Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
Q80YS5
(Leucine-rich repeat-containing protein 27) with a FATCAT P-Value: 1.51e-10 and RMSD of 3.27 angstrom. The sequence alignment identity is 55.0%.
Structural alignment shown in left. Query protein Q9C0I9 colored as red in alignment, homolog Q80YS5 colored as blue.
Query protein Q9C0I9 is also shown in right top, homolog Q80YS5 showed in right bottom. They are colored based on secondary structures.
Q9C0I9 MEGSSSYEV-------PSVAAADL-EEGAGQTRSLPATPSKDVH---KG-----VGGIIFSSSPILDLSESGLCRLEEVFRIPSLQQLHLQRNALCVIPQ 84 Q80YS5 MEDTSPQAVAEKAAKDPK-AAKDLKDDAAAATKSFP-----D-HFSREGDDQMDFEGVIFSSSPVLDLSQRGLRHLGKFFKIPNLQQLHLQRNLLREIPE 93 Q9C0I9 DFFQLLPNLTWLDLRYNRIKALPSGIGAHQHLKTLLLERNPIKMLPVELGSVTTLKALNLRHCPLEFPPQLVVQKGLVAIQRFLRMWAVEHSLPRN---P 181 Q80YS5 DFFQLLPNLTWLDLRYNKIKVLPSGIGSHKHLKTLLLERNPIKMLPVELGQVTTLTALNLRHCPLEFPPRLIVQKGLVAILTFLRICSVEKAFPGDELLP 193 Q9C0I9 -TSQEAPPVREMTLRDLPSPGLEL--SGDHASNQGAVNAQDPEGAVMKEKASFLPPVEKPDLSELRKSADSSENWPSEEEIRRFWKLRQEIVEHVKADVL 278 Q80YS5 EVS--AP---KMGSNDLQYPVLPLPRKGSPSEN--SLN--DPDQE--KEKADFFPPMERLDLSELRKSNAASEIWPSKEEIRRFWKLRQEIVENEQVEIQ 282 Q9C0I9 GDQLLTRELPPNLKAALNI-EKELPKPRHVFRRKTASSRSILPDLLSPYQMAIRAKRLEESRAAALRELQEKQALMEQQRREKRALQEWRERAQRMRKRK 377 Q80YS5 EKKLLAVELPPNLKAALNVKEKKHRKPWPAVRKRSTSFKGILPNLPSGYQNTVHANRMEDTHKAALQELQEKETVLEQRRRDKRALQEWREQTQHMRTRR 382 Q9C0I9 EELSKLLPPRRSMVASKIPSATDLIDNRKVPLNPPGKMKPSKEKSPQASKEMSA--LQERNLEEKIKQHVLQMREQRRFHGQAPLEEMRKAAEDLEIATE 475 Q80YS5 -ELSKLQPPHSNMMASKIPFATDLTDYEKMPVSPFGKVKPSGEGTAQRPIEISASPLAE--LEDKIKRHTQQIR-TRSFLGTNPMQDIKTANQDLETTKK 478 Q9C0I9 LQDEVLKLKLGLTLNKDRRRAALTGNLSLGLPAAQPQNTFFNTKYGESGNVRRYQ 530 Q80YS5 LQEELRKLKVEMTLNKDHPFPSFTGNLSLHPPASQPQNIFFNTKS---------- 523
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0006954 | inflammatory response |
| 1. PB | GO:0098978 | glutamatergic synapse |
| 1. PB | GO:0099560 | synaptic membrane adhesion |
| 1. PB | GO:0006977 | DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest |
| 1. PB | GO:0016323 | basolateral plasma membrane |
| 1. PB | GO:0030054 | cell junction |
| 1. PB | GO:0043030 | regulation of macrophage activation |
| 1. PB | GO:0097120 | receptor localization to synapse |
| 1. PB | GO:0070433 | negative regulation of nucleotide-binding oligomerization domain containing 2 signaling pathway |
| 1. PB | GO:0043113 | receptor clustering |
| 1. PB | GO:0010976 | positive regulation of neuron projection development |
| 1. PB | GO:0045806 | negative regulation of endocytosis |
| 1. PB | GO:2000405 | negative regulation of T cell migration |
| 1. PB | GO:2000786 | positive regulation of autophagosome assembly |
| 1. PB | GO:0098982 | GABA-ergic synapse |
| 1. PB | GO:0045197 | establishment or maintenance of epithelial cell apical/basal polarity |
| 1. PB | GO:0051721 | protein phosphatase 2A binding |
| 1. PB | GO:0045175 | basal protein localization |
| 1. PB | GO:0030056 | hemidesmosome |
| 1. PB | GO:0046579 | positive regulation of Ras protein signal transduction |
| 1. PB | GO:0031514 | motile cilium |
| 1. PB | GO:0032185 | septin cytoskeleton organization |
| 1. PB | GO:1900745 | positive regulation of p38MAPK cascade |
| 1. PB | GO:0034121 | regulation of toll-like receptor signaling pathway |
| 1. PB | GO:0034136 | negative regulation of toll-like receptor 2 signaling pathway |
| 1. PB | GO:0032495 | response to muramyl dipeptide |
| 1. PB | GO:1990869 | cellular response to chemokine |
| 1. PB | GO:1904417 | positive regulation of xenophagy |
| 1. PB | GO:0035308 | negative regulation of protein dephosphorylation |
| 1. PB | GO:1905606 | regulation of presynapse assembly |
| 1. PB | GO:0034260 | negative regulation of GTPase activity |
| 1. PB | GO:0031012 | extracellular matrix |
| 1. PB | GO:0014069 | postsynaptic density |
| 1. PB | GO:0045087 | innate immune response |
| 1. PB | GO:0051897 | positive regulation of protein kinase B signaling |
| 1. PB | GO:0071638 | negative regulation of monocyte chemotactic protein-1 production |
| 1. PB | GO:0043194 | axon initial segment |
| 1. PB | GO:1900181 | negative regulation of protein localization to nucleus |
| 1. PB | GO:0043122 | regulation of I-kappaB kinase/NF-kappaB signaling |
| 1. PB | GO:0042645 | mitochondrial nucleoid |
| 1. PB | GO:0070086 | ubiquitin-dependent endocytosis |
| 1. PB | GO:0005789 | endoplasmic reticulum membrane |
| 1. PB | GO:0046755 | viral budding |
| 1. PB | GO:0008625 | extrinsic apoptotic signaling pathway via death domain receptors |
| 1. PB | GO:0099072 | regulation of postsynaptic membrane neurotransmitter receptor levels |
| 1. PB | GO:0032088 | negative regulation of NF-kappaB transcription factor activity |
| 1. PB | GO:0034137 | positive regulation of toll-like receptor 2 signaling pathway |
| 1. PB | GO:0005635 | nuclear envelope |
| 1. PB | GO:0005176 | ErbB-2 class receptor binding |
| 1. PB | GO:0007165 | signal transduction |
| 1. PB | GO:0099061 | integral component of postsynaptic density membrane |
| 1. PB | GO:0031362 | anchored component of external side of plasma membrane |
| 1. PB | GO:0034144 | negative regulation of toll-like receptor 4 signaling pathway |
| 2. P | GO:0035082 | axoneme assembly |
| 2. P | GO:0060438 | trachea development |
| 2. P | GO:0005686 | U2 snRNP |
| 2. P | GO:0003351 | epithelial cilium movement involved in extracellular fluid movement |
| 2. P | GO:0002718 | regulation of cytokine production involved in immune response |
| 2. P | GO:0030424 | axon |
| 2. P | GO:0034451 | centriolar satellite |
| 2. P | GO:0085032 | modulation by symbiont of host I-kappaB kinase/NF-kappaB cascade |
| 2. P | GO:0071907 | determination of digestive tract left/right asymmetry |
| 2. P | GO:1904862 | inhibitory synapse assembly |
| 2. P | GO:1901673 | regulation of mitotic spindle assembly |
| 2. P | GO:0004864 | protein phosphatase inhibitor activity |
| 2. P | GO:0099179 | regulation of synaptic membrane adhesion |
| 2. P | GO:1902018 | negative regulation of cilium assembly |
| 2. P | GO:0005929 | cilium |
| 2. P | GO:0004842 | ubiquitin-protein transferase activity |
| 2. P | GO:0120293 | dynein axonemal particle |
| 2. P | GO:0030620 | U2 snRNA binding |
| 2. P | GO:0007599 | hemostasis |
| 2. P | GO:0060076 | excitatory synapse |
| 2. P | GO:0009986 | cell surface |
| 2. P | GO:0005615 | extracellular space |
| 2. P | GO:0033566 | gamma-tubulin complex localization |
| 2. P | GO:0050896 | response to stimulus |
| 2. P | GO:0050808 | synapse organization |
| 2. P | GO:0052083 | suppression by symbiont of host cell-mediated immune response |
| 2. P | GO:0030175 | filopodium |
| 2. P | GO:0001750 | photoreceptor outer segment |
| 2. P | GO:0003341 | cilium movement |
| 2. P | GO:0048793 | pronephros development |
| 2. P | GO:0071910 | determination of liver left/right asymmetry |
| 2. P | GO:0099059 | integral component of presynaptic active zone membrane |
| 2. P | GO:0016605 | PML body |
| 2. P | GO:0060287 | epithelial cilium movement involved in determination of left/right asymmetry |
| 2. P | GO:0034055 | effector-mediated induction of programmed cell death in host |
| 2. P | GO:0008542 | visual learning |
| 2. P | GO:0044164 | host cell cytosol |
| 2. P | GO:0070840 | dynein complex binding |
