Results | PROST

Summary

Q9C0I9

Homolog: Q80YS5.
Function: Leucine-rich repeat-containing protein 27.

Statistics

Total GO Annotation: 435
Unique PROST Go: 124
Unique BLAST Go: 258

Total Homologs: 336
Unique PROST Homologs: 91
Unique BLAST Homologs: 209

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q80YS5 (Leucine-rich repeat-containing protein 27) with a FATCAT P-Value: 1.51e-10 and RMSD of 3.27 angstrom. The sequence alignment identity is 55.0%.
Structural alignment shown in left. Query protein Q9C0I9 colored as red in alignment, homolog Q80YS5 colored as blue. Query protein Q9C0I9 is also shown in right top, homolog Q80YS5 showed in right bottom. They are colored based on secondary structures.

  Q9C0I9 MEGSSSYEV-------PSVAAADL-EEGAGQTRSLPATPSKDVH---KG-----VGGIIFSSSPILDLSESGLCRLEEVFRIPSLQQLHLQRNALCVIPQ 84
  Q80YS5 MEDTSPQAVAEKAAKDPK-AAKDLKDDAAAATKSFP-----D-HFSREGDDQMDFEGVIFSSSPVLDLSQRGLRHLGKFFKIPNLQQLHLQRNLLREIPE 93

  Q9C0I9 DFFQLLPNLTWLDLRYNRIKALPSGIGAHQHLKTLLLERNPIKMLPVELGSVTTLKALNLRHCPLEFPPQLVVQKGLVAIQRFLRMWAVEHSLPRN---P 181
  Q80YS5 DFFQLLPNLTWLDLRYNKIKVLPSGIGSHKHLKTLLLERNPIKMLPVELGQVTTLTALNLRHCPLEFPPRLIVQKGLVAILTFLRICSVEKAFPGDELLP 193

  Q9C0I9 -TSQEAPPVREMTLRDLPSPGLEL--SGDHASNQGAVNAQDPEGAVMKEKASFLPPVEKPDLSELRKSADSSENWPSEEEIRRFWKLRQEIVEHVKADVL 278
  Q80YS5 EVS--AP---KMGSNDLQYPVLPLPRKGSPSEN--SLN--DPDQE--KEKADFFPPMERLDLSELRKSNAASEIWPSKEEIRRFWKLRQEIVENEQVEIQ 282

  Q9C0I9 GDQLLTRELPPNLKAALNI-EKELPKPRHVFRRKTASSRSILPDLLSPYQMAIRAKRLEESRAAALRELQEKQALMEQQRREKRALQEWRERAQRMRKRK 377
  Q80YS5 EKKLLAVELPPNLKAALNVKEKKHRKPWPAVRKRSTSFKGILPNLPSGYQNTVHANRMEDTHKAALQELQEKETVLEQRRRDKRALQEWREQTQHMRTRR 382

  Q9C0I9 EELSKLLPPRRSMVASKIPSATDLIDNRKVPLNPPGKMKPSKEKSPQASKEMSA--LQERNLEEKIKQHVLQMREQRRFHGQAPLEEMRKAAEDLEIATE 475
  Q80YS5 -ELSKLQPPHSNMMASKIPFATDLTDYEKMPVSPFGKVKPSGEGTAQRPIEISASPLAE--LEDKIKRHTQQIR-TRSFLGTNPMQDIKTANQDLETTKK 478

  Q9C0I9 LQDEVLKLKLGLTLNKDRRRAALTGNLSLGLPAAQPQNTFFNTKYGESGNVRRYQ 530
  Q80YS5 LQEELRKLKVEMTLNKDHPFPSFTGNLSLHPPASQPQNIFFNTKS---------- 523

