Q9Z1E3	NF-kappa-B inhibitor alpha	2.07e-03	NA	0.006
3. B	Q7Z713	Ankyrin repeat domain-containing protein 37	4.25e-07	NA	0.013
3. B	Q9TU71	Ankyrin repeat domain-containing protein 1	5.85e-04	NA	1.13e-04
3. B	E9Q4F7	Ankyrin repeat domain-containing protein 11	9.37e-01	NA	1.31e-06
3. B	Q8WWH4	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	3.10e-03	NA	0.029
3. B	Q9XSM3	Transient receptor potential cation channel subfamily V member 5	4.66e-02	NA	0.025
3. B	Q5RF15	Serine/threonine-protein kinase TNNI3K	2.05e-02	NA	3.81e-05
3. B	Q9VFD5	Protein fem-1 homolog CG6966	1.21e-02	NA	4.66e-04
3. B	Q6P9K8	Caskin-1	1.85e-01	NA	5.19e-04
3. B	Q7ZUV0	Ankyrin repeat domain-containing protein 13C	1.45e-03	NA	0.003
3. B	Q9BZL4	Protein phosphatase 1 regulatory subunit 12C	1.12e-02	NA	5.43e-05
3. B	Q2IBA2	Cortactin-binding protein 2	2.17e-01	NA	2.63e-05
3. B	Q812A3	Ankyrin repeat domain-containing protein 23	1.00e-03	NA	2.32e-08
3. B	Q3SWY2	Integrin-linked protein kinase	1.33e-04	NA	0.015
3. B	A5PMU4	Ankyrin repeat and sterile alpha motif domain-containing protein 1B	1.27e-01	NA	4.33e-04
3. B	Q92882	Osteoclast-stimulating factor 1	1.99e-04	NA	0.005
3. B	Q99LW0	Ankyrin repeat domain-containing protein 10	4.23e-04	NA	5.31e-06
3. B	Q91ZU0	Ankyrin repeat and SOCS box protein 7	9.38e-03	NA	0.002
3. B	Q6GNY1	E3 ubiquitin-protein ligase mib1	5.74e-02	NA	0.019
3. B	Q91ZT8	Ankyrin repeat and SOCS box protein 9	1.22e-03	NA	1.57e-04
3. B	Q5UPV1	Putative ankyrin repeat protein L271	NA	NA	0.003
3. B	Q5UPU4	Putative ankyrin repeat protein R267	NA	NA	0.005
3. B	Q9J5H7	Putative ankyrin repeat protein FPV024	NA	NA	0.005
3. B	Q8WXI3	Ankyrin repeat and SOCS box protein 10	6.30e-04	NA	4.90e-04
3. B	Q01705	Neurogenic locus notch homolog protein 1	7.89e-01	NA	4.62e-04
3. B	Q9Z2G1	Protein fem-1 homolog A-A	1.08e-02	NA	0.002
3. B	P0C550	Potassium channel AKT1	9.83e-02	NA	0.002
3. B	Q5UQI7	Putative ankyrin repeat protein R838	NA	NA	0.043
3. B	Q8WXK1	Ankyrin repeat and SOCS box protein 15	2.16e-02	NA	9.23e-08
3. B	Q2IBF8	Cortactin-binding protein 2	1.86e-01	NA	4.44e-05
3. B	Q2T9K6	Protein fem-1 homolog C	8.68e-03	NA	1.78e-04
3. B	Q9ULJ7	Ankyrin repeat domain-containing protein 50	1.75e-01	NA	3.91e-08
3. B	P0C927	Ankyrin repeat and SOCS box protein 14	3.07e-03	NA	1.24e-05
3. B	Q07DX6	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	3.47e-03	NA	0.028
3. B	Q8VHK1	Caskin-2	1.03e-01	NA	0.001
3. B	Q8K2H4	Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1	2.06e-02	NA	4.03e-04
3. B	A5PK26	Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1	6.43e-03	NA	0.002
3. B	Q9Y6X6	Unconventional myosin-XVI	3.33e-01	NA	0.045
3. B	P46531	Neurogenic locus notch homolog protein 1	5.68e-01	NA	0.001
3. B	Q2IBE6	Cortactin-binding protein 2	2.19e-01	NA	1.12e-05
3. B	Q3ZBX7	Ankyrin repeat domain-containing protein 1	4.20e-04	NA	5.39e-06
3. B	Q4V869	Acyl-CoA-binding domain-containing protein 6	3.59e-03	NA	0.004
3. B	Q09YG9	Cortactin-binding protein 2	2.10e-01	NA	8.55e-06