| 2. P | GO:0060285 | cilium-dependent cell motility |
| 2. P | GO:0016540 | protein autoprocessing |
| 2. P | GO:0060972 | left/right pattern formation |
| 2. P | GO:0120229 | protein localization to motile cilium |
| 2. P | GO:0045433 | male courtship behavior, veined wing generated song production |
| 2. P | GO:0008104 | protein localization |
| 2. P | GO:0030030 | cell projection organization |
| 2. P | GO:0036159 | inner dynein arm assembly |
| 2. P | GO:0051649 | establishment of localization in cell |
| 2. P | GO:0015057 | thrombin-activated receptor activity |
| 2. P | GO:0042700 | luteinizing hormone signaling pathway |
| 2. P | GO:0030176 | integral component of endoplasmic reticulum membrane |
| 2. P | GO:0044074 | negative regulation by symbiont of host translation |
| 2. P | GO:0034142 | toll-like receptor 4 signaling pathway |
| 2. P | GO:0099175 | regulation of postsynapse organization |
| 2. P | GO:0090651 | apical cytoplasm |
| 2. P | GO:0005123 | death receptor binding |
| 2. P | GO:0050804 | modulation of chemical synaptic transmission |
| 2. P | GO:0061512 | protein localization to cilium |
| 2. P | GO:0044314 | protein K27-linked ubiquitination |
| 2. P | GO:0070286 | axonemal dynein complex assembly |
| 2. P | GO:0036158 | outer dynein arm assembly |
| 2. P | GO:0030193 | regulation of blood coagulation |
| 2. P | GO:0010378 | temperature compensation of the circadian clock |
| 2. P | GO:0090660 | cerebrospinal fluid circulation |
| 2. P | GO:0051865 | protein autoubiquitination |
| 2. P | GO:0046330 | positive regulation of JNK cascade |
| 2. P | GO:0050728 | negative regulation of inflammatory response |
| 2. P | GO:0010165 | response to X-ray |
| 2. P | GO:0000209 | protein polyubiquitination |
| 2. P | GO:2000155 | positive regulation of cilium-dependent cell motility |
| 2. P | GO:0001947 | heart looping |
| 2. P | GO:0030425 | dendrite |
| 2. P | GO:0097733 | photoreceptor cell cilium |
| 2. P | GO:0030218 | erythrocyte differentiation |
| 2. P | GO:0036064 | ciliary basal body |
| 2. P | GO:0005930 | axoneme |
| 2. P | GO:0035469 | determination of pancreatic left/right asymmetry |
| 2. P | GO:0098685 | Schaffer collateral - CA1 synapse |
| 2. P | GO:0007010 | cytoskeleton organization |
| 2. P | GO:0001530 | lipopolysaccharide binding |
| 2. P | GO:2000647 | negative regulation of stem cell proliferation |
| 2. P | GO:0003146 | heart jogging |
| 2. P | GO:0046426 | negative regulation of receptor signaling pathway via JAK-STAT |
| 2. P | GO:0007155 | cell adhesion |
| 2. P | GO:0022602 | ovulation cycle process |
| 2. P | GO:0000920 | septum digestion after cytokinesis |
| 2. P | GO:0060294 | cilium movement involved in cell motility |
| 2. P | GO:0070527 | platelet aggregation |
| 2. P | GO:0043393 | regulation of protein binding |
| 2. P | GO:0098794 | postsynapse |
| 2. P | GO:0040036 | regulation of fibroblast growth factor receptor signaling pathway |
| 2. P | GO:0071373 | cellular response to luteinizing hormone stimulus |
| 2. P | GO:0060027 | convergent extension involved in gastrulation |
| 2. P | GO:0003305 | cell migration involved in heart jogging |
| 2. P | GO:0046696 | lipopolysaccharide receptor complex |
| 2. P | GO:0003314 | heart rudiment morphogenesis |
| 2. P | GO:0003143 | embryonic heart tube morphogenesis |
| 2. P | GO:0052170 | suppression by symbiont of host innate immune response |
| 2. P | GO:0071356 | cellular response to tumor necrosis factor |
| 2. P | GO:0006919 | activation of cysteine-type endopeptidase activity involved in apoptotic process |
| 2. P | GO:0061458 | reproductive system development |
| 2. P | GO:0007118 | budding cell apical bud growth |
| 2. P | GO:0042769 | obsolete DNA damage response, detection of DNA damage |
| 2. P | GO:0004964 | luteinizing hormone receptor activity |
| 2. P | GO:0042730 | fibrinolysis |
| 2. P | GO:0032391 | photoreceptor connecting cilium |
| 2. P | GO:0060271 | cilium assembly |
| 2. P | GO:0030317 | flagellated sperm motility |
| 2. P | GO:0030532 | small nuclear ribonucleoprotein complex |
| 2. P | GO:0042025 | host cell nucleus |
| 2. P | GO:0003356 | regulation of cilium beat frequency |
| 2. P | GO:0005813 | centrosome |
| 2. P | GO:0007368 | determination of left/right symmetry |
| 2. P | GO:0061371 | determination of heart left/right asymmetry |
| 2. P | GO:0005829 | cytosol |
| 2. P | GO:0008039 | synaptic target recognition |
| 2. P | GO:0099151 | regulation of postsynaptic density assembly |
| 2. P | GO:0007616 | long-term memory |
| 2. P | GO:0044458 | motile cilium assembly |
| 2. P | GO:0007224 | smoothened signaling pathway |
| 2. P | GO:0007596 | blood coagulation |
| 2. P | GO:0044782 | cilium organization |
| 2. P | GO:0045211 | postsynaptic membrane |
| 2. P | GO:0099572 | postsynaptic specialization |
| 2. P | GO:0008584 | male gonad development |
| 3. B | GO:0030014 | CCR4-NOT complex |
| 3. B | GO:0016080 | synaptic vesicle targeting |
| 3. B | GO:0046007 | negative regulation of activated T cell proliferation |
| 3. B | GO:0038131 | neuregulin receptor activity |
| 3. B | GO:0045571 | negative regulation of imaginal disc growth |
| 3. B | GO:0055046 | microgametogenesis |
| 3. B | GO:0090037 | positive regulation of protein kinase C signaling |
| 3. B | GO:2001013 | epithelial cell proliferation involved in renal tubule morphogenesis |
| 3. B | GO:0006368 | transcription elongation from RNA polymerase II promoter |
| 3. B | GO:0007089 | traversing start control point of mitotic cell cycle |
| 3. B | GO:1903217 | negative regulation of protein processing involved in protein targeting to mitochondrion |
| 3. B | GO:0099147 | extrinsic component of postsynaptic density membrane |
| 3. B | GO:0006884 | cell volume homeostasis |
| 3. B | GO:0043615 | astrocyte cell migration |
| 3. B | GO:0045186 | zonula adherens assembly |
| 3. B | GO:0061161 | positive regulation of establishment of bipolar cell polarity regulating cell shape |
| 3. B | GO:0036360 | sorocarp stalk morphogenesis |
| 3. B | GO:0030539 | male genitalia development |
| 3. B | GO:0001964 | startle response |
| 3. B | GO:0071470 | cellular response to osmotic stress |
| 3. B | GO:0015734 | taurine transport |
| 3. B | GO:0030021 | extracellular matrix structural constituent conferring compression resistance |
| 3. B | GO:0045663 | positive regulation of myoblast differentiation |
| 3. B | GO:0019903 | protein phosphatase binding |
| 3. B | GO:0106310 | protein serine kinase activity |
| 3. B | GO:0099054 | presynapse assembly |
| 3. B | GO:0016500 | protein-hormone receptor activity |
| 3. B | GO:0035025 | positive regulation of Rho protein signal transduction |
| 3. B | GO:0016201 | synaptic target inhibition |
| 3. B | GO:0048495 | Roundabout binding |
| 3. B | GO:0008330 | protein tyrosine/threonine phosphatase activity |
| 3. B | GO:0032228 | regulation of synaptic transmission, GABAergic |
| 3. B | GO:0007163 | establishment or maintenance of cell polarity |
| 3. B | GO:0035264 | multicellular organism growth |
| 3. B | GO:0004722 | protein serine/threonine phosphatase activity |
| 3. B | GO:0060581 | cell fate commitment involved in pattern specification |