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
1. PB	GO:0006954	inflammatory response
1. PB	GO:0098978	glutamatergic synapse
1. PB	GO:0099560	synaptic membrane adhesion
1. PB	GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest
1. PB	GO:0016323	basolateral plasma membrane
1. PB	GO:0030054	cell junction
1. PB	GO:0043030	regulation of macrophage activation
1. PB	GO:0097120	receptor localization to synapse
1. PB	GO:0070433	negative regulation of nucleotide-binding oligomerization domain containing 2 signaling pathway
1. PB	GO:0043113	receptor clustering
1. PB	GO:0010976	positive regulation of neuron projection development
1. PB	GO:0045806	negative regulation of endocytosis
1. PB	GO:2000405	negative regulation of T cell migration
1. PB	GO:2000786	positive regulation of autophagosome assembly
1. PB	GO:0098982	GABA-ergic synapse
1. PB	GO:0045197	establishment or maintenance of epithelial cell apical/basal polarity
1. PB	GO:0051721	protein phosphatase 2A binding
1. PB	GO:0045175	basal protein localization
1. PB	GO:0030056	hemidesmosome
1. PB	GO:0046579	positive regulation of Ras protein signal transduction
1. PB	GO:0031514	motile cilium
1. PB	GO:0032185	septin cytoskeleton organization
1. PB	GO:1900745	positive regulation of p38MAPK cascade
1. PB	GO:0034121	regulation of toll-like receptor signaling pathway
1. PB	GO:0034136	negative regulation of toll-like receptor 2 signaling pathway
1. PB	GO:0032495	response to muramyl dipeptide
1. PB	GO:1990869	cellular response to chemokine
1. PB	GO:1904417	positive regulation of xenophagy
1. PB	GO:0035308	negative regulation of protein dephosphorylation
1. PB	GO:1905606	regulation of presynapse assembly
1. PB	GO:0034260	negative regulation of GTPase activity
1. PB	GO:0031012	extracellular matrix
1. PB	GO:0014069	postsynaptic density
1. PB	GO:0045087	innate immune response
1. PB	GO:0051897	positive regulation of protein kinase B signaling
1. PB	GO:0071638	negative regulation of monocyte chemotactic protein-1 production
1. PB	GO:0043194	axon initial segment
1. PB	GO:1900181	negative regulation of protein localization to nucleus
1. PB	GO:0043122	regulation of I-kappaB kinase/NF-kappaB signaling
1. PB	GO:0042645	mitochondrial nucleoid
1. PB	GO:0070086	ubiquitin-dependent endocytosis
1. PB	GO:0005789	endoplasmic reticulum membrane
1. PB	GO:0046755	viral budding
1. PB	GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors
1. PB	GO:0099072	regulation of postsynaptic membrane neurotransmitter receptor levels
1. PB	GO:0032088	negative regulation of NF-kappaB transcription factor activity
1. PB	GO:0034137	positive regulation of toll-like receptor 2 signaling pathway
1. PB	GO:0005635	nuclear envelope
1. PB	GO:0005176	ErbB-2 class receptor binding
1. PB	GO:0007165	signal transduction
1. PB	GO:0099061	integral component of postsynaptic density membrane
1. PB	GO:0031362	anchored component of external side of plasma membrane
1. PB	GO:0034144	negative regulation of toll-like receptor 4 signaling pathway
2. P	GO:0035082	axoneme assembly
2. P	GO:0060438	trachea development
2. P	GO:0005686	U2 snRNP
2. P	GO:0003351	epithelial cilium movement involved in extracellular fluid movement
2. P	GO:0002718	regulation of cytokine production involved in immune response
2. P	GO:0030424	axon
2. P	GO:0034451	centriolar satellite
2. P	GO:0085032	modulation by symbiont of host I-kappaB kinase/NF-kappaB cascade
2. P	GO:0071907	determination of digestive tract left/right asymmetry
2. P	GO:1904862	inhibitory synapse assembly
2. P	GO:1901673	regulation of mitotic spindle assembly
2. P	GO:0004864	protein phosphatase inhibitor activity
2. P	GO:0099179	regulation of synaptic membrane adhesion
2. P	GO:1902018	negative regulation of cilium assembly
2. P	GO:0005929	cilium
2. P	GO:0004842	ubiquitin-protein transferase activity
2. P	GO:0120293	dynein axonemal particle
2. P	GO:0030620	U2 snRNA binding
2. P	GO:0007599	hemostasis
2. P	GO:0060076	excitatory synapse
2. P	GO:0009986	cell surface
2. P	GO:0005615	extracellular space
2. P	GO:0033566	gamma-tubulin complex localization
2. P	GO:0050896	response to stimulus
2. P	GO:0050808	synapse organization
2. P	GO:0052083	suppression by symbiont of host cell-mediated immune response
2. P	GO:0030175	filopodium
2. P	GO:0001750	photoreceptor outer segment
2. P	GO:0003341	cilium movement
2. P	GO:0048793	pronephros development
2. P	GO:0071910	determination of liver left/right asymmetry
2. P	GO:0099059	integral component of presynaptic active zone membrane
2. P	GO:0016605	PML body
2. P	GO:0060287	epithelial cilium movement involved in determination of left/right asymmetry
2. P	GO:0034055	effector-mediated induction of programmed cell death in host
2. P	GO:0008542	visual learning
2. P	GO:0044164	host cell cytosol
2. P	GO:0070840	dynein complex binding
2. P	GO:0060285	cilium-dependent cell motility
2. P	GO:0016540	protein autoprocessing
2. P	GO:0060972	left/right pattern formation
2. P	GO:0120229	protein localization to motile cilium
2. P	GO:0045433	male courtship behavior, veined wing generated song production
2. P	GO:0008104	protein localization
2. P	GO:0030030	cell projection organization
2. P	GO:0036159	inner dynein arm assembly
2. P	GO:0051649	establishment of localization in cell
2. P	GO:0015057	thrombin-activated receptor activity
2. P	GO:0042700	luteinizing hormone signaling pathway
2. P	GO:0030176	integral component of endoplasmic reticulum membrane
2. P	GO:0044074	negative regulation by symbiont of host translation
2. P	GO:0034142	toll-like receptor 4 signaling pathway
2. P	GO:0099175	regulation of postsynapse organization
2. P	GO:0090651	apical cytoplasm
2. P	GO:0005123	death receptor binding
2. P	GO:0050804	modulation of chemical synaptic transmission
2. P	GO:0061512	protein localization to cilium
2. P	GO:0044314	protein K27-linked ubiquitination
2. P	GO:0070286	axonemal dynein complex assembly
2. P	GO:0036158	outer dynein arm assembly
2. P	GO:0030193	regulation of blood coagulation
2. P	GO:0010378	temperature compensation of the circadian clock
2. P	GO:0090660	cerebrospinal fluid circulation
2. P	GO:0051865	protein autoubiquitination
2. P	GO:0046330	positive regulation of JNK cascade
2. P	GO:0050728	negative regulation of inflammatory response
2. P	GO:0010165	response to X-ray
2. P	GO:0000209	protein polyubiquitination
2. P	GO:2000155	positive regulation of cilium-dependent cell motility
2. P	GO:0001947	heart looping
2. P	GO:0030425	dendrite
2. P	GO:0097733	photoreceptor cell cilium
2. P	GO:0030218	erythrocyte differentiation
2. P	GO:0036064	ciliary basal body
2. P	GO:0005930	axoneme
2. P	GO:0035469	determination of pancreatic left/right asymmetry
2. P	GO:0098685	Schaffer collateral - CA1 synapse
2. P	GO:0007010	cytoskeleton organization
2. P	GO:0001530	lipopolysaccharide binding
2. P	GO:2000647	negative regulation of stem cell proliferation
2. P	GO:0003146	heart jogging
2. P	GO:0046426	negative regulation of receptor signaling pathway via JAK-STAT
2. P	GO:0007155	cell adhesion
2. P	GO:0022602	ovulation cycle process
2. P	GO:0000920	septum digestion after cytokinesis
2. P	GO:0060294	cilium movement involved in cell motility
2. P	GO:0070527	platelet aggregation
2. P	GO:0043393	regulation of protein binding
2. P	GO:0098794	postsynapse
2. P	GO:0040036	regulation of fibroblast growth factor receptor signaling pathway
2. P	GO:0071373	cellular response to luteinizing hormone stimulus
2. P	GO:0060027	convergent extension involved in gastrulation
2. P	GO:0003305	cell migration involved in heart jogging