3. B	Q8HXA6	Ankyrin repeat and SOCS box protein 15	8.85e-03	NA	4.13e-06
3. B	Q0P5G1	Tonsoku-like protein	3.00e-01	NA	0.002
3. B	Q96NS5	Ankyrin repeat and SOCS box protein 16	1.41e-03	NA	0.004
3. B	P0C6S7	Ankyrin repeat and sterile alpha motif domain-containing protein 1B	9.81e-02	NA	2.28e-04
3. B	Q1RJ94	Putative ankyrin repeat protein RBE_0489	5.65e-04	NA	0.001
3. B	Q5U464	Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3	1.97e-01	NA	0.005
3. B	Q96JP0	Protein fem-1 homolog C	8.85e-03	NA	0.010
3. B	D3YWQ0	Diacylglycerol kinase iota	4.12e-02	NA	0.002
3. B	F1N6G5	E3 ubiquitin-protein ligase HACE1	2.68e-02	NA	0.007
3. B	Q865U8	Ankyrin repeat domain-containing protein 1	5.81e-04	NA	3.18e-05
3. B	Q8NFD2	Ankyrin repeat and protein kinase domain-containing protein 1	7.47e-03	NA	6.61e-05
3. B	Q9DF58	Integrin-linked protein kinase	6.11e-04	NA	0.005
3. B	Q3SZE4	Ankyrin repeat and SOCS box protein 11	1.09e-03	NA	0.013
3. B	O60237	Protein phosphatase 1 regulatory subunit 12B	6.27e-02	NA	1.64e-04
3. B	Q6NZL6	Tonsoku-like protein	4.39e-01	NA	0.041
3. B	Q569N2	Ankyrin repeat domain-containing protein 37	1.17e-05	NA	0.049
3. B	Q8WVL7	Ankyrin repeat domain-containing protein 49	4.15e-04	NA	1.92e-07
3. B	Q3UX43	Ankyrin repeat domain-containing protein 13C	9.62e-02	NA	0.015
3. B	A2VDR2	Acyl-CoA-binding domain-containing protein 6	2.77e-04	NA	0.008
3. B	Q95RG8	ARF GTPase-activating protein Git	1.24e-02	NA	0.003
3. B	Q00PJ1	Cortactin-binding protein 2	3.32e-01	NA	4.03e-05
3. B	Q54BA2	Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800	1.90e-02	NA	9.98e-08
3. B	Q9VCA8	Ankyrin repeat and KH domain-containing protein mask	NA	NA	2.25e-07
3. B	F1MJR8	Inactive serine/threonine-protein kinase TEX14	6.23e-02	NA	0.034
3. B	Q25338	Delta-latroinsectotoxin-Lt1a	2.36e-02	NA	3.03e-06
3. B	Q15327	Ankyrin repeat domain-containing protein 1	5.96e-04	NA	3.04e-05
3. B	Q5EA33	Ankyrin repeat domain-containing protein 49	6.88e-05	NA	1.54e-08
3. B	Q86YT6	E3 ubiquitin-protein ligase MIB1	5.71e-02	NA	0.004
3. B	Q94CT7	Probable E3 ubiquitin-protein ligase XBOS31	1.38e-03	NA	0.027
3. B	Q66JD7	Acyl-CoA-binding domain-containing protein 6	1.29e-03	NA	0.001
3. B	Q53RE8	Ankyrin repeat domain-containing protein 39	5.12e-05	NA	1.20e-06
3. B	Q54HW1	26S proteasome non-ATPase regulatory subunit 10	6.67e-05	NA	1.79e-06
3. B	Q69ZU8	Ankyrin repeat domain-containing protein 6	8.19e-03	NA	0.004
3. B	Q8WMX8	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.04e-02	NA	0.006
3. B	Q0JKV1	Potassium channel AKT1	1.26e-01	NA	0.002
3. B	F1MAB7	Diacylglycerol kinase iota	1.48e-02	NA	0.007
3. B	Q60773	Cyclin-dependent kinase 4 inhibitor D	7.43e-05	NA	0.001
3. B	Q2IBB2	Cortactin-binding protein 2	2.39e-01	NA	1.50e-04
3. B	Q9EQG6	Kinase D-interacting substrate of 220 kDa	2.89e-01	NA	0.002
3. B	Q5ZLC6	Ankyrin repeat domain-containing protein 10	1.33e-03	NA	2.63e-05
3. B	Q6ZPS6	Ankyrin repeat and IBR domain-containing protein 1	9.86e-02	NA	0.031