| 3. B | GO:0072282 | metanephric nephron tubule morphogenesis |
| 3. B | GO:0007416 | synapse assembly |
| 3. B | GO:0005524 | ATP binding |
| 3. B | GO:1904027 | negative regulation of collagen fibril organization |
| 3. B | GO:0106307 | |
| 3. B | GO:1904887 | Wnt signalosome assembly |
| 3. B | GO:0030587 | sorocarp development |
| 3. B | GO:0015698 | inorganic anion transport |
| 3. B | GO:0002667 | regulation of T cell anergy |
| 3. B | GO:0030036 | actin cytoskeleton organization |
| 3. B | GO:0007188 | adenylate cyclase-modulating G protein-coupled receptor signaling pathway |
| 3. B | GO:0000288 | nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay |
| 3. B | GO:0045930 | negative regulation of mitotic cell cycle |
| 3. B | GO:0007283 | spermatogenesis |
| 3. B | GO:0002329 | pre-B cell differentiation |
| 3. B | GO:0098887 | neurotransmitter receptor transport, endosome to postsynaptic membrane |
| 3. B | GO:0000076 | DNA replication checkpoint signaling |
| 3. B | GO:0043231 | intracellular membrane-bounded organelle |
| 3. B | GO:1902803 | regulation of synaptic vesicle transport |
| 3. B | GO:0030534 | adult behavior |
| 3. B | GO:0010606 | positive regulation of cytoplasmic mRNA processing body assembly |
| 3. B | GO:0045108 | regulation of intermediate filament polymerization or depolymerization |
| 3. B | GO:0014041 | regulation of neuron maturation |
| 3. B | GO:1905573 | ganglioside GM1 binding |
| 3. B | GO:0001768 | establishment of T cell polarity |
| 3. B | GO:0044753 | amphisome |
| 3. B | GO:0070966 | nuclear-transcribed mRNA catabolic process, no-go decay |
| 3. B | GO:0006970 | response to osmotic stress |
| 3. B | GO:0030714 | anterior/posterior axis specification, follicular epithelium |
| 3. B | GO:0140360 | cyclic-GMP-AMP transmembrane transporter activity |
| 3. B | GO:0071726 | cellular response to diacyl bacterial lipopeptide |
| 3. B | GO:0016336 | establishment or maintenance of polarity of larval imaginal disc epithelium |
| 3. B | GO:0050929 | induction of negative chemotaxis |
| 3. B | GO:0030282 | bone mineralization |
| 3. B | GO:0022038 | corpus callosum development |
| 3. B | GO:0016332 | establishment or maintenance of polarity of embryonic epithelium |
| 3. B | GO:0019843 | rRNA binding |
| 3. B | GO:0043547 | positive regulation of GTPase activity |
| 3. B | GO:0010233 | phloem transport |
| 3. B | GO:0034750 | Scrib-APC-beta-catenin complex |
| 3. B | GO:1902476 | chloride transmembrane transport |
| 3. B | GO:0030239 | myofibril assembly |
| 3. B | GO:0099400 | caveola neck |
| 3. B | GO:0032331 | negative regulation of chondrocyte differentiation |
| 3. B | GO:0010632 | regulation of epithelial cell migration |
| 3. B | GO:1905103 | integral component of lysosomal membrane |
| 3. B | GO:0044295 | axonal growth cone |
| 3. B | GO:0005887 | integral component of plasma membrane |
| 3. B | GO:0031589 | cell-substrate adhesion |
| 3. B | GO:0090038 | negative regulation of protein kinase C signaling |
| 3. B | GO:2000274 | regulation of epithelial cell migration, open tracheal system |
| 3. B | GO:0098968 | neurotransmitter receptor transport postsynaptic membrane to endosome |
| 3. B | GO:0060005 | vestibular reflex |
| 3. B | GO:0017017 | MAP kinase tyrosine/serine/threonine phosphatase activity |
| 3. B | GO:0004532 | exoribonuclease activity |
| 3. B | GO:0051014 | actin filament severing |
| 3. B | GO:0005518 | collagen binding |
| 3. B | GO:0007502 | digestive tract mesoderm development |
| 3. B | GO:0060561 | apoptotic process involved in morphogenesis |
| 3. B | GO:0044291 | cell-cell contact zone |
| 3. B | GO:0072202 | cell differentiation involved in metanephros development |
| 3. B | GO:0008157 | protein phosphatase 1 binding |
| 3. B | GO:0048243 | norepinephrine secretion |
| 3. B | GO:0099139 | cheating during chimeric sorocarp development |
| 3. B | GO:0023041 | neuronal signal transduction |
| 3. B | GO:0006171 | cAMP biosynthetic process |
| 3. B | GO:0051900 | regulation of mitochondrial depolarization |
| 3. B | GO:0004672 | protein kinase activity |
| 3. B | GO:0010067 | procambium histogenesis |
| 3. B | GO:0031344 | regulation of cell projection organization |
| 3. B | GO:0000188 | obsolete inactivation of MAPK activity |
| 3. B | GO:1903980 | positive regulation of microglial cell activation |
| 3. B | GO:0009649 | entrainment of circadian clock |
| 3. B | GO:0048681 | negative regulation of axon regeneration |
| 3. B | GO:0046956 | positive phototaxis |
| 3. B | GO:0060088 | auditory receptor cell stereocilium organization |
| 3. B | GO:0140058 | neuron projection arborization |
| 3. B | GO:0051965 | positive regulation of synapse assembly |
| 3. B | GO:0043928 | exonucleolytic catabolism of deadenylated mRNA |
| 3. B | GO:0061290 | canonical Wnt signaling pathway involved in metanephric kidney development |
| 3. B | GO:0106311 | |
| 3. B | GO:0032528 | microvillus organization |
| 3. B | GO:0098609 | cell-cell adhesion |
| 3. B | GO:0050673 | epithelial cell proliferation |
| 3. B | GO:0001818 | negative regulation of cytokine production |
| 3. B | GO:0106306 | |
| 3. B | GO:0036335 | intestinal stem cell homeostasis |
| 3. B | GO:0043327 | chemotaxis to cAMP |
| 3. B | GO:0035374 | chondroitin sulfate binding |
| 3. B | GO:0035970 | peptidyl-threonine dephosphorylation |
| 3. B | GO:0007318 | pole plasm protein localization |
| 3. B | GO:0071666 | Slit-Robo signaling complex |
| 3. B | GO:0050772 | positive regulation of axonogenesis |
| 3. B | GO:0030374 | nuclear receptor coactivator activity |
| 3. B | GO:0032922 | circadian regulation of gene expression |
| 3. B | GO:0035089 | establishment of apical/basal cell polarity |
| 3. B | GO:1902499 | positive regulation of protein autoubiquitination |
| 3. B | GO:0032968 | positive regulation of transcription elongation from RNA polymerase II promoter |
| 3. B | GO:0140361 | cyclic-GMP-AMP transmembrane import across plasma membrane |
| 3. B | GO:0031223 | auditory behavior |
| 3. B | GO:0051898 | negative regulation of protein kinase B signaling |
| 3. B | GO:0016333 | morphogenesis of follicular epithelium |
| 3. B | GO:1905289 | regulation of CAMKK-AMPK signaling cascade |
| 3. B | GO:0007265 | Ras protein signal transduction |
| 3. B | GO:0007409 | axonogenesis |
| 3. B | GO:0060603 | mammary gland duct morphogenesis |
| 3. B | GO:0090263 | positive regulation of canonical Wnt signaling pathway |
| 3. B | GO:0045171 | intercellular bridge |
| 3. B | GO:0030517 | negative regulation of axon extension |
| 3. B | GO:1900744 | regulation of p38MAPK cascade |
| 3. B | GO:0031430 | M band |
| 3. B | GO:0022028 | tangential migration from the subventricular zone to the olfactory bulb |
| 3. B | GO:1905279 | regulation of retrograde transport, endosome to Golgi |
| 3. B | GO:0001737 | establishment of imaginal disc-derived wing hair orientation |
| 3. B | GO:0061809 | NAD+ nucleotidase, cyclic ADP-ribose generating |
| 3. B | GO:0035751 | regulation of lysosomal lumen pH |
| 3. B | GO:0046849 | bone remodeling |
| 3. B | GO:0071896 | protein localization to adherens junction |
| 3. B | GO:1990030 | pericellular basket |
| 3. B | GO:0001942 | hair follicle development |
