Summary

Q9C073

Homolog: Q7TNF9.
Function: Protein FAM117A.

Statistics

Total GO Annotation: 54
Unique PROST Go: 54
Unique BLAST Go: 0

Total Homologs: 15
Unique PROST Homologs: 9
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q7TNF9 (Protein FAM117A) with a FATCAT P-Value: 8.89e-05 and RMSD of 7.53 angstrom. The sequence alignment identity is 87.9%.
Structural alignment shown in left. Query protein Q9C073 colored as red in alignment, homolog Q7TNF9 colored as blue. Query protein Q9C073 is also shown in right top, homolog Q7TNF9 showed in right bottom. They are colored based on secondary structures. 

  Q9C073 MAGAAAGGRGGGAWGPGRGGAGGLRRGCSPPAPAGSPRAGLQPLRATIPFQLQQPHQRRDGGGRAASVPCSVAPEKSVCRPQPLQVRRTFSLDTILSSYL 100
  Q7TNF9 MSGAAAGGRGGGSWGPGRGGAGGLRRGCSPPAPAGSPRVGLQPLRATVPFQLQQPHQRRDGGGRAASVPCSVAPEKSVCRPQPPQVRRTFSLDTILSSYL 100

  Q9C073 LGQWPRDADGAFTCCTNDKATQTPLSWQELEGERASSCAHKRSASWGSTDHRKEISKLKQQLQRTKLSRSGKEKERGSPLLGDHAVRGALRASPPSFPSG 200
  Q7TNF9 LGQWPRDADGAFTCCTNDKATQTPLSWQEPEGERASFCMHKRSASWGSTDHRKEITKLKQQLQRTKLSRSGKEKERSCPVQGDHAALGAGRASLPSHPPG 200

  Q9C073 SPVLRLSPCLHRSLEGLNQELEEVFVKEQGEEELLRILDIPDGHRAPAPPQSGSCDHPLLLLEPGNLASSPSMSLASPQPCGLASHEEHRGAAEELASTP 300
  Q7TNF9 PPVLRLSPCLHRSLEGLNQELEEVFVKEQGEEELLRILEVPDGHRAPAPPQNSSCDHS-LLLEPGNLTSSPSVPLASPQPPSQASREEHQGATEELASIH 299

  Q9C073 NDKASSPGHPAFLEDGSPSPVLAFAASPRPNHSYIFKREPPEGCEKVRVFEEATSPGPDLAFLTSCPDKNKVHFNPTGSAFCPVNLMKPLFPGMGFIFRN 400
  Q7TNF9 GNKASSPGNPAFLEDGSPSPVLAFAASPRPNHSYVFKREPPEGCERVRVFEEATSPGPDLAFLTSCPDKNKVHFNPTGSAFCPVSLIKPLFPSMGFIFRN 399

  Q9C073 CPSNPGSPLPPASPRPPPRKDPEASKASPLPFEPWQRTPPSEEPVLFQSSLMV 453
  Q7TNF9 CPSSPGSPLPTASPR-APRKGPEASKASSLPSEPWQRSPPSEESVLFQSSLVV 451