3. B	Q4KL97	Ankyrin repeat domain-containing protein 1	5.51e-04	NA	8.53e-04
3. B	O43150	Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2	2.29e-01	NA	0.001
3. B	P14368	Putative ankyrin repeat protein FPV234	NA	NA	0.035
3. B	Q2QLG9	Cortactin-binding protein 2	5.43e-01	NA	1.80e-05
3. B	Q9J5A7	Putative ankyrin repeat protein FPV115	NA	NA	2.34e-04
3. B	Q4R544	Ankyrin repeat and SOCS box protein 8	4.01e-04	NA	0.007
3. B	Q5ZJJ9	Osteoclast-stimulating factor 1	1.16e-04	NA	0.013
3. B	Q9J4Z6	Putative ankyrin repeat protein FPV244	NA	NA	0.032
3. B	Q60772	Cyclin-dependent kinase 4 inhibitor C	1.84e-05	NA	0.002
3. B	Q9UVH3	Palmitoyltransferase AKR1 (Fragment)	1.12e-03	NA	6.52e-06
3. B	Q07E17	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	2.36e-02	NA	0.004
3. B	A0JP26	POTE ankyrin domain family member B3	1.80e-03	NA	0.045
3. B	Q09YJ5	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.07e-02	NA	0.007
3. B	Q8WMX6	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	2.97e-03	NA	0.031
3. B	P77736	Putative ankyrin repeat protein YahD	1.41e-05	NA	0.021
3. B	Q5F478	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B	1.60e-02	NA	1.82e-05
3. B	Q8K3X6	Ankyrin repeat and SAM domain-containing protein 4B	3.02e-05	NA	0.022
3. B	Q62422	Osteoclast-stimulating factor 1	4.90e-04	NA	0.003
3. B	Q7TQP6	Serine/threonine-protein kinase TNNI3K	6.44e-02	NA	1.00e-04
3. B	P0CS67	Palmitoyltransferase AKR1	2.34e-02	NA	3.85e-05
3. B	Q9XXH8	Arf-GAP with ANK repeat and PH domain-containing protein cnt-1	5.81e-02	NA	0.001
3. B	Q9Z2G0	Protein fem-1 homolog B	1.55e-02	NA	0.002
3. B	Q9J519	Putative ankyrin repeat protein FPV216	NA	NA	0.010
3. B	G5E8K5	Ankyrin-3	2.92e-01	NA	2.01e-08
3. B	Q8K0L0	Ankyrin repeat and SOCS box protein 2	1.29e-02	NA	0.017
3. B	V6CLA2	E3 ubiquitin-protein ligase hecd-1	7.27e-01	NA	0.018
3. B	P21783	Neurogenic locus notch homolog protein 1	7.54e-01	NA	0.019
3. B	A0A0A6YYL3	POTE ankyrin domain family member B	1.57e-03	NA	0.040
3. B	Q9Z272	ARF GTPase-activating protein GIT1	2.81e-02	NA	0.049
3. B	Q96HA7	Tonsoku-like protein	6.81e-01	NA	0.037
3. B	Q9H765	Ankyrin repeat and SOCS box protein 8	2.75e-04	NA	0.007
3. B	Q3KP44	Ankyrin repeat domain-containing protein 55	5.11e-03	NA	0.016
3. B	Q63746	NF-kappa-B inhibitor alpha	7.90e-04	NA	0.005
3. B	Q10728	Protein phosphatase 1 regulatory subunit 12A	1.34e-01	NA	0.002
3. B	Q9R186	Transient receptor potential cation channel subfamily V member 6	3.06e-02	NA	0.048
3. B	Q07DV1	Cortactin-binding protein 2	4.04e-01	NA	3.54e-05
3. B	Q9W0T5	Transient receptor potential channel pyrexia	3.00e-02	NA	0.003
3. B	Q5W7F2	ADP-ribosylation factor GTPase-activating protein AGD3	2.32e-01	NA	0.036
3. B	Q9FNP4	Phytochrome-interacting ankyrin-repeat protein 2	3.93e-05	NA	7.01e-04
3. B	Q9STP8	Acyl-CoA-binding domain-containing protein 2	9.86e-04	NA	0.014
3. B	Q9QWY8	Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1	1.71e-01	NA	0.041
3. B	Q07DX4	Cortactin-binding protein 2	1.86e-01	NA	9.09e-06