| 3. B | GO:0030859 | polarized epithelial cell differentiation |
| 3. B | GO:0072002 | Malpighian tubule development |
| 3. B | GO:0034702 | ion channel complex |
| 3. B | GO:0051270 | regulation of cellular component movement |
| 3. B | GO:0050919 | negative chemotaxis |
| 3. B | GO:0090630 | activation of GTPase activity |
| 3. B | GO:0009626 | plant-type hypersensitive response |
| 3. B | GO:0007527 | adult somatic muscle development |
| 3. B | GO:0010977 | negative regulation of neuron projection development |
| 3. B | GO:0097487 | multivesicular body, internal vesicle |
| 3. B | GO:0004535 | poly(A)-specific ribonuclease activity |
| 3. B | GO:0010004 | gastrulation involving germ band extension |
| 3. B | GO:0060384 | innervation |
| 3. B | GO:0035564 | regulation of kidney size |
| 3. B | GO:0034134 | toll-like receptor 2 signaling pathway |
| 3. B | GO:1904713 | beta-catenin destruction complex binding |
| 3. B | GO:0071727 | cellular response to triacyl bacterial lipopeptide |
| 3. B | GO:0042622 | photoreceptor outer segment membrane |
| 3. B | GO:0021747 | cochlear nucleus development |
| 3. B | GO:0006470 | protein dephosphorylation |
| 3. B | GO:0000932 | P-body |
| 3. B | GO:0001649 | osteoblast differentiation |
| 3. B | GO:0048565 | digestive tract development |
| 3. B | GO:0035335 | peptidyl-tyrosine dephosphorylation |
| 3. B | GO:0016334 | establishment or maintenance of polarity of follicular epithelium |
| 3. B | GO:1905576 | ganglioside GT1b binding |
| 3. B | GO:0120163 | negative regulation of cold-induced thermogenesis |
| 3. B | GO:0031153 | slug development involved in sorocarp development |
| 3. B | GO:0031047 | gene silencing by RNA |
| 3. B | GO:0030015 | CCR4-NOT core complex |
| 3. B | GO:0005912 | adherens junction |
| 3. B | GO:0031150 | sorocarp stalk development |
| 3. B | GO:0021756 | striatum development |
| 3. B | GO:0015810 | aspartate transmembrane transport |
| 3. B | GO:0008154 | actin polymerization or depolymerization |
| 3. B | GO:0098633 | collagen fibril binding |
| 3. B | GO:2000172 | regulation of branching morphogenesis of a nerve |
| 3. B | GO:0035748 | myelin sheath abaxonal region |
| 3. B | GO:0060159 | regulation of dopamine receptor signaling pathway |
| 3. B | GO:0034122 | negative regulation of toll-like receptor signaling pathway |
| 3. B | GO:0050918 | positive chemotaxis |
| 3. B | GO:0016791 | phosphatase activity |
| 3. B | GO:1902004 | positive regulation of amyloid-beta formation |
| 3. B | GO:0005225 | volume-sensitive anion channel activity |
| 3. B | GO:1990794 | basolateral part of cell |
| 3. B | GO:0001678 | cellular glucose homeostasis |
| 3. B | GO:0000175 | 3'-5'-exoribonuclease activity |
| 3. B | GO:0062200 | RAM/MOR signaling pathway |
| 3. B | GO:0004016 | adenylate cyclase activity |
| 3. B | GO:0016335 | morphogenesis of larval imaginal disc epithelium |
| 3. B | GO:0007432 | salivary gland boundary specification |
| 3. B | GO:0048478 | replication fork protection |
| 3. B | GO:0043326 | chemotaxis to folate |
| 3. B | GO:0034178 | toll-like receptor 13 signaling pathway |
| 3. B | GO:0035996 | rhabdomere microvillus |
| 3. B | GO:0016601 | Rac protein signal transduction |
| 3. B | GO:0045444 | fat cell differentiation |
| 3. B | GO:0090190 | positive regulation of branching involved in ureteric bud morphogenesis |
| 3. B | GO:0036342 | post-anal tail morphogenesis |
| 3. B | GO:0008201 | heparin binding |
| 3. B | GO:0050135 | NAD(P)+ nucleosidase activity |
| 3. B | GO:0050807 | regulation of synapse organization |
| 3. B | GO:0043408 | regulation of MAPK cascade |
| 3. B | GO:0010619 | adenylate cyclase-activating glucose-activated G protein-coupled receptor signaling pathway |
| 3. B | GO:0004721 | phosphoprotein phosphatase activity |
| 3. B | GO:0001817 | regulation of cytokine production |
| 3. B | GO:0042592 | homeostatic process |
| 3. B | GO:0072224 | metanephric glomerulus development |
| 3. B | GO:0001772 | immunological synapse |
| 3. B | GO:0051019 | mitogen-activated protein kinase binding |
| 3. B | GO:0001921 | positive regulation of receptor recycling |
| 3. B | GO:0046328 | regulation of JNK cascade |
| 3. B | GO:0032473 | cytoplasmic side of mitochondrial outer membrane |
| 3. B | GO:0016593 | Cdc73/Paf1 complex |
| 3. B | GO:0060007 | linear vestibuloocular reflex |
| 3. B | GO:0048884 | neuromast development |
| 3. B | GO:0036479 | peroxidase inhibitor activity |
| 3. B | GO:0099149 | regulation of postsynaptic neurotransmitter receptor internalization |
| 3. B | GO:0000289 | nuclear-transcribed mRNA poly(A) tail shortening |
| 3. B | GO:0034214 | protein hexamerization |
| 3. B | GO:0098656 | anion transmembrane transport |
| 3. B | GO:0002093 | auditory receptor cell morphogenesis |
| 3. B | GO:0021562 | vestibulocochlear nerve development |
| 3. B | GO:0016331 | morphogenesis of embryonic epithelium |
| 3. B | GO:1903125 | negative regulation of thioredoxin peroxidase activity by peptidyl-threonine phosphorylation |
| 3. B | GO:0042067 | establishment of ommatidial planar polarity |
| 3. B | GO:0002755 | MyD88-dependent toll-like receptor signaling pathway |
| 3. B | GO:1903215 | negative regulation of protein targeting to mitochondrion |
| 3. B | GO:0006820 | anion transport |
| 3. B | GO:0051016 | barbed-end actin filament capping |
| 3. B | GO:0003779 | actin binding |
| 3. B | GO:0090102 | cochlea development |
| 3. B | GO:0004888 | transmembrane signaling receptor activity |
| 3. B | GO:0005546 | phosphatidylinositol-4,5-bisphosphate binding |
| 3. B | GO:0010811 | positive regulation of cell-substrate adhesion |
| 3. B | GO:0032024 | positive regulation of insulin secretion |
| 3. B | GO:0035556 | intracellular signal transduction |
| 3. B | GO:0000164 | protein phosphatase type 1 complex |
| 3. B | GO:0005918 | septate junction |
| 3. B | GO:1902823 | negative regulation of late endosome to lysosome transport |
| 3. B | GO:0035239 | tube morphogenesis |
| 3. B | GO:0034211 | GTP-dependent protein kinase activity |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q96AG4 | Leucine-rich repeat-containing protein 59 | 1.30e-04 | 6.84e-07 | 1.18e-05 |
| 1. PB | Q9Y4C4 | Malignant fibrous histiocytoma-amplified sequence 1 | 1.63e-02 | 2.19e-02 | 2.72e-04 |
| 1. PB | Q8AVS8 | Leucine-rich repeat-containing protein 59 | 9.49e-05 | 2.52e-09 | 4.61e-06 |
| 1. PB | Q921G6 | Leucine-rich repeat and calponin homology domain-containing protein 4 | 3.25e-02 | 1.41e-15 | 0.009 |
| 1. PB | Q9C0I9 | Leucine-rich repeat-containing protein 27 | 0 | 1.06e-153 | 0.0 |
| 1. PB | Q9HB75 | p53-induced death domain-containing protein 1 | 1.87e-01 | 6.20e-06 | 1.28e-04 |
| 1. PB | Q9W266 | Protein windpipe | 1.72e-02 | 2.00e-04 | 0.019 |
| 1. PB | P70587 | Leucine-rich repeat-containing protein 7 | 1.64e-01 | 5.72e-03 | 0.001 |
| 1. PB | F1MCA7 | Leucine-rich repeat-containing protein 7 | 7.07e-01 | 2.43e-02 | 2.16e-04 |
| 1. PB | Q5RJR8 | Leucine-rich repeat-containing protein 59 | 1.37e-04 | 9.21e-07 | 2.05e-05 |
| 1. PB | Q4R6X9 | Dynein regulatory complex subunit 3 | 6.26e-06 | 4.75e-13 | 0.049 |
| 1. PB | Q5F334 | Leucine-rich repeat-containing protein 59 | 2.10e-04 | 1.22e-07 | 2.12e-04 |