2. P	GO:0046696	lipopolysaccharide receptor complex
2. P	GO:0003314	heart rudiment morphogenesis
2. P	GO:0003143	embryonic heart tube morphogenesis
2. P	GO:0052170	suppression by symbiont of host innate immune response
2. P	GO:0071356	cellular response to tumor necrosis factor
2. P	GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process
2. P	GO:0061458	reproductive system development
2. P	GO:0007118	budding cell apical bud growth
2. P	GO:0042769	obsolete DNA damage response, detection of DNA damage
2. P	GO:0004964	luteinizing hormone receptor activity
2. P	GO:0042730	fibrinolysis
2. P	GO:0032391	photoreceptor connecting cilium
2. P	GO:0060271	cilium assembly
2. P	GO:0030317	flagellated sperm motility
2. P	GO:0030532	small nuclear ribonucleoprotein complex
2. P	GO:0042025	host cell nucleus
2. P	GO:0003356	regulation of cilium beat frequency
2. P	GO:0005813	centrosome
2. P	GO:0007368	determination of left/right symmetry
2. P	GO:0061371	determination of heart left/right asymmetry
2. P	GO:0005829	cytosol
2. P	GO:0008039	synaptic target recognition
2. P	GO:0099151	regulation of postsynaptic density assembly
2. P	GO:0007616	long-term memory
2. P	GO:0044458	motile cilium assembly
2. P	GO:0007224	smoothened signaling pathway
2. P	GO:0007596	blood coagulation
2. P	GO:0044782	cilium organization
2. P	GO:0045211	postsynaptic membrane
2. P	GO:0099572	postsynaptic specialization
2. P	GO:0008584	male gonad development
3. B	GO:0030014	CCR4-NOT complex
3. B	GO:0016080	synaptic vesicle targeting
3. B	GO:0046007	negative regulation of activated T cell proliferation
3. B	GO:0038131	neuregulin receptor activity
3. B	GO:0045571	negative regulation of imaginal disc growth
3. B	GO:0055046	microgametogenesis
3. B	GO:0090037	positive regulation of protein kinase C signaling
3. B	GO:2001013	epithelial cell proliferation involved in renal tubule morphogenesis
3. B	GO:0006368	transcription elongation from RNA polymerase II promoter
3. B	GO:0007089	traversing start control point of mitotic cell cycle
3. B	GO:1903217	negative regulation of protein processing involved in protein targeting to mitochondrion
3. B	GO:0099147	extrinsic component of postsynaptic density membrane
3. B	GO:0006884	cell volume homeostasis
3. B	GO:0043615	astrocyte cell migration
3. B	GO:0045186	zonula adherens assembly
3. B	GO:0061161	positive regulation of establishment of bipolar cell polarity regulating cell shape
3. B	GO:0036360	sorocarp stalk morphogenesis
3. B	GO:0030539	male genitalia development
3. B	GO:0001964	startle response
3. B	GO:0071470	cellular response to osmotic stress
3. B	GO:0015734	taurine transport
3. B	GO:0030021	extracellular matrix structural constituent conferring compression resistance
3. B	GO:0045663	positive regulation of myoblast differentiation
3. B	GO:0019903	protein phosphatase binding
3. B	GO:0106310	protein serine kinase activity
3. B	GO:0099054	presynapse assembly
3. B	GO:0016500	protein-hormone receptor activity
3. B	GO:0035025	positive regulation of Rho protein signal transduction
3. B	GO:0016201	synaptic target inhibition
3. B	GO:0048495	Roundabout binding
3. B	GO:0008330	protein tyrosine/threonine phosphatase activity
3. B	GO:0032228	regulation of synaptic transmission, GABAergic
3. B	GO:0007163	establishment or maintenance of cell polarity
3. B	GO:0035264	multicellular organism growth
3. B	GO:0004722	protein serine/threonine phosphatase activity
3. B	GO:0060581	cell fate commitment involved in pattern specification
3. B	GO:0072282	metanephric nephron tubule morphogenesis
3. B	GO:0007416	synapse assembly
3. B	GO:0005524	ATP binding
3. B	GO:1904027	negative regulation of collagen fibril organization
3. B	GO:0106307
3. B	GO:1904887	Wnt signalosome assembly
3. B	GO:0030587	sorocarp development
3. B	GO:0015698	inorganic anion transport
3. B	GO:0002667	regulation of T cell anergy
3. B	GO:0030036	actin cytoskeleton organization
3. B	GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway
3. B	GO:0000288	nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
3. B	GO:0045930	negative regulation of mitotic cell cycle
3. B	GO:0007283	spermatogenesis
3. B	GO:0002329	pre-B cell differentiation
3. B	GO:0098887	neurotransmitter receptor transport, endosome to postsynaptic membrane
3. B	GO:0000076	DNA replication checkpoint signaling
3. B	GO:0043231	intracellular membrane-bounded organelle
3. B	GO:1902803	regulation of synaptic vesicle transport
3. B	GO:0030534	adult behavior
3. B	GO:0010606	positive regulation of cytoplasmic mRNA processing body assembly
3. B	GO:0045108	regulation of intermediate filament polymerization or depolymerization
3. B	GO:0014041	regulation of neuron maturation
3. B	GO:1905573	ganglioside GM1 binding
3. B	GO:0001768	establishment of T cell polarity
3. B	GO:0044753	amphisome
3. B	GO:0070966	nuclear-transcribed mRNA catabolic process, no-go decay
3. B	GO:0006970	response to osmotic stress
3. B	GO:0030714	anterior/posterior axis specification, follicular epithelium
3. B	GO:0140360	cyclic-GMP-AMP transmembrane transporter activity
3. B	GO:0071726	cellular response to diacyl bacterial lipopeptide
3. B	GO:0016336	establishment or maintenance of polarity of larval imaginal disc epithelium
3. B	GO:0050929	induction of negative chemotaxis
3. B	GO:0030282	bone mineralization
3. B	GO:0022038	corpus callosum development
3. B	GO:0016332	establishment or maintenance of polarity of embryonic epithelium
3. B	GO:0019843	rRNA binding
3. B	GO:0043547	positive regulation of GTPase activity
3. B	GO:0010233	phloem transport
3. B	GO:0034750	Scrib-APC-beta-catenin complex
3. B	GO:1902476	chloride transmembrane transport
3. B	GO:0030239	myofibril assembly
3. B	GO:0099400	caveola neck
3. B	GO:0032331	negative regulation of chondrocyte differentiation
3. B	GO:0010632	regulation of epithelial cell migration
3. B	GO:1905103	integral component of lysosomal membrane
3. B	GO:0044295	axonal growth cone
3. B	GO:0005887	integral component of plasma membrane
3. B	GO:0031589	cell-substrate adhesion
3. B	GO:0090038	negative regulation of protein kinase C signaling
3. B	GO:2000274	regulation of epithelial cell migration, open tracheal system
3. B	GO:0098968	neurotransmitter receptor transport postsynaptic membrane to endosome
3. B	GO:0060005	vestibular reflex
3. B	GO:0017017	MAP kinase tyrosine/serine/threonine phosphatase activity
3. B	GO:0004532	exoribonuclease activity
3. B	GO:0051014	actin filament severing
3. B	GO:0005518	collagen binding
3. B	GO:0007502	digestive tract mesoderm development
3. B	GO:0060561	apoptotic process involved in morphogenesis
3. B	GO:0044291	cell-cell contact zone
3. B	GO:0072202	cell differentiation involved in metanephros development
3. B	GO:0008157	protein phosphatase 1 binding
3. B	GO:0048243	norepinephrine secretion
3. B	GO:0099139	cheating during chimeric sorocarp development
3. B	GO:0023041	neuronal signal transduction
3. B	GO:0006171	cAMP biosynthetic process
3. B	GO:0051900	regulation of mitochondrial depolarization
3. B	GO:0004672	protein kinase activity
3. B	GO:0010067	procambium histogenesis
3. B	GO:0031344	regulation of cell projection organization
3. B	GO:0000188	obsolete inactivation of MAPK activity
3. B	GO:1903980	positive regulation of microglial cell activation
3. B	GO:0009649	entrainment of circadian clock
3. B	GO:0048681	negative regulation of axon regeneration
3. B	GO:0046956	positive phototaxis
3. B	GO:0060088	auditory receptor cell stereocilium organization
3. B	GO:0140058	neuron projection arborization