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0032731 positive regulation of interleukin-1 beta production
2. P GO:0010508 positive regulation of autophagy
2. P GO:0032494 response to peptidoglycan
2. P GO:0014737 positive regulation of muscle atrophy
2. P GO:0090436 leaf pavement cell development
2. P GO:0002221 pattern recognition receptor signaling pathway
2. P GO:0034334 adherens junction maintenance
2. P GO:0031398 positive regulation of protein ubiquitination
2. P GO:0042594 response to starvation
2. P GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
2. P GO:1902584 positive regulation of response to water deprivation
2. P GO:0032755 positive regulation of interleukin-6 production
2. P GO:0060041 retina development in camera-type eye
2. P GO:0009554 megasporogenesis
2. P GO:1903409 reactive oxygen species biosynthetic process
2. P GO:0010235 guard mother cell cytokinesis
2. P GO:0002720 positive regulation of cytokine production involved in immune response
2. P GO:0035721 intraciliary retrograde transport
2. P GO:0070542 response to fatty acid
2. P GO:0000187 obsolete activation of MAPK activity
2. P GO:0050891 multicellular organismal water homeostasis
2. P GO:0009737 response to abscisic acid
2. P GO:0009629 response to gravity
2. P GO:0030991 intraciliary transport particle A
2. P GO:0080022 primary root development
2. P GO:0033209 tumor necrosis factor-mediated signaling pathway
2. P GO:0031490 chromatin DNA binding
2. P GO:0009926 auxin polar transport
2. P GO:0032733 positive regulation of interleukin-10 production
2. P GO:0031274 positive regulation of pseudopodium assembly
2. P GO:0032495 response to muramyl dipeptide
2. P GO:2000037 regulation of stomatal complex patterning
2. P GO:0010052 guard cell differentiation
2. P GO:0010376 stomatal complex formation
2. P GO:1901333 positive regulation of lateral root development
2. P GO:0000266 mitochondrial fission
2. P GO:0070431 nucleotide-binding oligomerization domain containing 2 signaling pathway
2. P GO:0000123 histone acetyltransferase complex
2. P GO:0060729 intestinal epithelial structure maintenance
2. P GO:0009733 response to auxin
2. P GO:0005856 cytoskeleton
2. P GO:0009553 embryo sac development
2. P GO:0043525 positive regulation of neuron apoptotic process
2. P GO:0010444 guard mother cell differentiation
2. P GO:0032875 regulation of DNA endoreduplication
2. P GO:0030838 positive regulation of actin filament polymerization
2. P GO:1902806 regulation of cell cycle G1/S phase transition
2. P GO:0032874 positive regulation of stress-activated MAPK cascade
2. P GO:1901002 positive regulation of response to salt stress
2. P GO:0007266 Rho protein signal transduction
2. P GO:0061087 positive regulation of histone H3-K27 methylation
2. P GO:0043565 sequence-specific DNA binding
2. P GO:0009734 auxin-activated signaling pathway
2. P GO:0043123 positive regulation of I-kappaB kinase/NF-kappaB signaling

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q8K3I9 Glucocorticoid-induced transcript 1 protein 1.19e-02 4.15e-09 1.13e-70
1. PB Q86VQ1 Glucocorticoid-induced transcript 1 protein 1.20e-03 2.20e-11 6.05e-69
1. PB Q3U3E2 Protein FAM117B 1.45e-02 2.97e-02 2.47e-63
1. PB Q7TNF9 Protein FAM117A 8.89e-05 1.09e-64 0.0
1. PB Q9C073 Protein FAM117A 0 3.61e-139 0.0
1. PB Q6P1L5 Protein FAM117B 7.87e-03 1.87e-03 3.05e-64
2. P Q6EUW1 Forkhead box protein O3 2.41e-01 9.16e-03 NA
2. P Q0IHW6 KAT8 regulatory NSL complex subunit 1-like protein 5.79e-01 3.44e-02 NA
2. P Q4V7T5 Mitochondrial fission regulator 1-like-B 3.93e-01 1.36e-02 NA
2. P Q0VFP3 Mitochondrial fission regulator 1-like 1.87e-01 5.36e-03 NA
2. P Q8N9Y4 Protein FAM181A 1.12e-01 4.98e-02 NA
2. P Q94FL6 Transcription factor MYB124 3.52e-01 4.54e-02 NA
2. P Q3KP66 Innate immunity activator protein 2.92e-01 3.08e-02 NA
2. P A1A5P0 Cdc42 effector protein 1 2.82e-01 3.41e-02 NA
2. P Q2TBN9 Intraflagellar transport protein 43 homolog 3.93e-01 3.78e-02 NA