3. B	Q9CR42	Ankyrin repeat domain-containing protein 1	6.90e-04	NA	3.05e-04
3. B	A6NK59	Ankyrin repeat and SOCS box protein 14	2.14e-02	NA	6.59e-04
3. B	Q8H569	Potassium channel AKT3	9.60e-02	NA	7.80e-04
3. B	Q6C520	Palmitoyltransferase AKR1	8.91e-03	NA	0.005
3. B	Q2QLA2	Cortactin-binding protein 2	3.38e-01	NA	2.67e-05
3. B	Q74ZH9	Glycerophosphocholine phosphodiesterase GDE1	7.26e-02	NA	0.002
3. B	Q9D2X0	Ankyrin repeat domain-containing protein 39	5.24e-09	NA	1.32e-06
3. B	O75179	Ankyrin repeat domain-containing protein 17	6.12e-01	NA	3.34e-05
3. B	Q86AT8	Stress-activated protein kinase alpha	9.32e-03	NA	0.004
3. B	Q9HYV6	Putative ankyrin repeat protein PA3287	6.81e-06	NA	0.001
3. B	Q09YM8	Cortactin-binding protein 2	1.76e-01	NA	4.52e-05
3. B	Q6GPE5	Protein fem-1 homolog B	1.78e-02	NA	0.030
3. B	Q8WXE0	Caskin-2	7.17e-02	NA	0.001
3. B	Q07E30	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.96e-02	NA	0.010
3. B	Q5DW34	Histone-lysine N-methyltransferase EHMT1	7.36e-02	NA	1.28e-04
3. B	Q80YE7	Death-associated protein kinase 1	1.40e-01	NA	1.15e-04
3. B	P0DJE3	Alpha-latrotoxin-Lhe1a	1.73e-01	NA	0.001
3. B	Q978J0	Putative ankyrin repeat protein TV1425	1.54e-06	NA	1.35e-06
3. B	Q2IBF5	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	3.97e-03	NA	0.028
3. B	A2CIR7	BTB/POZ domain and ankyrin repeat-containing protein NPR5	1.01e-02	NA	4.15e-04
3. B	I1S2J8	Transcription regulator FGM4	5.97e-02	NA	2.18e-04
3. B	Q3UYR4	Espin-like protein	7.07e-02	NA	0.014
3. B	Q8IWZ3	Ankyrin repeat and KH domain-containing protein 1	6.09e-01	NA	2.83e-05
3. B	A6NFN9	Protein ANKUB1	2.90e-07	NA	0.001
3. B	Q4V890	Protein fem-1 homolog A	8.30e-03	NA	0.002
3. B	Q9J5H5	Putative ankyrin repeat protein FPV026	NA	NA	0.036
3. B	Q9J4Z4	Putative ankyrin repeat protein FPV246	NA	NA	0.001
3. B	Q29RV0	Cyclin-dependent kinase 4 inhibitor D	2.06e-05	NA	0.001
3. B	Q8C6Y6	Ankyrin repeat and SOCS box protein 14	6.62e-03	NA	7.07e-04
3. B	Q5UPJ9	Putative ankyrin repeat protein L122	NA	NA	0.003
3. B	Q91974	NF-kappa-B inhibitor alpha	3.17e-04	NA	1.14e-05
3. B	Q54F46	Homeobox protein Wariai	1.35e-02	NA	0.005
3. B	Q108T9	Cortactin-binding protein 2	1.89e-01	NA	3.90e-05
3. B	Q9H672	Ankyrin repeat and SOCS box protein 7	1.15e-02	NA	0.002
3. B	Q9ET47	Espin	2.75e-02	NA	4.58e-06
3. B	Q05921	2-5A-dependent ribonuclease	3.42e-02	NA	2.83e-06
3. B	Q2RAQ5	BTB/POZ domain and ankyrin repeat-containing protein NH5.1	8.72e-03	NA	0.002
3. B	Q5ZIJ9	E3 ubiquitin-protein ligase MIB2	4.85e-02	NA	0.026
3. B	Q80VM7	Ankyrin repeat domain-containing protein 24	2.22e-02	NA	8.81e-04
3. B	P50086	Probable 26S proteasome regulatory subunit p28	2.54e-05	NA	0.002
3. B	P42771	Cyclin-dependent kinase inhibitor 2A	3.75e-07	NA	0.009
3. B	Q505D1	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A	3.76e-02	NA	5.22e-07
3. B	P81069	GA-binding protein subunit beta-2	3.67e-05	NA	6.29e-05
3. B	Q9VUW9	Palmitoyltransferase Hip14	1.17e-02	NA	0.002