3. B	GO:0051965	positive regulation of synapse assembly
3. B	GO:0043928	exonucleolytic catabolism of deadenylated mRNA
3. B	GO:0061290	canonical Wnt signaling pathway involved in metanephric kidney development
3. B	GO:0106311
3. B	GO:0032528	microvillus organization
3. B	GO:0098609	cell-cell adhesion
3. B	GO:0050673	epithelial cell proliferation
3. B	GO:0001818	negative regulation of cytokine production
3. B	GO:0106306
3. B	GO:0036335	intestinal stem cell homeostasis
3. B	GO:0043327	chemotaxis to cAMP
3. B	GO:0035374	chondroitin sulfate binding
3. B	GO:0035970	peptidyl-threonine dephosphorylation
3. B	GO:0007318	pole plasm protein localization
3. B	GO:0071666	Slit-Robo signaling complex
3. B	GO:0050772	positive regulation of axonogenesis
3. B	GO:0030374	nuclear receptor coactivator activity
3. B	GO:0032922	circadian regulation of gene expression
3. B	GO:0035089	establishment of apical/basal cell polarity
3. B	GO:1902499	positive regulation of protein autoubiquitination
3. B	GO:0032968	positive regulation of transcription elongation from RNA polymerase II promoter
3. B	GO:0140361	cyclic-GMP-AMP transmembrane import across plasma membrane
3. B	GO:0031223	auditory behavior
3. B	GO:0051898	negative regulation of protein kinase B signaling
3. B	GO:0016333	morphogenesis of follicular epithelium
3. B	GO:1905289	regulation of CAMKK-AMPK signaling cascade
3. B	GO:0007265	Ras protein signal transduction
3. B	GO:0007409	axonogenesis
3. B	GO:0060603	mammary gland duct morphogenesis
3. B	GO:0090263	positive regulation of canonical Wnt signaling pathway
3. B	GO:0045171	intercellular bridge
3. B	GO:0030517	negative regulation of axon extension
3. B	GO:1900744	regulation of p38MAPK cascade
3. B	GO:0031430	M band
3. B	GO:0022028	tangential migration from the subventricular zone to the olfactory bulb
3. B	GO:1905279	regulation of retrograde transport, endosome to Golgi
3. B	GO:0001737	establishment of imaginal disc-derived wing hair orientation
3. B	GO:0061809	NAD+ nucleotidase, cyclic ADP-ribose generating
3. B	GO:0035751	regulation of lysosomal lumen pH
3. B	GO:0046849	bone remodeling
3. B	GO:0071896	protein localization to adherens junction
3. B	GO:1990030	pericellular basket
3. B	GO:0001942	hair follicle development
3. B	GO:0030859	polarized epithelial cell differentiation
3. B	GO:0072002	Malpighian tubule development
3. B	GO:0034702	ion channel complex
3. B	GO:0051270	regulation of cellular component movement
3. B	GO:0050919	negative chemotaxis
3. B	GO:0090630	activation of GTPase activity
3. B	GO:0009626	plant-type hypersensitive response
3. B	GO:0007527	adult somatic muscle development
3. B	GO:0010977	negative regulation of neuron projection development
3. B	GO:0097487	multivesicular body, internal vesicle
3. B	GO:0004535	poly(A)-specific ribonuclease activity
3. B	GO:0010004	gastrulation involving germ band extension
3. B	GO:0060384	innervation
3. B	GO:0035564	regulation of kidney size
3. B	GO:0034134	toll-like receptor 2 signaling pathway
3. B	GO:1904713	beta-catenin destruction complex binding
3. B	GO:0071727	cellular response to triacyl bacterial lipopeptide
3. B	GO:0042622	photoreceptor outer segment membrane
3. B	GO:0021747	cochlear nucleus development
3. B	GO:0006470	protein dephosphorylation
3. B	GO:0000932	P-body
3. B	GO:0001649	osteoblast differentiation
3. B	GO:0048565	digestive tract development
3. B	GO:0035335	peptidyl-tyrosine dephosphorylation
3. B	GO:0016334	establishment or maintenance of polarity of follicular epithelium
3. B	GO:1905576	ganglioside GT1b binding
3. B	GO:0120163	negative regulation of cold-induced thermogenesis
3. B	GO:0031153	slug development involved in sorocarp development
3. B	GO:0031047	gene silencing by RNA
3. B	GO:0030015	CCR4-NOT core complex
3. B	GO:0005912	adherens junction
3. B	GO:0031150	sorocarp stalk development
3. B	GO:0021756	striatum development
3. B	GO:0015810	aspartate transmembrane transport
3. B	GO:0008154	actin polymerization or depolymerization
3. B	GO:0098633	collagen fibril binding
3. B	GO:2000172	regulation of branching morphogenesis of a nerve
3. B	GO:0035748	myelin sheath abaxonal region
3. B	GO:0060159	regulation of dopamine receptor signaling pathway
3. B	GO:0034122	negative regulation of toll-like receptor signaling pathway
3. B	GO:0050918	positive chemotaxis
3. B	GO:0016791	phosphatase activity
3. B	GO:1902004	positive regulation of amyloid-beta formation
3. B	GO:0005225	volume-sensitive anion channel activity
3. B	GO:1990794	basolateral part of cell
3. B	GO:0001678	cellular glucose homeostasis
3. B	GO:0000175	3'-5'-exoribonuclease activity
3. B	GO:0062200	RAM/MOR signaling pathway
3. B	GO:0004016	adenylate cyclase activity
3. B	GO:0016335	morphogenesis of larval imaginal disc epithelium
3. B	GO:0007432	salivary gland boundary specification
3. B	GO:0048478	replication fork protection
3. B	GO:0043326	chemotaxis to folate
3. B	GO:0034178	toll-like receptor 13 signaling pathway
3. B	GO:0035996	rhabdomere microvillus
3. B	GO:0016601	Rac protein signal transduction
3. B	GO:0045444	fat cell differentiation
3. B	GO:0090190	positive regulation of branching involved in ureteric bud morphogenesis
3. B	GO:0036342	post-anal tail morphogenesis
3. B	GO:0008201	heparin binding
3. B	GO:0050135	NAD(P)+ nucleosidase activity
3. B	GO:0050807	regulation of synapse organization
3. B	GO:0043408	regulation of MAPK cascade
3. B	GO:0010619	adenylate cyclase-activating glucose-activated G protein-coupled receptor signaling pathway
3. B	GO:0004721	phosphoprotein phosphatase activity
3. B	GO:0001817	regulation of cytokine production
3. B	GO:0042592	homeostatic process
3. B	GO:0072224	metanephric glomerulus development
3. B	GO:0001772	immunological synapse
3. B	GO:0051019	mitogen-activated protein kinase binding
3. B	GO:0001921	positive regulation of receptor recycling
3. B	GO:0046328	regulation of JNK cascade
3. B	GO:0032473	cytoplasmic side of mitochondrial outer membrane
3. B	GO:0016593	Cdc73/Paf1 complex
3. B	GO:0060007	linear vestibuloocular reflex
3. B	GO:0048884	neuromast development
3. B	GO:0036479	peroxidase inhibitor activity
3. B	GO:0099149	regulation of postsynaptic neurotransmitter receptor internalization
3. B	GO:0000289	nuclear-transcribed mRNA poly(A) tail shortening
3. B	GO:0034214	protein hexamerization
3. B	GO:0098656	anion transmembrane transport
3. B	GO:0002093	auditory receptor cell morphogenesis
3. B	GO:0021562	vestibulocochlear nerve development
3. B	GO:0016331	morphogenesis of embryonic epithelium
3. B	GO:1903125	negative regulation of thioredoxin peroxidase activity by peptidyl-threonine phosphorylation
3. B	GO:0042067	establishment of ommatidial planar polarity
3. B	GO:0002755	MyD88-dependent toll-like receptor signaling pathway
3. B	GO:1903215	negative regulation of protein targeting to mitochondrion
3. B	GO:0006820	anion transport
3. B	GO:0051016	barbed-end actin filament capping
3. B	GO:0003779	actin binding
3. B	GO:0090102	cochlea development
3. B	GO:0004888	transmembrane signaling receptor activity
3. B	GO:0005546	phosphatidylinositol-4,5-bisphosphate binding
3. B	GO:0010811	positive regulation of cell-substrate adhesion
3. B	GO:0032024	positive regulation of insulin secretion
3. B	GO:0035556	intracellular signal transduction
3. B	GO:0000164	protein phosphatase type 1 complex
3. B	GO:0005918	septate junction
3. B	GO:1902823	negative regulation of late endosome to lysosome transport
3. B	GO:0035239	tube morphogenesis
3. B	GO:0034211	GTP-dependent protein kinase activity