| 1. PB | P62046 | Leucine-rich repeat and calponin homology domain-containing protein 1 | 3.45e-02 | 1.55e-09 | 7.59e-04 |
| 1. PB | Q960C5 | Leucine-rich repeat and calponin homology domain-containing protein | 3.11e-02 | 6.16e-08 | 4.79e-06 |
| 1. PB | Q5E9X4 | Leucine-rich repeat-containing protein 59 | 1.15e-04 | 1.07e-07 | 9.30e-06 |
| 1. PB | Q6UWE0 | E3 ubiquitin-protein ligase LRSAM1 | 2.00e-06 | 2.84e-02 | 2.43e-10 |
| 1. PB | Q9D5E4 | Dynein regulatory complex subunit 3 | 3.35e-05 | 1.48e-12 | 0.027 |
| 1. PB | Q6NX28 | Leucine-rich repeat-containing protein 59 | 1.47e-05 | 8.20e-10 | 8.36e-06 |
| 1. PB | Q8N1G4 | Leucine-rich repeat-containing protein 47 | 1.55e-02 | 3.83e-14 | 0.046 |
| 1. PB | O75427 | Leucine-rich repeat and calponin homology domain-containing protein 4 | 1.07e-03 | 3.22e-13 | 0.004 |
| 1. PB | Q5VUJ6 | Leucine-rich repeat and calponin homology domain-containing protein 2 | 6.39e-03 | 5.39e-10 | 8.35e-05 |
| 1. PB | Q80TE7 | Leucine-rich repeat-containing protein 7 | 1.89e-01 | 2.83e-03 | 8.82e-04 |
| 1. PB | Q6NWG1 | Leucine-rich repeat-containing protein 59 | 2.92e-05 | 4.41e-09 | 8.29e-05 |
| 1. PB | Q9H069 | Dynein regulatory complex subunit 3 | 9.39e-06 | 6.88e-13 | 0.025 |
| 1. PB | Q9Y2L9 | Leucine-rich repeat and calponin homology domain-containing protein 1 | 1.68e-03 | 2.47e-07 | 6.07e-04 |
| 1. PB | Q96RT1 | Erbin | 5.79e-01 | 2.58e-03 | 3.07e-06 |
| 1. PB | Q8BVU0 | DISP complex protein LRCH3 | 1.96e-03 | 1.76e-16 | 0.004 |
| 1. PB | Q922Q8 | Leucine-rich repeat-containing protein 59 | 3.62e-04 | 3.84e-06 | 2.05e-05 |
| 1. PB | Q96II8 | DISP complex protein LRCH3 | 6.90e-03 | 6.22e-17 | 0.002 |
| 1. PB | Q80YS5 | Leucine-rich repeat-containing protein 27 | 1.51e-10 | 1.25e-65 | 0.0 |
| 1. PB | Q3UMG5 | Leucine-rich repeat and calponin homology domain-containing protein 2 | 4.50e-03 | 8.32e-11 | 4.17e-05 |
| 1. PB | Q3V1N1 | Malignant fibrous histiocytoma-amplified sequence 1 homolog | 1.19e-02 | 1.18e-02 | 3.17e-04 |
| 1. PB | Q80TH2 | Erbin | 3.01e-01 | 5.62e-04 | 7.43e-05 |
| 1. PB | Q9ERV7 | p53-induced death domain-containing protein 1 | 3.71e-01 | 1.71e-03 | 0.021 |
| 1. PB | Q80ZI6 | E3 ubiquitin-protein ligase LRSAM1 | 1.19e-05 | 2.43e-02 | 2.27e-11 |
| 1. PB | Q6PJG9 | Leucine-rich repeat and fibronectin type-III domain-containing protein 4 | 3.91e-02 | 1.17e-02 | 0.044 |
| 2. P | Q504C1 | Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 2 | 5.46e-02 | 8.43e-04 | NA |
| 2. P | Q95LL2 | X-ray radiation resistance-associated protein 1 (Fragment) | 9.86e-02 | 1.32e-07 | NA |
| 2. P | Q8IYG6 | Leucine-rich repeat-containing protein 56 | 2.21e-02 | 2.28e-06 | NA |
| 2. P | Q6IRU7 | Centrosomal protein of 78 kDa | 1.71e-02 | 2.92e-02 | NA |
| 2. P | Q3TAA7 | Serine/threonine-protein kinase 11-interacting protein | 6.01e-02 | 3.24e-02 | NA |
| 2. P | B3DH20 | Dynein axonemal assembly factor 11 | 4.05e-03 | 8.40e-05 | NA |
| 2. P | Q08817 | Leucine-rich repeat-containing protein SOG2 | 4.55e-03 | 1.45e-05 | NA |
| 2. P | W8DXL4 | Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 3 | 3.15e-02 | 1.50e-05 | NA |
| 2. P | Q8N309 | Leucine-rich repeat-containing protein 43 | 6.74e-02 | 2.18e-05 | NA |
| 2. P | B0BNK7 | Leucine-rich repeat and fibronectin type-III domain-containing protein 3 | 1.67e-02 | 3.21e-02 | NA |
| 2. P | Q68FM6 | Protein phosphatase 1 regulatory subunit 29 | 7.03e-03 | 1.43e-02 | NA |
| 2. P | Q326Z6 | E3 ubiquitin-protein ligase ipaH9.8 | 1.17e-02 | 1.53e-04 | NA |
| 2. P | Q86X45 | Dynein axonemal assembly factor 11 | 5.86e-03 | 7.03e-04 | NA |
| 2. P | Q80XU8 | Leucine-rich repeat and fibronectin type-III domain-containing protein 4 | 7.38e-02 | 1.72e-02 | NA |
| 2. P | Q8WUT4 | Leucine-rich repeat neuronal protein 4 | 7.56e-02 | 9.14e-03 | NA |
| 2. P | Q9NZU1 | Leucine-rich repeat transmembrane protein FLRT1 | 6.24e-02 | 2.17e-02 | NA |
| 2. P | Q8K375 | Leucine-rich repeat-containing protein 56 | 2.78e-02 | 1.57e-12 | NA |
| 2. P | Q28FY0 | Dynein axonemal assembly factor 11 | 2.92e-03 | 4.39e-03 | NA |
| 2. P | Q9VR52 | Protein tilB | 9.64e-02 | 8.70e-03 | NA |
| 2. P | O35930 | Platelet glycoprotein Ib alpha chain | 5.24e-02 | 2.43e-02 | NA |
| 2. P | Q8C8T7 | Protein ELFN1 | 1.56e-02 | 1.69e-03 | NA |
| 2. P | Q8VSC3 | E3 ubiquitin-protein ligase ipaH9.8 | 3.05e-03 | 2.72e-04 | NA |
| 2. P | Q9BTN0 | Leucine-rich repeat and fibronectin type-III domain-containing protein 3 | 4.25e-02 | 1.13e-02 | NA |
| 2. P | Q5XI54 | Dynein regulatory complex subunit 3 | 3.31e-05 | 9.80e-13 | NA |
| 2. P | Q8K0B3 | Leucine-rich repeat-containing protein 66 | 3.75e-02 | 1.54e-02 | NA |
| 2. P | Q9NJE9 | Dynein axonemal assembly factor 11 | 7.00e-03 | 6.66e-06 | NA |
| 2. P | A8IVX2 | Dynein regulatory complex subunit 3 | 1.22e-05 | 2.72e-12 | NA |
| 2. P | D2HFT7 | Leucine-rich repeat and fibronectin type-III domain-containing protein 3 | 8.09e-03 | 3.15e-02 | NA |
| 2. P | Q1RMS4 | Leucine-rich repeat and fibronectin type-III domain-containing protein 3 | 2.76e-02 | 7.27e-03 | NA |
| 2. P | B2TT54 | E3 ubiquitin-protein ligase ipaH9.8 | 9.12e-03 | 8.70e-04 | NA |
| 2. P | Q5Y2C3 | Histone H2A.Y | 5.70e-02 | 3.05e-05 | NA |
| 2. P | Q8N9M1 | Uncharacterized protein C19orf47 | 4.82e-01 | 4.58e-03 | NA |
| 2. P | Q14DL3 | Leucine-rich repeat and IQ domain-containing protein 3 | 4.57e-04 | 1.13e-11 | NA |
| 2. P | Q7ZV84 | Dynein axonemal assembly factor 1 | 1.62e-02 | 3.53e-04 | NA |
| 2. P | Q6AYH9 | Dynein axonemal assembly factor 1 | 3.08e-02 | 3.01e-02 | NA |
| 2. P | Q9ULH4 | Leucine-rich repeat and fibronectin type-III domain-containing protein 2 | 2.05e-01 | 1.36e-02 | NA |
| 2. P | Q5R3F8 | Protein phosphatase 1 regulatory subunit 29 | 3.83e-03 | 2.84e-02 | NA |
| 2. P | Q4R3F0 | Protein tilB homolog | 1.07e-03 | 3.30e-03 | NA |
| 2. P | Q6GPJ8 | Centrosomal protein of 97 kDa | 7.33e-03 | 1.33e-04 | NA |
| 2. P | Q8K099 | Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 1 | 3.99e-02 | 4.09e-03 | NA |
| 2. P | Q3SXY7 | Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 3 | 4.78e-02 | 5.95e-03 | NA |
| 2. P | Q505F5 | Leucine-rich repeat-containing protein 47 | 1.84e-02 | 1.51e-14 | NA |
| 2. P | A6NDA9 | Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 2 | 9.03e-03 | 2.27e-02 | NA |
| 2. P | A6PVS8 | Leucine-rich repeat and IQ domain-containing protein 3 | 1.66e-05 | 4.65e-11 | NA |
| 2. P | P18009 | Probable E3 ubiquitin-protein ligase ipaH4.5 | 9.15e-03 | 2.14e-03 | NA |
| 2. P | Q9BE71 | Leucine-rich repeat and fibronectin type-III domain-containing protein 2 | 1.60e-01 | 3.14e-03 | NA |
| 2. P | Q460M5 | Leucine-rich repeat and fibronectin type-III domain-containing protein 2 | 3.84e-02 | 4.48e-03 | NA |
| 2. P | Q5BGW9 | U2 small nuclear ribonucleoprotein A' | 1.17e-02 | 1.16e-03 | NA |
| 2. P | P07359 | Platelet glycoprotein Ib alpha chain | 5.01e-02 | 1.41e-02 | NA |
| 2. P | O88978 | Dynein axonemal assembly factor 11 | 9.06e-03 | 2.60e-04 | NA |
| 2. P | P18014 | Probable E3 ubiquitin-protein ligase ipaH7.8 | 1.15e-02 | 2.75e-03 | NA |
| 2. P | D2AJU0 | E3 ubiquitin-protein ligase ipaH9.8 | 4.90e-03 | 1.26e-03 | NA |
| 2. P | Q7L0X0 | TLR4 interactor with leucine rich repeats | 4.17e-02 | 5.80e-04 | NA |