3. B	Q9NXR5	Ankyrin repeat domain-containing protein 10	1.35e-04	NA	7.44e-06
3. B	Q96Q27	Ankyrin repeat and SOCS box protein 2	4.63e-03	NA	0.003
3. B	Q00420	GA-binding protein subunit beta-1	3.59e-04	NA	1.21e-07
3. B	Q6NLQ8	E3 ubiquitin-protein ligase XBAT32	2.27e-03	NA	0.002
3. B	Q86WC6	Protein phosphatase 1 regulatory subunit 27	5.86e-05	NA	0.003
3. B	Q9Y6H5	Synphilin-1	4.53e-02	NA	8.61e-04
3. B	Q8R516	E3 ubiquitin-protein ligase MIB2	5.09e-02	NA	0.017
3. B	Q8BG95	Protein phosphatase 1 regulatory subunit 12B	5.91e-02	NA	3.45e-04
3. B	Q6ZVH7	Espin-like protein	4.65e-02	NA	0.008
3. B	Q13418	Integrin-linked protein kinase	6.10e-04	NA	0.010
3. B	Q9FF09	Phytochrome-interacting ankyrin-repeat protein 1	1.81e-05	NA	4.91e-05
3. B	Q9C0D5	Protein TANC1	1.29e-01	NA	3.52e-05
3. B	Q5BKI6	Ankyrin repeat domain-containing protein 1	3.61e-04	NA	1.12e-05
3. B	Q9Z1P7	KN motif and ankyrin repeat domain-containing protein 3	4.20e-03	NA	0.014
3. B	Q6ZQK5	Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2	2.65e-03	NA	3.74e-05
3. B	Q9D738	Ankyrin repeat and SOCS box protein 12	2.92e-03	NA	7.71e-04
3. B	Q07DZ5	Cortactin-binding protein 2	1.69e-01	NA	4.54e-04
3. B	Q09YN0	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.13e-02	NA	0.039
3. B	D3YZU1	SH3 and multiple ankyrin repeat domains protein 1	1.23e-01	NA	0.002
3. B	Q92527	Ankyrin repeat domain-containing protein 7	8.56e-05	NA	0.026
3. B	Q02989	Alpha-latroinsectotoxin-Lt1a (Fragment)	1.85e-01	NA	6.61e-04
3. B	Q60J38	Ankyrin repeat and KH domain-containing protein CBG24701	6.75e-01	NA	2.25e-04
3. B	Q8T2Q0	Putative ZDHHC-type palmitoyltransferase 6	9.75e-03	NA	9.59e-06
3. B	B2RXR6	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B	3.00e-02	NA	8.16e-06
3. B	Q502K3	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C	1.01e-01	NA	1.89e-07
3. B	Q862Z2	Ankyrin repeat and SOCS box protein 5	2.24e-04	NA	0.003
3. B	Q66H07	Fibronectin type 3 and ankyrin repeat domains 1 protein	3.85e-03	NA	6.37e-04
3. B	Q7M6U3	Inactive serine/threonine-protein kinase TEX14	5.81e-02	NA	0.021
3. B	Q9EP71	Ankycorbin	1.45e-02	NA	2.65e-04
3. B	Q2QLB3	Cortactin-binding protein 2	2.10e-01	NA	1.61e-05
3. B	Q8HYY4	Uveal autoantigen with coiled-coil domains and ankyrin repeats protein	1.49e-01	NA	8.69e-05
3. B	Q05753	Ankyrin repeat domain-containing protein, chloroplastic	5.13e-03	NA	0.013
3. B	Q6UB99	Ankyrin repeat domain-containing protein 11	5.63e-01	NA	1.55e-06
3. B	O55222	Integrin-linked protein kinase	2.81e-03	NA	0.011
3. B	Q9J569	Putative ankyrin repeat protein FPV162	NA	NA	0.007
3. B	Q3SX45	Ankyrin repeat and SOCS box protein 2	7.04e-03	NA	4.55e-04
3. B	Q8MJ49	Osteoclast-stimulating factor 1	2.39e-04	NA	0.006
3. B	Q9SAR5	Ankyrin repeat domain-containing protein 2A	2.39e-02	NA	2.07e-07
3. B	Q08DV6	Ankyrin repeat and SOCS box protein 3	4.03e-03	NA	2.91e-04
3. B	Q09103	Eye-specific diacylglycerol kinase	1.16e-01	NA	5.67e-04
3. B	Q04721	Neurogenic locus notch homolog protein 2	5.96e-01	NA	3.32e-06