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	Q96AG4	Leucine-rich repeat-containing protein 59	1.30e-04	6.84e-07	1.18e-05
1. PB	Q9Y4C4	Malignant fibrous histiocytoma-amplified sequence 1	1.63e-02	2.19e-02	2.72e-04
1. PB	Q8AVS8	Leucine-rich repeat-containing protein 59	9.49e-05	2.52e-09	4.61e-06
1. PB	Q921G6	Leucine-rich repeat and calponin homology domain-containing protein 4	3.25e-02	1.41e-15	0.009
1. PB	Q9C0I9	Leucine-rich repeat-containing protein 27	0	1.06e-153	0.0
1. PB	Q9HB75	p53-induced death domain-containing protein 1	1.87e-01	6.20e-06	1.28e-04
1. PB	Q9W266	Protein windpipe	1.72e-02	2.00e-04	0.019
1. PB	P70587	Leucine-rich repeat-containing protein 7	1.64e-01	5.72e-03	0.001
1. PB	F1MCA7	Leucine-rich repeat-containing protein 7	7.07e-01	2.43e-02	2.16e-04
1. PB	Q5RJR8	Leucine-rich repeat-containing protein 59	1.37e-04	9.21e-07	2.05e-05
1. PB	Q4R6X9	Dynein regulatory complex subunit 3	6.26e-06	4.75e-13	0.049
1. PB	Q5F334	Leucine-rich repeat-containing protein 59	2.10e-04	1.22e-07	2.12e-04
1. PB	P62046	Leucine-rich repeat and calponin homology domain-containing protein 1	3.45e-02	1.55e-09	7.59e-04
1. PB	Q960C5	Leucine-rich repeat and calponin homology domain-containing protein	3.11e-02	6.16e-08	4.79e-06
1. PB	Q5E9X4	Leucine-rich repeat-containing protein 59	1.15e-04	1.07e-07	9.30e-06
1. PB	Q6UWE0	E3 ubiquitin-protein ligase LRSAM1	2.00e-06	2.84e-02	2.43e-10
1. PB	Q9D5E4	Dynein regulatory complex subunit 3	3.35e-05	1.48e-12	0.027
1. PB	Q6NX28	Leucine-rich repeat-containing protein 59	1.47e-05	8.20e-10	8.36e-06
1. PB	Q8N1G4	Leucine-rich repeat-containing protein 47	1.55e-02	3.83e-14	0.046
1. PB	O75427	Leucine-rich repeat and calponin homology domain-containing protein 4	1.07e-03	3.22e-13	0.004
1. PB	Q5VUJ6	Leucine-rich repeat and calponin homology domain-containing protein 2	6.39e-03	5.39e-10	8.35e-05
1. PB	Q80TE7	Leucine-rich repeat-containing protein 7	1.89e-01	2.83e-03	8.82e-04
1. PB	Q6NWG1	Leucine-rich repeat-containing protein 59	2.92e-05	4.41e-09	8.29e-05
1. PB	Q9H069	Dynein regulatory complex subunit 3	9.39e-06	6.88e-13	0.025
1. PB	Q9Y2L9	Leucine-rich repeat and calponin homology domain-containing protein 1	1.68e-03	2.47e-07	6.07e-04
1. PB	Q96RT1	Erbin	5.79e-01	2.58e-03	3.07e-06
1. PB	Q8BVU0	DISP complex protein LRCH3	1.96e-03	1.76e-16	0.004
1. PB	Q922Q8	Leucine-rich repeat-containing protein 59	3.62e-04	3.84e-06	2.05e-05
1. PB	Q96II8	DISP complex protein LRCH3	6.90e-03	6.22e-17	0.002
1. PB	Q80YS5	Leucine-rich repeat-containing protein 27	1.51e-10	1.25e-65	0.0
1. PB	Q3UMG5	Leucine-rich repeat and calponin homology domain-containing protein 2	4.50e-03	8.32e-11	4.17e-05
1. PB	Q3V1N1	Malignant fibrous histiocytoma-amplified sequence 1 homolog	1.19e-02	1.18e-02	3.17e-04
1. PB	Q80TH2	Erbin	3.01e-01	5.62e-04	7.43e-05
1. PB	Q9ERV7	p53-induced death domain-containing protein 1	3.71e-01	1.71e-03	0.021
1. PB	Q80ZI6	E3 ubiquitin-protein ligase LRSAM1	1.19e-05	2.43e-02	2.27e-11
1. PB	Q6PJG9	Leucine-rich repeat and fibronectin type-III domain-containing protein 4	3.91e-02	1.17e-02	0.044
2. P	Q504C1	Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 2	5.46e-02	8.43e-04	NA
2. P	Q95LL2	X-ray radiation resistance-associated protein 1 (Fragment)	9.86e-02	1.32e-07	NA
2. P	Q8IYG6	Leucine-rich repeat-containing protein 56	2.21e-02	2.28e-06	NA
2. P	Q6IRU7	Centrosomal protein of 78 kDa	1.71e-02	2.92e-02	NA
2. P	Q3TAA7	Serine/threonine-protein kinase 11-interacting protein	6.01e-02	3.24e-02	NA
2. P	B3DH20	Dynein axonemal assembly factor 11	4.05e-03	8.40e-05	NA
2. P	Q08817	Leucine-rich repeat-containing protein SOG2	4.55e-03	1.45e-05	NA
2. P	W8DXL4	Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 3	3.15e-02	1.50e-05	NA
2. P	Q8N309	Leucine-rich repeat-containing protein 43	6.74e-02	2.18e-05	NA
2. P	B0BNK7	Leucine-rich repeat and fibronectin type-III domain-containing protein 3	1.67e-02	3.21e-02	NA
2. P	Q68FM6	Protein phosphatase 1 regulatory subunit 29	7.03e-03	1.43e-02	NA
2. P	Q326Z6	E3 ubiquitin-protein ligase ipaH9.8	1.17e-02	1.53e-04	NA
2. P	Q86X45	Dynein axonemal assembly factor 11	5.86e-03	7.03e-04	NA
2. P	Q80XU8	Leucine-rich repeat and fibronectin type-III domain-containing protein 4	7.38e-02	1.72e-02	NA
2. P	Q8WUT4	Leucine-rich repeat neuronal protein 4	7.56e-02	9.14e-03	NA
2. P	Q9NZU1	Leucine-rich repeat transmembrane protein FLRT1	6.24e-02	2.17e-02	NA
2. P	Q8K375	Leucine-rich repeat-containing protein 56	2.78e-02	1.57e-12	NA
2. P	Q28FY0	Dynein axonemal assembly factor 11	2.92e-03	4.39e-03	NA
2. P	Q9VR52	Protein tilB	9.64e-02	8.70e-03	NA
2. P	O35930	Platelet glycoprotein Ib alpha chain	5.24e-02	2.43e-02	NA
2. P	Q8C8T7	Protein ELFN1	1.56e-02	1.69e-03	NA
2. P	Q8VSC3	E3 ubiquitin-protein ligase ipaH9.8	3.05e-03	2.72e-04	NA
2. P	Q9BTN0	Leucine-rich repeat and fibronectin type-III domain-containing protein 3	4.25e-02	1.13e-02	NA
2. P	Q5XI54	Dynein regulatory complex subunit 3	3.31e-05	9.80e-13	NA
2. P	Q8K0B3	Leucine-rich repeat-containing protein 66	3.75e-02	1.54e-02	NA
2. P	Q9NJE9	Dynein axonemal assembly factor 11	7.00e-03	6.66e-06	NA
2. P	A8IVX2	Dynein regulatory complex subunit 3	1.22e-05	2.72e-12	NA
2. P	D2HFT7	Leucine-rich repeat and fibronectin type-III domain-containing protein 3	8.09e-03	3.15e-02	NA
2. P	Q1RMS4	Leucine-rich repeat and fibronectin type-III domain-containing protein 3	2.76e-02	7.27e-03	NA
2. P	B2TT54	E3 ubiquitin-protein ligase ipaH9.8	9.12e-03	8.70e-04	NA
2. P	Q5Y2C3	Histone H2A.Y	5.70e-02	3.05e-05	NA
2. P	Q8N9M1	Uncharacterized protein C19orf47	4.82e-01	4.58e-03	NA
2. P	Q14DL3	Leucine-rich repeat and IQ domain-containing protein 3	4.57e-04	1.13e-11	NA
2. P	Q7ZV84	Dynein axonemal assembly factor 1	1.62e-02	3.53e-04	NA
2. P	Q6AYH9	Dynein axonemal assembly factor 1	3.08e-02	3.01e-02	NA
2. P	Q9ULH4	Leucine-rich repeat and fibronectin type-III domain-containing protein 2	2.05e-01	1.36e-02	NA
2. P	Q5R3F8	Protein phosphatase 1 regulatory subunit 29	3.83e-03	2.84e-02	NA
2. P	Q4R3F0	Protein tilB homolog	1.07e-03	3.30e-03	NA
2. P	Q6GPJ8	Centrosomal protein of 97 kDa	7.33e-03	1.33e-04	NA
2. P	Q8K099	Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 1	3.99e-02	4.09e-03	NA
2. P	Q3SXY7	Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 3	4.78e-02	5.95e-03	NA
2. P	Q505F5	Leucine-rich repeat-containing protein 47	1.84e-02	1.51e-14	NA
2. P	A6NDA9	Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 2	9.03e-03	2.27e-02	NA