| 2. P | Q6PFC5 | Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 2 | 1.68e-02 | 3.85e-02 | NA |
| 2. P | Q9JMH2 | Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 1 | 2.94e-02 | 2.48e-03 | NA |
| 2. P | Q6AYL8 | Leucine-rich repeat and IQ domain-containing protein 3 | 2.57e-04 | 1.04e-14 | NA |
| 2. P | Q8IW35 | Centrosomal protein of 97 kDa | 1.31e-02 | 2.85e-05 | NA |
| 2. P | Q9V4Q8 | Probable U2 small nuclear ribonucleoprotein A' | 3.89e-03 | 1.05e-02 | NA |
| 2. P | Q8CIM1 | Leucine-rich repeat-containing protein 45 | 1.78e-04 | 2.36e-02 | NA |
| 2. P | Q7PK92 | Dynein axonemal assembly factor 1 homolog | 7.83e-03 | 4.72e-03 | NA |
| 2. P | Q9DBY4 | TLR4 interactor with leucine rich repeats | 1.06e-02 | 8.80e-04 | NA |
| 2. P | Q83RJ4 | E3 ubiquitin-protein ligase ipaH3 | 1.36e-02 | 4.48e-04 | NA |
| 2. P | Q3U3V8 | X-ray radiation resistance-associated protein 1 | 2.32e-02 | 9.08e-05 | NA |
| 2. P | Q1RMR5 | Dynein axonemal assembly factor 11 | 1.30e-03 | 2.78e-04 | NA |
| 2. P | Q9CZ62 | Centrosomal protein of 97 kDa | 2.53e-02 | 1.44e-04 | NA |
| 2. P | Q3YTH5 | E3 ubiquitin-protein ligase ipaH9.8 | 1.31e-03 | 9.37e-04 | NA |
| 2. P | D4ABX8 | Leucine-rich repeat and fibronectin type-III domain-containing protein 4 | 2.61e-02 | 1.99e-02 | NA |
| 2. P | Q80TG9 | Leucine-rich repeat and fibronectin type-III domain-containing protein 2 | 8.43e-02 | 5.01e-03 | NA |
| 2. P | Q1EGL1 | Leucine-rich repeat LGI family member 2 | 1.56e-01 | 3.54e-02 | NA |
| 2. P | Q4V8C9 | Leucine-rich repeat-containing protein 56 | 5.04e-03 | 1.49e-09 | NA |
| 2. P | Q09JZ4 | Leucine-rich repeat-containing protein ODA7 | 1.28e-02 | 1.60e-07 | NA |
| 2. P | Q7PCK7 | X-ray radiation resistance-associated protein 1 (Fragment) | 1.32e-01 | 7.39e-08 | NA |
| 2. P | O43822 | Cilia- and flagella-associated protein 410 | 1.80e-02 | 3.34e-03 | NA |
| 2. P | Q90674 | Lutropin-choriogonadotropic hormone receptor | 7.49e-03 | 4.92e-02 | NA |
| 2. P | Q3V0L5 | Leucine-rich repeat-containing protein 43 | 8.32e-02 | 8.55e-06 | NA |
| 2. P | P59383 | Leucine-rich repeat neuronal protein 4 | 7.50e-02 | 4.34e-04 | NA |
| 2. P | Q9P2V4 | Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 1 | 1.48e-02 | 1.91e-03 | NA |
| 2. P | Q96FV0 | Leucine-rich repeat-containing protein 46 | 8.06e-03 | 1.59e-02 | NA |
| 2. P | Q496Z2 | TLR4 interactor with leucine rich repeats | 3.90e-02 | 8.25e-04 | NA |
| 2. P | Q95JT3 | Leucine-rich repeat-containing protein 43 | 8.74e-02 | 3.53e-04 | NA |
| 2. P | P32690 | Putative protein YjbI | 1.32e-01 | 3.09e-02 | NA |
| 2. P | Q5ZI11 | Leucine-rich repeat-containing protein 45 | 3.60e-04 | 5.99e-04 | NA |
| 2. P | A0A1L8G016 | Dynein axonemal assembly factor 11 | 5.02e-03 | 2.87e-04 | NA |
| 2. P | P0C7U0 | Protein ELFN1 | 4.86e-03 | 2.53e-03 | NA |
| 2. P | Q8N0V4 | Leucine-rich repeat LGI family member 2 | 1.70e-01 | 3.54e-02 | NA |
| 2. P | Q501X2 | Centrosomal protein of 72 kDa | 5.52e-04 | 9.95e-08 | NA |
| 2. P | Q31SH3 | E3 ubiquitin-protein ligase ipaH9.8 | 1.23e-03 | 3.38e-04 | NA |
| 2. P | Q8C6G1 | Cilia- and flagella-associated protein 410 | 3.16e-02 | 3.54e-02 | NA |
| 2. P | Q6P2D8 | X-ray radiation resistance-associated protein 1 | 9.96e-02 | 8.59e-05 | NA |
| 2. P | Q54NK3 | Putative protein DDB_G0285185 | 2.06e-02 | 1.13e-05 | NA |
| 2. P | Q5F479 | Serine/threonine-protein kinase 11-interacting protein | 1.68e-01 | 3.97e-03 | NA |
| 3. B | Q54XZ5 | Probable serine/threonine-protein kinase DDB_G0278509 | 1.18e-01 | NA | 0.030 |
| 3. B | Q0GC71 | Toll-like receptor 2 | 4.13e-01 | NA | 0.024 |
| 3. B | Q80U72 | Protein scribble homolog | 2.88e-01 | NA | 0.001 |
| 3. B | Q8S7M7 | Plant intracellular Ras-group-related LRR protein 5 | 2.07e-02 | NA | 3.44e-06 |
| 3. B | Q810C1 | SLIT and NTRK-like protein 1 | 1.47e-02 | NA | 0.018 |
| 3. B | Q9FII5 | Leucine-rich repeat receptor-like protein kinase TDR | 9.46e-02 | NA | 0.027 |
| 3. B | P0CP22 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 4.34e-02 | NA | 6.13e-06 |
| 3. B | Q96PX8 | SLIT and NTRK-like protein 1 | 2.10e-02 | NA | 0.003 |
| 3. B | Q8VEG6 | CCR4-NOT transcription complex subunit 6-like | 4.72e-03 | NA | 2.60e-07 |
| 3. B | Q75BI3 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 1.38e-01 | NA | 6.00e-06 |
| 3. B | B0M0P8 | Ras guanine nucleotide exchange factor L | 7.88e-01 | NA | 0.003 |
| 3. B | Q9BYS8 | Leucine-rich repeat-containing protein 2 | 6.14e-03 | NA | 0.045 |
| 3. B | Q24020 | Protein flightless-1 | 1.19e-01 | NA | 0.002 |
| 3. B | Q8AVI4 | Leucine-rich repeat protein SHOC-2 | 2.82e-06 | NA | 2.35e-08 |
| 3. B | Q4WQG5 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 3.33e-02 | NA | 2.85e-05 |
| 3. B | B4IBI9 | Leucine-rich repeat protein soc-2 homolog | 1.33e-03 | NA | 2.54e-10 |
| 3. B | A2BHJ4 | CCR4-NOT transcription complex subunit 6-like | 9.08e-03 | NA | 1.07e-06 |
| 3. B | Q2UUI3 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 2.58e-02 | NA | 1.13e-06 |
| 3. B | Q8IWT6 | Volume-regulated anion channel subunit LRRC8A | 9.17e-02 | NA | 1.67e-06 |
| 3. B | Q5RFE9 | Leucine-rich repeat-containing protein 40 | 3.15e-04 | NA | 9.58e-05 |
| 3. B | Q5RAV5 | Leucine-rich repeat protein SHOC-2 | 3.02e-06 | NA | 1.58e-06 |
| 3. B | Q7XK44 | Plant intracellular Ras-group-related LRR protein 3 | 4.42e-03 | NA | 8.46e-07 |
| 3. B | Q8N456 | Leucine-rich repeat-containing protein 18 | 7.23e-03 | NA | 2.85e-06 |
| 3. B | Q7L1W4 | Volume-regulated anion channel subunit LRRC8D | 7.81e-02 | NA | 0.001 |
| 3. B | Q5S007 | Leucine-rich repeat serine/threonine-protein kinase 2 | 6.89e-01 | NA | 0.018 |
| 3. B | P82963 | Chaoptin (Fragment) | 1.91e-01 | NA | 4.17e-04 |
| 3. B | Q9DE68 | Decorin | 1.82e-02 | NA | 0.041 |
| 3. B | Q9D9Q0 | Leucine-rich repeat-containing protein 69 | 3.30e-02 | NA | 3.39e-06 |
| 3. B | Q5G5E0 | Plant intracellular Ras-group-related LRR protein 5 | 3.16e-02 | NA | 1.60e-05 |
| 3. B | Q9LRV8 | Plant intracellular Ras-group-related LRR protein 2 | 2.05e-03 | NA | 0.002 |
| 3. B | Q7SXW3 | Leucine-rich repeat-containing protein 40 | 6.21e-04 | NA | 1.45e-06 |
| 3. B | Q9UQ13 | Leucine-rich repeat protein SHOC-2 | 2.89e-06 | NA | 1.58e-06 |
| 3. B | Q80VQ1 | Leucine-rich repeat-containing protein 1 | 1.50e-02 | NA | 1.75e-04 |
| 3. B | Q6FRT2 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 1.60e-01 | NA | 2.05e-05 |
| 3. B | Q5G5D8 | Plant intracellular Ras-group-related LRR protein 7 | 4.29e-03 | NA | 6.89e-04 |
| 3. B | O88520 | Leucine-rich repeat protein SHOC-2 | 2.88e-06 | NA | 2.56e-07 |
| 3. B | Q6K7R2 | Plant intracellular Ras-group-related LRR protein 6 | 2.13e-03 | NA | 6.64e-06 |
| 3. B | Q9DBB9 | Carboxypeptidase N subunit 2 | 3.74e-02 | NA | 3.51e-05 |
| 3. B | O94991 | SLIT and NTRK-like protein 5 | 6.87e-02 | NA | 0.008 |
| 3. B | Q6AYI5 | Leucine-rich repeat protein SHOC-2 | 2.92e-06 | NA | 6.26e-07 |
| 3. B | P08678 | Adenylate cyclase | 5.78e-01 | NA | 0.017 |
| 3. B | Q5E9C0 | Ras suppressor protein 1 | 2.05e-04 | NA | 2.92e-05 |
| 3. B | Q4P9T3 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 1.04e-02 | NA | 1.25e-05 |
| 3. B | P14605 | Adenylate cyclase | 2.95e-01 | NA | 0.001 |
| 3. B | Q86WK6 | Amphoterin-induced protein 1 | 1.66e-02 | NA | 0.028 |