3. B	Q09YI1	Cortactin-binding protein 2	1.42e-01	NA	4.72e-05
3. B	Q3UMT1	Protein phosphatase 1 regulatory subunit 12C	1.72e-02	NA	7.79e-05
3. B	Q9C7A2	Ankyrin repeat-containing protein ITN1	1.69e-02	NA	0.002
3. B	Q8N6D5	Ankyrin repeat domain-containing protein 29	4.52e-04	NA	1.27e-06
3. B	O15084	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A	8.66e-02	NA	5.46e-07
3. B	Q9J4Z5	Putative ankyrin repeat protein FPV245	NA	NA	9.60e-05
3. B	Q8BTI7	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C	8.56e-02	NA	1.07e-07
3. B	E5RJM6	Ankyrin repeat domain-containing protein 65	8.70e-04	NA	4.84e-06
3. B	Q9QW30	Neurogenic locus notch homolog protein 2	5.80e-01	NA	3.32e-06
3. B	Q6GQX6	Ankyrin repeat and SAM domain-containing protein 6	5.18e-02	NA	0.008
3. B	Q86U10	60 kDa lysophospholipase	1.40e-02	NA	9.56e-06
3. B	Q3SX00	Ankyrin repeat domain-containing protein 46	1.46e-05	NA	0.027
3. B	Q6IVG4	Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2	3.98e-03	NA	3.46e-05
3. B	Q2IBB1	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	2.17e-03	NA	0.029
3. B	Q60649	Caseinolytic peptidase B protein homolog	1.06e-02	NA	0.040
3. B	Q59H18	Serine/threonine-protein kinase TNNI3K	5.93e-02	NA	3.50e-05
3. B	Q8VHQ3	Protein phosphatase 1 regulatory inhibitor subunit 16B	8.47e-03	NA	4.93e-05
3. B	Q99PE2	Ankyrin repeat family A protein 2	7.20e-05	NA	0.006
3. B	Q7ZYG4	Osteoclast-stimulating factor 1	7.77e-04	NA	0.011
3. B	Q0VC93	Ankyrin repeat domain-containing protein 37	4.56e-05	NA	0.007
3. B	Q9BSK4	Protein fem-1 homolog A	8.75e-02	NA	6.93e-04
3. B	Q9H9B1	Histone-lysine N-methyltransferase EHMT1	1.03e-01	NA	5.94e-04
3. B	Q99ME3	Synphilin-1	1.98e-02	NA	0.001
3. B	P42773	Cyclin-dependent kinase 4 inhibitor C	6.64e-06	NA	0.005
3. B	A0JNU3	60 kDa lysophospholipase	1.83e-02	NA	0.003
3. B	Q9J5I7	Putative ankyrin repeat protein FPV014	NA	NA	0.004
3. B	H3BUK9	POTE ankyrin domain family member B2	3.22e-03	NA	0.040
3. B	Q9BZF9	Uveal autoantigen with coiled-coil domains and ankyrin repeats	1.12e-01	NA	4.76e-05
3. B	Q9DAM9	Fibronectin type 3 and ankyrin repeat domains 1 protein	2.85e-03	NA	0.002
3. B	Q8N283	Ankyrin repeat domain-containing protein 35	4.42e-02	NA	7.41e-05
3. B	Q8WXH4	Ankyrin repeat and SOCS box protein 11	9.95e-04	NA	0.006
3. B	O60733	85/88 kDa calcium-independent phospholipase A2	4.48e-02	NA	9.23e-07
3. B	Q9ERK0	Receptor-interacting serine/threonine-protein kinase 4	2.44e-02	NA	2.18e-04
3. B	Q810B6	Rabankyrin-5	6.14e-02	NA	2.66e-04
3. B	A0A1D8PNZ7	Glycerophosphocholine phosphodiesterase GDE1	1.43e-01	NA	0.001
3. B	Q9J517	Putative ankyrin repeat protein FPV218	NA	NA	0.002
3. B	Q09YJ3	Cortactin-binding protein 2	2.29e-01	NA	4.29e-05
3. B	Q12955	Ankyrin-3	NA	NA	9.58e-09
3. B	Q8VHS5	Ankyrin repeat and SOCS box protein 16	2.62e-02	NA	0.005
3. B	Q8C0T1	Protein fem-1 homolog A-B	1.66e-02	NA	0.002
3. B	A2RUV0	Neurogenic locus notch homolog protein 1	6.57e-01	NA	0.023
3. B	Q38998	Potassium channel AKT1	8.98e-02	NA	3.93e-04