2. P	A6PVS8	Leucine-rich repeat and IQ domain-containing protein 3	1.66e-05	4.65e-11	NA
2. P	P18009	Probable E3 ubiquitin-protein ligase ipaH4.5	9.15e-03	2.14e-03	NA
2. P	Q9BE71	Leucine-rich repeat and fibronectin type-III domain-containing protein 2	1.60e-01	3.14e-03	NA
2. P	Q460M5	Leucine-rich repeat and fibronectin type-III domain-containing protein 2	3.84e-02	4.48e-03	NA
2. P	Q5BGW9	U2 small nuclear ribonucleoprotein A'	1.17e-02	1.16e-03	NA
2. P	P07359	Platelet glycoprotein Ib alpha chain	5.01e-02	1.41e-02	NA
2. P	O88978	Dynein axonemal assembly factor 11	9.06e-03	2.60e-04	NA
2. P	P18014	Probable E3 ubiquitin-protein ligase ipaH7.8	1.15e-02	2.75e-03	NA
2. P	D2AJU0	E3 ubiquitin-protein ligase ipaH9.8	4.90e-03	1.26e-03	NA
2. P	Q7L0X0	TLR4 interactor with leucine rich repeats	4.17e-02	5.80e-04	NA
2. P	Q6PFC5	Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 2	1.68e-02	3.85e-02	NA
2. P	Q9JMH2	Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 1	2.94e-02	2.48e-03	NA
2. P	Q6AYL8	Leucine-rich repeat and IQ domain-containing protein 3	2.57e-04	1.04e-14	NA
2. P	Q8IW35	Centrosomal protein of 97 kDa	1.31e-02	2.85e-05	NA
2. P	Q9V4Q8	Probable U2 small nuclear ribonucleoprotein A'	3.89e-03	1.05e-02	NA
2. P	Q8CIM1	Leucine-rich repeat-containing protein 45	1.78e-04	2.36e-02	NA
2. P	Q7PK92	Dynein axonemal assembly factor 1 homolog	7.83e-03	4.72e-03	NA
2. P	Q9DBY4	TLR4 interactor with leucine rich repeats	1.06e-02	8.80e-04	NA
2. P	Q83RJ4	E3 ubiquitin-protein ligase ipaH3	1.36e-02	4.48e-04	NA
2. P	Q3U3V8	X-ray radiation resistance-associated protein 1	2.32e-02	9.08e-05	NA
2. P	Q1RMR5	Dynein axonemal assembly factor 11	1.30e-03	2.78e-04	NA
2. P	Q9CZ62	Centrosomal protein of 97 kDa	2.53e-02	1.44e-04	NA
2. P	Q3YTH5	E3 ubiquitin-protein ligase ipaH9.8	1.31e-03	9.37e-04	NA
2. P	D4ABX8	Leucine-rich repeat and fibronectin type-III domain-containing protein 4	2.61e-02	1.99e-02	NA
2. P	Q80TG9	Leucine-rich repeat and fibronectin type-III domain-containing protein 2	8.43e-02	5.01e-03	NA
2. P	Q1EGL1	Leucine-rich repeat LGI family member 2	1.56e-01	3.54e-02	NA
2. P	Q4V8C9	Leucine-rich repeat-containing protein 56	5.04e-03	1.49e-09	NA
2. P	Q09JZ4	Leucine-rich repeat-containing protein ODA7	1.28e-02	1.60e-07	NA
2. P	Q7PCK7	X-ray radiation resistance-associated protein 1 (Fragment)	1.32e-01	7.39e-08	NA
2. P	O43822	Cilia- and flagella-associated protein 410	1.80e-02	3.34e-03	NA
2. P	Q90674	Lutropin-choriogonadotropic hormone receptor	7.49e-03	4.92e-02	NA
2. P	Q3V0L5	Leucine-rich repeat-containing protein 43	8.32e-02	8.55e-06	NA
2. P	P59383	Leucine-rich repeat neuronal protein 4	7.50e-02	4.34e-04	NA
2. P	Q9P2V4	Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 1	1.48e-02	1.91e-03	NA
2. P	Q96FV0	Leucine-rich repeat-containing protein 46	8.06e-03	1.59e-02	NA
2. P	Q496Z2	TLR4 interactor with leucine rich repeats	3.90e-02	8.25e-04	NA
2. P	Q95JT3	Leucine-rich repeat-containing protein 43	8.74e-02	3.53e-04	NA
2. P	P32690	Putative protein YjbI	1.32e-01	3.09e-02	NA
2. P	Q5ZI11	Leucine-rich repeat-containing protein 45	3.60e-04	5.99e-04	NA
2. P	A0A1L8G016	Dynein axonemal assembly factor 11	5.02e-03	2.87e-04	NA
2. P	P0C7U0	Protein ELFN1	4.86e-03	2.53e-03	NA
2. P	Q8N0V4	Leucine-rich repeat LGI family member 2	1.70e-01	3.54e-02	NA
2. P	Q501X2	Centrosomal protein of 72 kDa	5.52e-04	9.95e-08	NA
2. P	Q31SH3	E3 ubiquitin-protein ligase ipaH9.8	1.23e-03	3.38e-04	NA
2. P	Q8C6G1	Cilia- and flagella-associated protein 410	3.16e-02	3.54e-02	NA
2. P	Q6P2D8	X-ray radiation resistance-associated protein 1	9.96e-02	8.59e-05	NA
2. P	Q54NK3	Putative protein DDB_G0285185	2.06e-02	1.13e-05	NA
2. P	Q5F479	Serine/threonine-protein kinase 11-interacting protein	1.68e-01	3.97e-03	NA
3. B	Q54XZ5	Probable serine/threonine-protein kinase DDB_G0278509	1.18e-01	NA	0.030
3. B	Q0GC71	Toll-like receptor 2	4.13e-01	NA	0.024
3. B	Q80U72	Protein scribble homolog	2.88e-01	NA	0.001
3. B	Q8S7M7	Plant intracellular Ras-group-related LRR protein 5	2.07e-02	NA	3.44e-06
3. B	Q810C1	SLIT and NTRK-like protein 1	1.47e-02	NA	0.018
3. B	Q9FII5	Leucine-rich repeat receptor-like protein kinase TDR	9.46e-02	NA	0.027
3. B	P0CP22	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	4.34e-02	NA	6.13e-06
3. B	Q96PX8	SLIT and NTRK-like protein 1	2.10e-02	NA	0.003
3. B	Q8VEG6	CCR4-NOT transcription complex subunit 6-like	4.72e-03	NA	2.60e-07
3. B	Q75BI3	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	1.38e-01	NA	6.00e-06
3. B	B0M0P8	Ras guanine nucleotide exchange factor L	7.88e-01	NA	0.003
3. B	Q9BYS8	Leucine-rich repeat-containing protein 2	6.14e-03	NA	0.045
3. B	Q24020	Protein flightless-1	1.19e-01	NA	0.002
3. B	Q8AVI4	Leucine-rich repeat protein SHOC-2	2.82e-06	NA	2.35e-08
3. B	Q4WQG5	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	3.33e-02	NA	2.85e-05
3. B	B4IBI9	Leucine-rich repeat protein soc-2 homolog	1.33e-03	NA	2.54e-10
3. B	A2BHJ4	CCR4-NOT transcription complex subunit 6-like	9.08e-03	NA	1.07e-06
3. B	Q2UUI3	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	2.58e-02	NA	1.13e-06
3. B	Q8IWT6	Volume-regulated anion channel subunit LRRC8A	9.17e-02	NA	1.67e-06
3. B	Q5RFE9	Leucine-rich repeat-containing protein 40	3.15e-04	NA	9.58e-05
3. B	Q5RAV5	Leucine-rich repeat protein SHOC-2	3.02e-06	NA	1.58e-06
3. B	Q7XK44	Plant intracellular Ras-group-related LRR protein 3	4.42e-03	NA	8.46e-07
3. B	Q8N456	Leucine-rich repeat-containing protein 18	7.23e-03	NA	2.85e-06
3. B	Q7L1W4	Volume-regulated anion channel subunit LRRC8D	7.81e-02	NA	0.001
3. B	Q5S007	Leucine-rich repeat serine/threonine-protein kinase 2	6.89e-01	NA	0.018
3. B	P82963	Chaoptin (Fragment)	1.91e-01	NA	4.17e-04
3. B	Q9DE68	Decorin	1.82e-02	NA	0.041
3. B	Q9D9Q0	Leucine-rich repeat-containing protein 69	3.30e-02	NA	3.39e-06
3. B	Q5G5E0	Plant intracellular Ras-group-related LRR protein 5	3.16e-02	NA	1.60e-05
3. B	Q9LRV8	Plant intracellular Ras-group-related LRR protein 2	2.05e-03	NA	0.002
3. B	Q7SXW3	Leucine-rich repeat-containing protein 40	6.21e-04	NA	1.45e-06
3. B	Q9UQ13	Leucine-rich repeat protein SHOC-2	2.89e-06	NA	1.58e-06
3. B	Q80VQ1	Leucine-rich repeat-containing protein 1	1.50e-02	NA	1.75e-04
3. B	Q6FRT2	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	1.60e-01	NA	2.05e-05
3. B	Q5G5D8	Plant intracellular Ras-group-related LRR protein 7	4.29e-03	NA	6.89e-04
3. B	O88520	Leucine-rich repeat protein SHOC-2	2.88e-06	NA	2.56e-07