| 3. B | Q4H4B6 | Protein scribble homolog | 2.87e-01 | NA | 0.002 |
| 3. B | Q6GPJ5 | Leucine-rich repeat-containing protein 40 | 1.44e-03 | NA | 1.26e-07 |
| 3. B | Q9CQ07 | Leucine-rich repeat-containing protein 18 | 1.82e-03 | NA | 7.84e-07 |
| 3. B | F1R6I3 | Leucine-rich repeat-containing protein 39 | 1.07e-03 | NA | 0.001 |
| 3. B | B5DX45 | Leucine-rich repeat protein soc-2 homolog | 5.51e-05 | NA | 1.26e-08 |
| 3. B | Q6DHL5 | Leucine-rich repeat-containing protein 57 | 1.70e-03 | NA | 2.01e-05 |
| 3. B | Q55CS7 | MAP kinase phosphatase with leucine-rich repeats protein 1 | 2.92e-02 | NA | 0.017 |
| 3. B | Q8W4Q3 | Plant intracellular Ras-group-related LRR protein 3 | 2.58e-02 | NA | 4.04e-04 |
| 3. B | Q9RBS2 | Protein PopC | 1.13e-02 | NA | 0.001 |
| 3. B | Q42484 | Disease resistance protein RPS2 | 2.50e-01 | NA | 0.003 |
| 3. B | B4N9T4 | Leucine-rich repeat protein soc-2 homolog | 6.63e-05 | NA | 1.19e-09 |
| 3. B | A1CW67 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 7.84e-02 | NA | 1.35e-05 |
| 3. B | Q5XH73 | CCR4-NOT transcription complex subunit 6-like-B | 1.48e-02 | NA | 0.039 |
| 3. B | D3ZAL8 | Leucine-rich repeat transmembrane neuronal protein 3 | 2.52e-02 | NA | 0.003 |
| 3. B | Q9BTT6 | Leucine-rich repeat-containing protein 1 | 3.06e-03 | NA | 1.84e-04 |
| 3. B | Q6R5N8 | Toll-like receptor 13 | 6.28e-02 | NA | 5.06e-04 |
| 3. B | B3P3E8 | Leucine-rich repeat protein soc-2 homolog | 8.06e-05 | NA | 5.84e-10 |
| 3. B | O61967 | Protein lap1 | 4.92e-02 | NA | 6.25e-04 |
| 3. B | Q9N0E3 | Reticulon-4 receptor | 3.59e-02 | NA | 0.008 |
| 3. B | B4JTV9 | Leucine-rich repeat protein soc-2 homolog | 4.01e-05 | NA | 2.52e-10 |
| 3. B | Q0U7W4 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 1.22e-02 | NA | 2.84e-06 |
| 3. B | Q80TM9 | Nischarin | 2.14e-01 | NA | 0.002 |
| 3. B | P40197 | Platelet glycoprotein V | 8.28e-02 | NA | 0.023 |
| 3. B | A8JAM0 | Dynein regulatory complex subunit 7 (Fragment) | 2.32e-01 | NA | 1.36e-04 |
| 3. B | Q4R6F0 | Leucine-rich repeat and death domain-containing protein 1 | 4.80e-02 | NA | 0.002 |
| 3. B | Q96NW7 | Leucine-rich repeat-containing protein 7 | 6.55e-01 | NA | 4.13e-04 |
| 3. B | Q9JJ28 | Protein flightless-1 homolog | 1.15e-01 | NA | 0.002 |
| 3. B | F1MLX5 | Leucine-rich repeat-containing G-protein coupled receptor 4 | 1.97e-03 | NA | 2.24e-04 |
| 3. B | Q86VH5 | Leucine-rich repeat transmembrane neuronal protein 3 | 2.81e-02 | NA | 0.003 |
| 3. B | B0W6M9 | Leucine-rich repeat protein soc-2 homolog | 1.09e-04 | NA | 1.42e-07 |
| 3. B | Q810B7 | SLIT and NTRK-like protein 5 | 8.72e-02 | NA | 0.007 |
| 3. B | Q8RXS5 | Probable disease resistance protein At5g63020 | 5.56e-01 | NA | 0.001 |
| 3. B | O02833 | Insulin-like growth factor-binding protein complex acid labile subunit | 8.90e-03 | NA | 0.009 |
| 3. B | Q8TDW0 | Volume-regulated anion channel subunit LRRC8C | 2.73e-02 | NA | 7.87e-04 |
| 3. B | P12024 | Chaoptin | 2.67e-01 | NA | 5.53e-06 |
| 3. B | Q15404 | Ras suppressor protein 1 | 3.85e-04 | NA | 1.55e-05 |
| 3. B | Q8BGR2 | Volume-regulated anion channel subunit LRRC8D | 7.69e-02 | NA | 0.001 |
| 3. B | Q9SGP2 | Receptor-like protein kinase HSL1 | 7.66e-02 | NA | 0.013 |
| 3. B | Q55FD8 | Ras guanine nucleotide exchange factor V | 2.03e-01 | NA | 0.014 |
| 3. B | Q5M8G4 | Leucine-rich repeat-containing protein 40 | 1.05e-04 | NA | 7.80e-07 |
| 3. B | D3ZXS4 | Leucine-rich repeat-containing protein 39 | 7.69e-03 | NA | 6.78e-05 |
| 3. B | Q9CRC8 | Leucine-rich repeat-containing protein 40 | 8.49e-05 | NA | 1.48e-04 |
| 3. B | P31384 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 7.19e-02 | NA | 8.35e-07 |
| 3. B | Q9BXB1 | Leucine-rich repeat-containing G-protein coupled receptor 4 | 2.32e-03 | NA | 0.003 |
| 3. B | A4IIK1 | Malignant fibrous histiocytoma-amplified sequence 1 homolog | 1.44e-02 | NA | 3.06e-05 |
| 3. B | A8XWW4 | Leucine-rich repeat protein soc-2 | 1.53e-04 | NA | 1.87e-04 |
| 3. B | Q55CS8 | MAP kinase phosphatase with leucine-rich repeats protein 2 | 1.54e-02 | NA | 0.004 |
| 3. B | Q5DU41 | Volume-regulated anion channel subunit LRRC8B | 1.24e-01 | NA | 1.13e-06 |
| 3. B | Q9FK63 | Calmodulin-binding receptor kinase CaMRLK | 2.41e-02 | NA | 0.020 |
| 3. B | O74874 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 1.99e-02 | NA | 4.00e-06 |
| 3. B | Q9H5Y7 | SLIT and NTRK-like protein 6 | 4.66e-02 | NA | 0.010 |
| 3. B | Q6BMM5 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 7.27e-02 | NA | 1.82e-08 |
| 3. B | Q8SU52 | Probable CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 6.36e-03 | NA | 5.87e-04 |
| 3. B | Q55E58 | Probable serine/threonine-protein kinase pats1 | NA | NA | 2.32e-06 |
| 3. B | Q54Y32 | MAP kinase phosphatase with leucine-rich repeats protein 3 | 3.21e-02 | NA | 1.82e-04 |
| 3. B | Q54AX5 | Leucine-rich repeat protein lrrA | 6.75e-05 | NA | 2.16e-06 |
| 3. B | A2ARI4 | Leucine-rich repeat-containing G-protein coupled receptor 4 | 1.00e-03 | NA | 0.017 |
| 3. B | Q7XNY1 | Plant intracellular Ras-group-related LRR protein 1 | 8.04e-04 | NA | 0.004 |
| 3. B | A1CIJ6 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 7.96e-03 | NA | 9.08e-05 |
| 3. B | Q5ZLN0 | Leucine-rich repeat-containing protein 40 | 1.06e-03 | NA | 1.12e-06 |
| 3. B | Q6NU09 | Volume-regulated anion channel subunit LRRC8E | 7.94e-02 | NA | 1.03e-04 |
| 3. B | B9F655 | Plant intracellular Ras-group-related LRR protein 7 | 3.62e-04 | NA | 1.22e-06 |
| 3. B | Q810B8 | SLIT and NTRK-like protein 4 | 4.59e-02 | NA | 8.37e-04 |
| 3. B | Q6ZVD8 | PH domain leucine-rich repeat-containing protein phosphatase 2 | 4.56e-01 | NA | 8.03e-04 |
| 3. B | Q01730 | Ras suppressor protein 1 | 3.55e-04 | NA | 0.003 |
| 3. B | B3LWU3 | Leucine-rich repeat protein soc-2 homolog | 6.10e-05 | NA | 1.60e-09 |
| 3. B | B7XK66 | Probable CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 2.34e-02 | NA | 1.14e-06 |
| 3. B | Q8C110 | SLIT and NTRK-like protein 6 | 2.18e-02 | NA | 0.015 |
| 3. B | Q9WTR8 | PH domain leucine-rich repeat protein phosphatase 1 | 8.05e-01 | NA | 8.82e-05 |
| 3. B | Q1L8Y7 | Leucine-rich repeat protein SHOC-2 | 2.28e-06 | NA | 1.81e-07 |
| 3. B | B4QVR7 | Leucine-rich repeat protein soc-2 homolog | 1.34e-03 | NA | 7.50e-10 |
| 3. B | B4PU77 | Leucine-rich repeat protein soc-2 homolog | 7.63e-05 | NA | 6.32e-10 |
| 3. B | Q5A761 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 2.61e-02 | NA | 6.13e-08 |
| 3. B | Q6P9F7 | Volume-regulated anion channel subunit LRRC8B | 1.69e-01 | NA | 5.63e-06 |
| 3. B | Q22875 | Leucine-rich repeat protein soc-2 | 3.30e-05 | NA | 4.14e-05 |
| 3. B | Q4R3P6 | Leucine-rich repeat-containing protein 40 | 8.80e-04 | NA | 4.29e-05 |
| 3. B | Q6XHB2 | Probable serine/threonine-protein kinase roco4 | 4.80e-01 | NA | 1.33e-05 |
| 3. B | Q8BZ81 | Leucine-rich repeat transmembrane neuronal protein 3 | 2.06e-02 | NA | 0.002 |
| 3. B | P24014 | Protein slit | 4.65e-01 | NA | 0.008 |
| 3. B | Q96LI5 | CCR4-NOT transcription complex subunit 6-like | 3.59e-02 | NA | 0.014 |
| 3. B | Q4G017 | Nischarin | 6.22e-01 | NA | 0.029 |
| 3. B | A6NIV6 | Leucine-rich repeat and IQ domain-containing protein 4 | 1.70e-02 | NA | 1.22e-09 |