3. B	Q7S3M5	Palmitoyltransferase akr1	2.87e-02	NA	0.002
3. B	Q3V0J4	Ankyrin repeat domain-containing protein 53	8.14e-04	NA	5.15e-08
3. B	Q7Z6G8	Ankyrin repeat and sterile alpha motif domain-containing protein 1B	7.34e-02	NA	8.48e-05
3. B	Q5R5V4	Integrin-linked protein kinase	6.18e-05	NA	0.011
3. B	O75832	26S proteasome non-ATPase regulatory subunit 10	2.02e-05	NA	6.05e-06
3. B	Q6ZW76	Ankyrin repeat and SAM domain-containing protein 3	3.41e-02	NA	3.69e-05
3. B	Q2IBB4	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.80e-02	NA	0.004
3. B	Q8GXE6	Potassium channel AKT6	5.53e-02	NA	2.19e-05
3. B	A0A140LI88	Ankyrin repeat domain-containing protein 31	4.21e-01	NA	3.37e-05
3. B	Q09YK4	Cortactin-binding protein 2	2.31e-01	NA	6.76e-05
3. B	Q8C8R3	Ankyrin-2	NA	NA	1.15e-08
3. B	E1C656	E3 ubiquitin-protein ligase HACE1	2.83e-02	NA	0.008
3. B	Q6F6B3	Protein TANC1	1.24e-01	NA	4.61e-05
3. B	Q17QS6	Ankyrin repeat and SOCS box protein 5	1.58e-03	NA	3.63e-04
3. B	Q86W74	Ankyrin repeat domain-containing protein 46	1.15e-05	NA	0.027
3. B	Q8N8V4	Ankyrin repeat and SAM domain-containing protein 4B	1.46e-05	NA	0.017
3. B	Q7SIG6	Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2	2.14e-01	NA	0.001
3. B	Q07DY6	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	9.95e-03	NA	0.029
3. B	Q6ZPR6	Inhibitor of Bruton tyrosine kinase	1.97e-01	NA	0.043
3. B	Q9Y574	Ankyrin repeat and SOCS box protein 4	6.67e-03	NA	4.37e-05
3. B	P40480	Protein HOS4	5.16e-02	NA	0.002
3. B	Q9UU77	Ankyrin repeat-containing protein P1E11.10	3.82e-05	NA	1.92e-06
3. B	Q9H9E1	Ankyrin repeat family A protein 2	1.62e-04	NA	0.008
3. B	Q6NXT1	Ankyrin repeat domain-containing protein 54	8.82e-05	NA	9.47e-07
3. B	Q8BIZ1	Ankyrin repeat and sterile alpha motif domain-containing protein 1B	1.08e-01	NA	1.13e-04
3. B	Q6AWW5	Ankyrin repeat-containing protein At5g02620	2.11e-03	NA	0.005
3. B	Q9QZH2	BRCA1-associated RING domain protein 1	1.56e-02	NA	2.38e-04
3. B	Q8TDY4	Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3	3.90e-02	NA	0.045
3. B	Q07E43	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	6.99e-03	NA	0.045
3. B	Q8TC84	Fibronectin type 3 and ankyrin repeat domains protein 1	1.40e-03	NA	0.002
3. B	Q54HT1	Protein tirA	1.36e-01	NA	0.003
3. B	Q96P50	Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 3	1.24e-02	NA	4.53e-04
3. B	Q9J503	Putative ankyrin repeat protein FPV232	NA	NA	0.004
3. B	Q99728	BRCA1-associated RING domain protein 1	3.73e-02	NA	2.02e-04
3. B	P97570	85/88 kDa calcium-independent phospholipase A2	4.43e-02	NA	3.98e-07
3. B	Q07008	Neurogenic locus notch homolog protein 1	6.79e-01	NA	4.35e-04
3. B	Q3UMR0	Ankyrin repeat domain-containing protein 27	8.14e-02	NA	5.60e-06
3. B	A3AYR1	Acyl-CoA-binding domain-containing protein 4	1.25e-03	NA	0.003
3. B	Q07DY4	Cortactin-binding protein 2	2.83e-01	NA	2.52e-05
3. B	A1X157	Cortactin-binding protein 2	2.34e-01	NA	3.60e-05
3. B	Q9HCD6	Protein TANC2	1.63e-01	NA	1.90e-04