3. B	Q6K7R2	Plant intracellular Ras-group-related LRR protein 6	2.13e-03	NA	6.64e-06
3. B	Q9DBB9	Carboxypeptidase N subunit 2	3.74e-02	NA	3.51e-05
3. B	O94991	SLIT and NTRK-like protein 5	6.87e-02	NA	0.008
3. B	Q6AYI5	Leucine-rich repeat protein SHOC-2	2.92e-06	NA	6.26e-07
3. B	P08678	Adenylate cyclase	5.78e-01	NA	0.017
3. B	Q5E9C0	Ras suppressor protein 1	2.05e-04	NA	2.92e-05
3. B	Q4P9T3	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	1.04e-02	NA	1.25e-05
3. B	P14605	Adenylate cyclase	2.95e-01	NA	0.001
3. B	Q86WK6	Amphoterin-induced protein 1	1.66e-02	NA	0.028
3. B	Q4H4B6	Protein scribble homolog	2.87e-01	NA	0.002
3. B	Q6GPJ5	Leucine-rich repeat-containing protein 40	1.44e-03	NA	1.26e-07
3. B	Q9CQ07	Leucine-rich repeat-containing protein 18	1.82e-03	NA	7.84e-07
3. B	F1R6I3	Leucine-rich repeat-containing protein 39	1.07e-03	NA	0.001
3. B	B5DX45	Leucine-rich repeat protein soc-2 homolog	5.51e-05	NA	1.26e-08
3. B	Q6DHL5	Leucine-rich repeat-containing protein 57	1.70e-03	NA	2.01e-05
3. B	Q55CS7	MAP kinase phosphatase with leucine-rich repeats protein 1	2.92e-02	NA	0.017
3. B	Q8W4Q3	Plant intracellular Ras-group-related LRR protein 3	2.58e-02	NA	4.04e-04
3. B	Q9RBS2	Protein PopC	1.13e-02	NA	0.001
3. B	Q42484	Disease resistance protein RPS2	2.50e-01	NA	0.003
3. B	B4N9T4	Leucine-rich repeat protein soc-2 homolog	6.63e-05	NA	1.19e-09
3. B	A1CW67	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	7.84e-02	NA	1.35e-05
3. B	Q5XH73	CCR4-NOT transcription complex subunit 6-like-B	1.48e-02	NA	0.039
3. B	D3ZAL8	Leucine-rich repeat transmembrane neuronal protein 3	2.52e-02	NA	0.003
3. B	Q9BTT6	Leucine-rich repeat-containing protein 1	3.06e-03	NA	1.84e-04
3. B	Q6R5N8	Toll-like receptor 13	6.28e-02	NA	5.06e-04
3. B	B3P3E8	Leucine-rich repeat protein soc-2 homolog	8.06e-05	NA	5.84e-10
3. B	O61967	Protein lap1	4.92e-02	NA	6.25e-04
3. B	Q9N0E3	Reticulon-4 receptor	3.59e-02	NA	0.008
3. B	B4JTV9	Leucine-rich repeat protein soc-2 homolog	4.01e-05	NA	2.52e-10
3. B	Q0U7W4	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	1.22e-02	NA	2.84e-06
3. B	Q80TM9	Nischarin	2.14e-01	NA	0.002
3. B	P40197	Platelet glycoprotein V	8.28e-02	NA	0.023
3. B	A8JAM0	Dynein regulatory complex subunit 7 (Fragment)	2.32e-01	NA	1.36e-04
3. B	Q4R6F0	Leucine-rich repeat and death domain-containing protein 1	4.80e-02	NA	0.002
3. B	Q96NW7	Leucine-rich repeat-containing protein 7	6.55e-01	NA	4.13e-04
3. B	Q9JJ28	Protein flightless-1 homolog	1.15e-01	NA	0.002
3. B	F1MLX5	Leucine-rich repeat-containing G-protein coupled receptor 4	1.97e-03	NA	2.24e-04
3. B	Q86VH5	Leucine-rich repeat transmembrane neuronal protein 3	2.81e-02	NA	0.003
3. B	B0W6M9	Leucine-rich repeat protein soc-2 homolog	1.09e-04	NA	1.42e-07
3. B	Q810B7	SLIT and NTRK-like protein 5	8.72e-02	NA	0.007
3. B	Q8RXS5	Probable disease resistance protein At5g63020	5.56e-01	NA	0.001
3. B	O02833	Insulin-like growth factor-binding protein complex acid labile subunit	8.90e-03	NA	0.009
3. B	Q8TDW0	Volume-regulated anion channel subunit LRRC8C	2.73e-02	NA	7.87e-04
3. B	P12024	Chaoptin	2.67e-01	NA	5.53e-06
3. B	Q15404	Ras suppressor protein 1	3.85e-04	NA	1.55e-05
3. B	Q8BGR2	Volume-regulated anion channel subunit LRRC8D	7.69e-02	NA	0.001
3. B	Q9SGP2	Receptor-like protein kinase HSL1	7.66e-02	NA	0.013
3. B	Q55FD8	Ras guanine nucleotide exchange factor V	2.03e-01	NA	0.014
3. B	Q5M8G4	Leucine-rich repeat-containing protein 40	1.05e-04	NA	7.80e-07
3. B	D3ZXS4	Leucine-rich repeat-containing protein 39	7.69e-03	NA	6.78e-05
3. B	Q9CRC8	Leucine-rich repeat-containing protein 40	8.49e-05	NA	1.48e-04
3. B	P31384	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	7.19e-02	NA	8.35e-07
3. B	Q9BXB1	Leucine-rich repeat-containing G-protein coupled receptor 4	2.32e-03	NA	0.003
3. B	A4IIK1	Malignant fibrous histiocytoma-amplified sequence 1 homolog	1.44e-02	NA	3.06e-05
3. B	A8XWW4	Leucine-rich repeat protein soc-2	1.53e-04	NA	1.87e-04
3. B	Q55CS8	MAP kinase phosphatase with leucine-rich repeats protein 2	1.54e-02	NA	0.004
3. B	Q5DU41	Volume-regulated anion channel subunit LRRC8B	1.24e-01	NA	1.13e-06
3. B	Q9FK63	Calmodulin-binding receptor kinase CaMRLK	2.41e-02	NA	0.020
3. B	O74874	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	1.99e-02	NA	4.00e-06
3. B	Q9H5Y7	SLIT and NTRK-like protein 6	4.66e-02	NA	0.010
3. B	Q6BMM5	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	7.27e-02	NA	1.82e-08
3. B	Q8SU52	Probable CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	6.36e-03	NA	5.87e-04
3. B	Q55E58	Probable serine/threonine-protein kinase pats1	NA	NA	2.32e-06
3. B	Q54Y32	MAP kinase phosphatase with leucine-rich repeats protein 3	3.21e-02	NA	1.82e-04
3. B	Q54AX5	Leucine-rich repeat protein lrrA	6.75e-05	NA	2.16e-06
3. B	A2ARI4	Leucine-rich repeat-containing G-protein coupled receptor 4	1.00e-03	NA	0.017
3. B	Q7XNY1	Plant intracellular Ras-group-related LRR protein 1	8.04e-04	NA	0.004
3. B	A1CIJ6	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	7.96e-03	NA	9.08e-05
3. B	Q5ZLN0	Leucine-rich repeat-containing protein 40	1.06e-03	NA	1.12e-06
3. B	Q6NU09	Volume-regulated anion channel subunit LRRC8E	7.94e-02	NA	1.03e-04
3. B	B9F655	Plant intracellular Ras-group-related LRR protein 7	3.62e-04	NA	1.22e-06
3. B	Q810B8	SLIT and NTRK-like protein 4	4.59e-02	NA	8.37e-04
3. B	Q6ZVD8	PH domain leucine-rich repeat-containing protein phosphatase 2	4.56e-01	NA	8.03e-04
3. B	Q01730	Ras suppressor protein 1	3.55e-04	NA	0.003
3. B	B3LWU3	Leucine-rich repeat protein soc-2 homolog	6.10e-05	NA	1.60e-09
3. B	B7XK66	Probable CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	2.34e-02	NA	1.14e-06
3. B	Q8C110	SLIT and NTRK-like protein 6	2.18e-02	NA	0.015
3. B	Q9WTR8	PH domain leucine-rich repeat protein phosphatase 1	8.05e-01	NA	8.82e-05
3. B	Q1L8Y7	Leucine-rich repeat protein SHOC-2	2.28e-06	NA	1.81e-07
3. B	B4QVR7	Leucine-rich repeat protein soc-2 homolog	1.34e-03	NA	7.50e-10
3. B	B4PU77	Leucine-rich repeat protein soc-2 homolog	7.63e-05	NA	6.32e-10
3. B	Q5A761	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	2.61e-02	NA	6.13e-08
3. B	Q6P9F7	Volume-regulated anion channel subunit LRRC8B	1.69e-01	NA	5.63e-06
3. B	Q22875	Leucine-rich repeat protein soc-2	3.30e-05	NA	4.14e-05
3. B	Q4R3P6	Leucine-rich repeat-containing protein 40	8.80e-04	NA	4.29e-05
3. B	Q6XHB2	Probable serine/threonine-protein kinase roco4	4.80e-01	NA	1.33e-05