| 3. B | Q05C16 | Leucine-rich repeat-containing protein 63 | 6.53e-02 | NA | 0.009 |
| 3. B | Q6NSJ5 | Volume-regulated anion channel subunit LRRC8E | 5.97e-02 | NA | 0.035 |
| 3. B | Q6Z8P4 | Plant intracellular Ras-group-related LRR protein 4 | 1.00e-04 | NA | 2.43e-04 |
| 3. B | Q498T9 | Volume-regulated anion channel subunit LRRC8C | 3.21e-02 | NA | 3.33e-04 |
| 3. B | Q96DD0 | Leucine-rich repeat-containing protein 39 | 7.51e-03 | NA | 3.76e-05 |
| 3. B | O64566 | Plant intracellular Ras-group-related LRR protein 6 | 1.82e-03 | NA | 8.51e-05 |
| 3. B | P0C895 | LRR repeats and ubiquitin-like domain-containing protein At2g30105 | 9.06e-04 | NA | 0.009 |
| 3. B | Q01513 | Adenylate cyclase | 7.88e-01 | NA | 6.40e-04 |
| 3. B | Q8K3P5 | CCR4-NOT transcription complex subunit 6 | 1.83e-02 | NA | 2.00e-08 |
| 3. B | Q13045 | Protein flightless-1 homolog | 1.56e-01 | NA | 8.54e-05 |
| 3. B | Q9ZPS9 | Serine/threonine-protein kinase BRI1-like 2 | 2.33e-01 | NA | 0.005 |
| 3. B | Q810C0 | SLIT and NTRK-like protein 2 | 6.57e-02 | NA | 0.048 |
| 3. B | Q8C0R9 | Leucine-rich repeat and death domain-containing protein 1 | 3.51e-03 | NA | 1.02e-04 |
| 3. B | Q9BZR6 | Reticulon-4 receptor | 2.91e-02 | NA | 0.012 |
| 3. B | Q5BJ41 | CCR4-NOT transcription complex subunit 6 | 5.90e-03 | NA | 1.93e-08 |
| 3. B | Q54WS5 | Probable serine/threonine-protein kinase roco6 | 6.77e-01 | NA | 0.021 |
| 3. B | P0CP23 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 6.14e-02 | NA | 6.24e-06 |
| 3. B | Q9H9A6 | Leucine-rich repeat-containing protein 40 | 1.22e-04 | NA | 1.79e-04 |
| 3. B | O94294 | Leucine-rich repeat-containing protein sog2 | 1.76e-03 | NA | 1.24e-04 |
| 3. B | Q54M77 | Probable serine/threonine-protein kinase roco8 | 4.80e-01 | NA | 0.001 |
| 3. B | Q8BGI7 | Leucine-rich repeat-containing protein 39 | 5.46e-03 | NA | 1.32e-05 |
| 3. B | Q7XDQ7 | Plant intracellular Ras-group-related LRR protein 8 | 4.26e-04 | NA | 5.08e-04 |
| 3. B | Q8TCA0 | Leucine-rich repeat-containing protein 20 | 4.35e-05 | NA | 0.004 |
| 3. B | E9Q7T7 | Chondroadherin-like protein | 5.78e-02 | NA | 0.002 |
| 3. B | Q66JT1 | Volume-regulated anion channel subunit LRRC8E | 1.60e-01 | NA | 0.010 |
| 3. B | Q9ULM6 | CCR4-NOT transcription complex subunit 6 | 2.33e-02 | NA | 6.47e-08 |
| 3. B | Q8MVR1 | Cyclic GMP-binding protein C | 5.65e-01 | NA | 1.60e-07 |
| 3. B | Q6CJU4 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 2.28e-01 | NA | 2.66e-07 |
| 3. B | Q14160 | Protein scribble homolog | 4.49e-01 | NA | 0.002 |
| 3. B | Q9V780 | Protein lap1 | 1.22e-01 | NA | 0.001 |
| 3. B | Q7KRY7 | Protein lap4 | 5.76e-01 | NA | 4.27e-05 |
| 3. B | Q9C2R2 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 2.48e-02 | NA | 0.001 |
| 3. B | Q6XHA7 | Probable serine/threonine-protein kinase roco9 | NA | NA | 0.024 |
| 3. B | Q4V8I7 | Volume-regulated anion channel subunit LRRC8A | 1.73e-01 | NA | 6.94e-06 |
| 3. B | Q8RWE5 | Plant intracellular Ras-group-related LRR protein 8 | 1.33e-04 | NA | 1.44e-05 |
| 3. B | Q01631 | Adenylate cyclase | 8.24e-01 | NA | 0.025 |
| 3. B | Q9SVW8 | Plant intracellular Ras-group-related LRR protein 4 | 9.27e-03 | NA | 1.24e-04 |
| 3. B | A6QLV3 | Leucine-rich repeat protein SHOC-2 | 3.12e-06 | NA | 1.58e-06 |
| 3. B | A6H6A4 | Leucine-rich repeat and IQ domain-containing protein 4 | 1.55e-04 | NA | 1.32e-08 |
| 3. B | A5PK13 | Volume-regulated anion channel subunit LRRC8C | 4.39e-02 | NA | 7.28e-04 |
| 3. B | C4V7I7 | Probable CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 1.26e-02 | NA | 7.99e-09 |
| 3. B | Q6AXU9 | CCR4-NOT transcription complex subunit 6 | 6.63e-03 | NA | 2.00e-08 |
| 3. B | Q86X40 | Leucine-rich repeat-containing protein 28 | 1.12e-02 | NA | 0.005 |
| 3. B | Q6NUI6 | Chondroadherin-like protein | 5.25e-02 | NA | 2.98e-04 |
| 3. B | Q3TX51 | Leucine-rich repeat-containing protein 28 | 6.32e-03 | NA | 3.94e-05 |
| 3. B | Q1EA11 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 5.48e-03 | NA | 2.86e-07 |
| 3. B | Q0CT27 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 1.85e-02 | NA | 4.42e-07 |
| 3. B | Q8IW52 | SLIT and NTRK-like protein 4 | 8.94e-02 | NA | 7.75e-04 |
| 3. B | P49606 | Adenylate cyclase | 6.14e-01 | NA | 6.53e-06 |
| 3. B | Q5U308 | Volume-regulated anion channel subunit LRRC8D | 6.59e-02 | NA | 1.75e-04 |
| 3. B | P22792 | Carboxypeptidase N subunit 2 | 4.09e-02 | NA | 8.93e-04 |
| 3. B | Q5RAC4 | SLIT and NTRK-like protein 1 | 9.11e-02 | NA | 0.003 |
| 3. B | Q9LVT4 | Probable disease resistance protein At5g47250 | 2.19e-01 | NA | 2.27e-04 |
| 3. B | Q5B778 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 1.06e-02 | NA | 1.11e-08 |
| 3. B | Q1ZXD6 | Probable serine/threonine-protein kinase roco5 | NA | NA | 6.32e-07 |
| 3. B | Q8VYG9 | Plant intracellular Ras-group-related LRR protein 9 | 5.26e-04 | NA | 5.86e-08 |
| 3. B | Q9FFJ3 | Plant intracellular Ras-group-related LRR protein 1 | 5.62e-04 | NA | 6.70e-07 |
| 3. B | Q8BXA7 | PH domain leucine-rich repeat-containing protein phosphatase 2 | 3.71e-01 | NA | 0.006 |
| 3. B | P28675 | Decorin | 5.29e-03 | NA | 0.015 |
| 3. B | B4LXW1 | Leucine-rich repeat protein soc-2 homolog | 2.91e-05 | NA | 3.27e-10 |
| 3. B | Q9Z2H4 | Leucine-rich repeat-containing G-protein coupled receptor 4 | 1.44e-02 | NA | 0.003 |
| 3. B | Q8CHE4 | PH domain leucine-rich repeat-containing protein phosphatase 1 | 5.35e-01 | NA | 1.58e-04 |
| 3. B | Q3ZC49 | Leucine-rich repeat-containing protein 39 | 7.35e-03 | NA | 2.92e-05 |
| 3. B | Q6GLE8 | Leucine-rich repeat-containing protein 28 | 7.10e-03 | NA | 2.97e-05 |
| 3. B | A4D1F6 | Leucine-rich repeat and death domain-containing protein 1 | 9.73e-03 | NA | 0.001 |
| 3. B | Q9VEK6 | Leucine-rich repeat protein soc-2 homolog | 9.05e-05 | NA | 6.41e-10 |
| 3. B | Q8R502 | Volume-regulated anion channel subunit LRRC8C | 1.65e-01 | NA | 3.92e-04 |
| 3. B | Q9H156 | SLIT and NTRK-like protein 2 | 1.98e-02 | NA | 0.008 |
| 3. B | A7SFP1 | Leucine-rich repeat protein soc-2 homolog | 1.66e-04 | NA | 1.54e-05 |
| 3. B | P23466 | Adenylate cyclase | 6.07e-01 | NA | 0.005 |
| 3. B | Q6XHA5 | Probable serine/threonine-protein kinase roco11 | 2.86e-01 | NA | 2.03e-06 |
| 3. B | Q5F4C4 | Leucine-rich repeat protein SHOC-2 | 2.93e-03 | NA | 6.46e-08 |
| 3. B | Q9BGP6 | Leucine-rich repeat transmembrane neuronal protein 3 | 2.54e-02 | NA | 0.003 |
| 3. B | O60346 | PH domain leucine-rich repeat-containing protein phosphatase 1 | 7.41e-01 | NA | 0.001 |
| 3. B | Q54TM7 | Probable serine/threonine-protein kinase drkD | 2.82e-02 | NA | 0.004 |
| 3. B | Q5FVI3 | Leucine-rich repeat-containing protein 57 | 1.10e-03 | NA | 0.036 |
| 3. B | A2Q9L0 | CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 | 1.29e-02 | NA | 4.58e-08 |
| 3. B | Q2PZH4 | Toll-like receptor 2 | 1.11e-01 | NA | 0.022 |
| 3. B | Q6ZH85 | Plant intracellular Ras-group-related LRR protein 2 | 2.86e-02 | NA | 8.37e-04 |
| 3. B | Q80WG5 | Volume-regulated anion channel subunit LRRC8A | 8.59e-02 | NA | 8.18e-07 |
| 3. B | O64973 | Disease resistance protein RPS5 | 4.61e-01 | NA | 3.69e-04 |
| 3. B | Q32KX5 | Leucine-rich repeat-containing protein 28 | 1.87e-02 | NA | 0.002 |