3. B	Q9Z148	Histone-lysine N-methyltransferase EHMT2	8.17e-02	NA	0.043
3. B	Q9GL21	Uveal autoantigen with coiled-coil domains and ankyrin repeats	1.49e-01	NA	7.12e-05
3. B	Q9CZK6	Ankyrin repeat and SAM domain-containing protein 3	1.21e-02	NA	1.18e-05
3. B	Q8TAK5	GA-binding protein subunit beta-2	1.06e-03	NA	1.61e-05
3. B	Q99J82	Integrin-linked protein kinase	1.35e-04	NA	0.011
3. B	Q2IBF7	Cortactin-binding protein 2	1.24e-01	NA	5.27e-06
3. B	Q2QLF8	Cortactin-binding protein 2	2.26e-01	NA	2.51e-05
3. B	Q71S22	Inversin-A	5.54e-02	NA	0.044
3. B	Q1AAU6	Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1	3.16e-01	NA	0.040
3. B	A0M8T3	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	5.94e-03	NA	0.007
3. B	Q4UMH6	Putative ankyrin repeat protein RF_0381	2.58e-01	NA	4.63e-05
3. B	P53355	Death-associated protein kinase 1	7.70e-02	NA	0.003
3. B	Q804S5	E3 ubiquitin-protein ligase mib1	8.33e-02	NA	0.016
3. B	Q8IYU2	E3 ubiquitin-protein ligase HACE1	4.09e-02	NA	0.010
3. B	Q875S9	Palmitoyltransferase AKR1	3.72e-02	NA	0.003
3. B	P0CS66	Palmitoyltransferase AKR1	1.98e-02	NA	3.85e-05
3. B	Q6B858	Fibronectin type 3 and ankyrin repeat domains protein 1	1.14e-03	NA	0.001
3. B	Q8NB46	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C	8.48e-02	NA	9.33e-08
3. B	P25963	NF-kappa-B inhibitor alpha	2.70e-03	NA	0.008
3. B	Q5REW9	Ankyrin repeat domain-containing protein 27	4.96e-02	NA	3.94e-06
3. B	Q9CQ31	Ankyrin repeat and SOCS box protein 11	9.97e-04	NA	0.004
3. B	Q6JAN1	Inversin	9.68e-02	NA	0.048
3. B	Q5RJK8	Acyl-CoA-binding domain-containing protein 6	1.37e-03	NA	0.002
3. B	D3ZBM7	E3 ubiquitin-protein ligase HACE1	2.21e-02	NA	0.005
3. B	Q9J5G9	Putative ankyrin repeat protein FPV034	NA	NA	2.26e-04
3. B	Q9ZVC2	Regulatory protein NPR5	1.52e-02	NA	0.001
3. B	Q2QLA4	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	5.80e-03	NA	0.007
3. B	P23631	Alpha-latrotoxin-Lt1a	1.73e-01	NA	9.83e-05
3. B	P39010	Palmitoyltransferase AKR1	1.57e-02	NA	0.026
3. B	Q8WXD9	Caskin-1	1.90e-01	NA	4.25e-05
3. B	Q8R560	Ankyrin repeat domain-containing protein 1	6.19e-04	NA	1.49e-04
3. B	Q9FY48	E3 ubiquitin-protein ligase KEG	4.17e-01	NA	0.004
3. B	Q8BH83	Ankyrin repeat domain-containing protein 9	2.11e-03	NA	0.003
3. B	Q8WZ74	Cortactin-binding protein 2	2.33e-01	NA	5.27e-06
3. B	Q3EC11	Probable protein S-acyltransferase 23	1.67e-02	NA	7.63e-06
3. B	Q5B0V6	Palmitoyltransferase akr1	4.98e-02	NA	0.021
3. B	Q8BLD6	Ankyrin repeat domain-containing protein 55	6.71e-03	NA	0.038
3. B	Q6DRG7	Protein phosphatase 1 regulatory subunit 12A	1.36e-01	NA	4.91e-04
3. B	Q9VBP3	Poly [ADP-ribose] polymerase tankyrase	7.50e-02	NA	1.09e-06
3. B	Q96DX5	Ankyrin repeat and SOCS box protein 9	8.89e-04	NA	3.13e-04
3. B	Q9BR61	Acyl-CoA-binding domain-containing protein 6	2.15e-03	NA	0.005
3. B	Q2QL82	Cortactin-binding protein 2	3.19e-01	NA	2.02e-05
3. B	Q96NW4	Ankyrin repeat domain-containing protein 27	6.18e-02	NA	2.60e-06
3. B	Q8VE42	Ankyrin repeat domain-containing protein 49	2.58e-04	NA	1.54e-06