3. B	Q8BZ81	Leucine-rich repeat transmembrane neuronal protein 3	2.06e-02	NA	0.002
3. B	P24014	Protein slit	4.65e-01	NA	0.008
3. B	Q96LI5	CCR4-NOT transcription complex subunit 6-like	3.59e-02	NA	0.014
3. B	Q4G017	Nischarin	6.22e-01	NA	0.029
3. B	A6NIV6	Leucine-rich repeat and IQ domain-containing protein 4	1.70e-02	NA	1.22e-09
3. B	Q05C16	Leucine-rich repeat-containing protein 63	6.53e-02	NA	0.009
3. B	Q6NSJ5	Volume-regulated anion channel subunit LRRC8E	5.97e-02	NA	0.035
3. B	Q6Z8P4	Plant intracellular Ras-group-related LRR protein 4	1.00e-04	NA	2.43e-04
3. B	Q498T9	Volume-regulated anion channel subunit LRRC8C	3.21e-02	NA	3.33e-04
3. B	Q96DD0	Leucine-rich repeat-containing protein 39	7.51e-03	NA	3.76e-05
3. B	O64566	Plant intracellular Ras-group-related LRR protein 6	1.82e-03	NA	8.51e-05
3. B	P0C895	LRR repeats and ubiquitin-like domain-containing protein At2g30105	9.06e-04	NA	0.009
3. B	Q01513	Adenylate cyclase	7.88e-01	NA	6.40e-04
3. B	Q8K3P5	CCR4-NOT transcription complex subunit 6	1.83e-02	NA	2.00e-08
3. B	Q13045	Protein flightless-1 homolog	1.56e-01	NA	8.54e-05
3. B	Q9ZPS9	Serine/threonine-protein kinase BRI1-like 2	2.33e-01	NA	0.005
3. B	Q810C0	SLIT and NTRK-like protein 2	6.57e-02	NA	0.048
3. B	Q8C0R9	Leucine-rich repeat and death domain-containing protein 1	3.51e-03	NA	1.02e-04
3. B	Q9BZR6	Reticulon-4 receptor	2.91e-02	NA	0.012
3. B	Q5BJ41	CCR4-NOT transcription complex subunit 6	5.90e-03	NA	1.93e-08
3. B	Q54WS5	Probable serine/threonine-protein kinase roco6	6.77e-01	NA	0.021
3. B	P0CP23	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	6.14e-02	NA	6.24e-06
3. B	Q9H9A6	Leucine-rich repeat-containing protein 40	1.22e-04	NA	1.79e-04
3. B	O94294	Leucine-rich repeat-containing protein sog2	1.76e-03	NA	1.24e-04
3. B	Q54M77	Probable serine/threonine-protein kinase roco8	4.80e-01	NA	0.001
3. B	Q8BGI7	Leucine-rich repeat-containing protein 39	5.46e-03	NA	1.32e-05
3. B	Q7XDQ7	Plant intracellular Ras-group-related LRR protein 8	4.26e-04	NA	5.08e-04
3. B	Q8TCA0	Leucine-rich repeat-containing protein 20	4.35e-05	NA	0.004
3. B	E9Q7T7	Chondroadherin-like protein	5.78e-02	NA	0.002
3. B	Q66JT1	Volume-regulated anion channel subunit LRRC8E	1.60e-01	NA	0.010
3. B	Q9ULM6	CCR4-NOT transcription complex subunit 6	2.33e-02	NA	6.47e-08
3. B	Q8MVR1	Cyclic GMP-binding protein C	5.65e-01	NA	1.60e-07
3. B	Q6CJU4	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	2.28e-01	NA	2.66e-07
3. B	Q14160	Protein scribble homolog	4.49e-01	NA	0.002
3. B	Q9V780	Protein lap1	1.22e-01	NA	0.001
3. B	Q7KRY7	Protein lap4	5.76e-01	NA	4.27e-05
3. B	Q9C2R2	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	2.48e-02	NA	0.001
3. B	Q6XHA7	Probable serine/threonine-protein kinase roco9	NA	NA	0.024
3. B	Q4V8I7	Volume-regulated anion channel subunit LRRC8A	1.73e-01	NA	6.94e-06
3. B	Q8RWE5	Plant intracellular Ras-group-related LRR protein 8	1.33e-04	NA	1.44e-05
3. B	Q01631	Adenylate cyclase	8.24e-01	NA	0.025
3. B	Q9SVW8	Plant intracellular Ras-group-related LRR protein 4	9.27e-03	NA	1.24e-04
3. B	A6QLV3	Leucine-rich repeat protein SHOC-2	3.12e-06	NA	1.58e-06
3. B	A6H6A4	Leucine-rich repeat and IQ domain-containing protein 4	1.55e-04	NA	1.32e-08
3. B	A5PK13	Volume-regulated anion channel subunit LRRC8C	4.39e-02	NA	7.28e-04
3. B	C4V7I7	Probable CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	1.26e-02	NA	7.99e-09
3. B	Q6AXU9	CCR4-NOT transcription complex subunit 6	6.63e-03	NA	2.00e-08
3. B	Q86X40	Leucine-rich repeat-containing protein 28	1.12e-02	NA	0.005
3. B	Q6NUI6	Chondroadherin-like protein	5.25e-02	NA	2.98e-04
3. B	Q3TX51	Leucine-rich repeat-containing protein 28	6.32e-03	NA	3.94e-05
3. B	Q1EA11	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	5.48e-03	NA	2.86e-07
3. B	Q0CT27	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	1.85e-02	NA	4.42e-07
3. B	Q8IW52	SLIT and NTRK-like protein 4	8.94e-02	NA	7.75e-04
3. B	P49606	Adenylate cyclase	6.14e-01	NA	6.53e-06
3. B	Q5U308	Volume-regulated anion channel subunit LRRC8D	6.59e-02	NA	1.75e-04
3. B	P22792	Carboxypeptidase N subunit 2	4.09e-02	NA	8.93e-04
3. B	Q5RAC4	SLIT and NTRK-like protein 1	9.11e-02	NA	0.003
3. B	Q9LVT4	Probable disease resistance protein At5g47250	2.19e-01	NA	2.27e-04
3. B	Q5B778	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	1.06e-02	NA	1.11e-08
3. B	Q1ZXD6	Probable serine/threonine-protein kinase roco5	NA	NA	6.32e-07
3. B	Q8VYG9	Plant intracellular Ras-group-related LRR protein 9	5.26e-04	NA	5.86e-08
3. B	Q9FFJ3	Plant intracellular Ras-group-related LRR protein 1	5.62e-04	NA	6.70e-07
3. B	Q8BXA7	PH domain leucine-rich repeat-containing protein phosphatase 2	3.71e-01	NA	0.006
3. B	P28675	Decorin	5.29e-03	NA	0.015
3. B	B4LXW1	Leucine-rich repeat protein soc-2 homolog	2.91e-05	NA	3.27e-10
3. B	Q9Z2H4	Leucine-rich repeat-containing G-protein coupled receptor 4	1.44e-02	NA	0.003
3. B	Q8CHE4	PH domain leucine-rich repeat-containing protein phosphatase 1	5.35e-01	NA	1.58e-04
3. B	Q3ZC49	Leucine-rich repeat-containing protein 39	7.35e-03	NA	2.92e-05
3. B	Q6GLE8	Leucine-rich repeat-containing protein 28	7.10e-03	NA	2.97e-05
3. B	A4D1F6	Leucine-rich repeat and death domain-containing protein 1	9.73e-03	NA	0.001
3. B	Q9VEK6	Leucine-rich repeat protein soc-2 homolog	9.05e-05	NA	6.41e-10
3. B	Q8R502	Volume-regulated anion channel subunit LRRC8C	1.65e-01	NA	3.92e-04
3. B	Q9H156	SLIT and NTRK-like protein 2	1.98e-02	NA	0.008
3. B	A7SFP1	Leucine-rich repeat protein soc-2 homolog	1.66e-04	NA	1.54e-05
3. B	P23466	Adenylate cyclase	6.07e-01	NA	0.005
3. B	Q6XHA5	Probable serine/threonine-protein kinase roco11	2.86e-01	NA	2.03e-06
3. B	Q5F4C4	Leucine-rich repeat protein SHOC-2	2.93e-03	NA	6.46e-08
3. B	Q9BGP6	Leucine-rich repeat transmembrane neuronal protein 3	2.54e-02	NA	0.003
3. B	O60346	PH domain leucine-rich repeat-containing protein phosphatase 1	7.41e-01	NA	0.001
3. B	Q54TM7	Probable serine/threonine-protein kinase drkD	2.82e-02	NA	0.004
3. B	Q5FVI3	Leucine-rich repeat-containing protein 57	1.10e-03	NA	0.036
3. B	A2Q9L0	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	1.29e-02	NA	4.58e-08
3. B	Q2PZH4	Toll-like receptor 2	1.11e-01	NA	0.022
3. B	Q6ZH85	Plant intracellular Ras-group-related LRR protein 2	2.86e-02	NA	8.37e-04
3. B	Q80WG5	Volume-regulated anion channel subunit LRRC8A	8.59e-02	NA	8.18e-07
3. B	O64973	Disease resistance protein RPS5	4.61e-01	NA	3.69e-04
3. B	Q32KX5	Leucine-rich repeat-containing protein 28	1.87e-02	NA	0.002