Summary

Q9H098

Homolog: Q5U4F3.
Function: Protein FAM107B.

Statistics

Total GO Annotation: 140
Unique PROST Go: 115
Unique BLAST Go: 3

Total Homologs: 135
Unique PROST Homologs: 126
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q5U4F3 (Protein FAM107B) with a FATCAT P-Value: 0.0 and RMSD of 2.65 angstrom. The sequence alignment identity is 99.2%.
Structural alignment shown in left. Query protein Q9H098 colored as red in alignment, homolog Q5U4F3 colored as blue. Query protein Q9H098 is also shown in right top, homolog Q5U4F3 showed in right bottom. They are colored based on secondary structures. 

  Q9H098 MAEPDYIEDDNPELIRPQKLINPVKTSRNHQDLHRELLMNQKRGLAPQNKPELQKVMEKRKRDQVIKQKEEEAQKKKSDLEIELLKRQQKLEQLELEKQK 100
  Q5U4F3 MAEPDYIEDDNPELIRPQKLINPVKTSRNHQDLHRELLMNQKRGLAPQNKPELQKVMEKRRRDQVIKQKEEEAQKKKSDLEIELLKRQQKLEQLELEKQK 100

  Q9H098 LQEEQENAPEFVKVKGNLRRTGQEVAQAQES 131
  Q5U4F3 LQEEQENAPEFVKVKGNLRRTGQEVAQAQES 131

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0043005 neuron projection
1. PB GO:0031398 positive regulation of protein ubiquitination
1. PB GO:0015629 actin cytoskeleton
1. PB GO:2000134 negative regulation of G1/S transition of mitotic cell cycle
1. PB GO:0071385 cellular response to glucocorticoid stimulus
1. PB GO:0001725 stress fiber
1. PB GO:0005925 focal adhesion
1. PB GO:0030041 actin filament polymerization
1. PB GO:0032587 ruffle membrane
1. PB GO:0051017 actin filament bundle assembly
1. PB GO:0050890 cognition
1. PB GO:0045202 synapse
1. PB GO:0070507 regulation of microtubule cytoskeleton organization
1. PB GO:0003779 actin binding
1. PB GO:0031647 regulation of protein stability
1. PB GO:0007049 cell cycle
1. PB GO:0051895 negative regulation of focal adhesion assembly
1. PB GO:0030335 positive regulation of cell migration
1. PB GO:1900272 negative regulation of long-term synaptic potentiation
1. PB GO:0031669 cellular response to nutrient levels
1. PB GO:0032956 regulation of actin cytoskeleton organization
1. PB GO:0001558 regulation of cell growth
2. P GO:0042277 peptide binding
2. P GO:0035082 axoneme assembly
2. P GO:0051028 mRNA transport
2. P GO:0006942 regulation of striated muscle contraction
2. P GO:0005874 microtubule
2. P GO:0045177 apical part of cell
2. P GO:0061908 phagophore
2. P GO:0031444 slow-twitch skeletal muscle fiber contraction
2. P GO:0006937 regulation of muscle contraction
2. P GO:0030172 troponin C binding
2. P GO:1903612 positive regulation of calcium-dependent ATPase activity
2. P GO:1905048 regulation of metallopeptidase activity
2. P GO:2000157 negative regulation of ubiquitin-specific protease activity
2. P GO:0030016 myofibril
2. P GO:0000032 cell wall mannoprotein biosynthetic process
2. P GO:0007409 axonogenesis
2. P GO:0034728 nucleosome organization
2. P GO:0031490 chromatin DNA binding
2. P GO:0048268 clathrin coat assembly
2. P GO:0071796 K6-linked polyubiquitin modification-dependent protein binding
2. P GO:0031013 troponin I binding
2. P GO:0051764 actin crosslink formation
2. P GO:0120095 vacuole-isolation membrane contact site
2. P GO:0032435 negative regulation of proteasomal ubiquitin-dependent protein catabolic process
2. P GO:0000828 inositol hexakisphosphate kinase activity
2. P GO:0007052 mitotic spindle organization
2. P GO:0032781 positive regulation of ATP-dependent activity
2. P GO:0045214 sarcomere organization
2. P GO:0019776 Atg8 ligase activity
2. P GO:0005929 cilium
2. P GO:0010526 negative regulation of transposition, RNA-mediated
2. P GO:0030049 muscle filament sliding
2. P GO:0008016 regulation of heart contraction
2. P GO:0030998 linear element
2. P GO:0070495 negative regulation of thrombin-activated receptor signaling pathway
2. P GO:0007019 microtubule depolymerization
2. P GO:0016183 synaptic vesicle coating
2. P GO:0060170 ciliary membrane
2. P GO:0044196 host cell nucleolus
2. P GO:1905098 negative regulation of guanyl-nucleotide exchange factor activity
2. P GO:0007420 brain development
2. P GO:0005861 troponin complex
2. P GO:0009504 cell plate
2. P GO:0060048 cardiac muscle contraction
2. P GO:0005802 trans-Golgi network
2. P GO:0005198 structural molecule activity
2. P GO:0005865 striated muscle thin filament
2. P GO:0006936 muscle contraction
2. P GO:0030118 clathrin coat
2. P GO:0009615 response to virus
2. P GO:0000281 mitotic cytokinesis
2. P GO:0032780 negative regulation of ATP-dependent activity
2. P GO:0010596 negative regulation of endothelial cell migration
2. P GO:0032050 clathrin heavy chain binding
2. P GO:0005730 nucleolus
2. P GO:0030132 clathrin coat of coated pit
2. P GO:0030130 clathrin coat of trans-Golgi network vesicle
2. P GO:0055009 atrial cardiac muscle tissue morphogenesis
2. P GO:0051497 negative regulation of stress fiber assembly
2. P GO:0003014 renal system process
2. P GO:1904293 negative regulation of ERAD pathway
2. P GO:0031110 regulation of microtubule polymerization or depolymerization
2. P GO:1903343 positive regulation of meiotic DNA double-strand break formation
2. P GO:0006886 intracellular protein transport
2. P GO:1990584 cardiac Troponin complex
2. P GO:0061436 establishment of skin barrier
2. P GO:0035024 negative regulation of Rho protein signal transduction
2. P GO:0031115 negative regulation of microtubule polymerization
2. P GO:0048306 calcium-dependent protein binding
2. P GO:1903094 negative regulation of protein K48-linked deubiquitination
2. P GO:0055072 iron ion homeostasis
2. P GO:0061635 regulation of protein complex stability
2. P GO:0031397 negative regulation of protein ubiquitination
2. P GO:0005523 tropomyosin binding
2. P GO:0000408 EKC/KEOPS complex
2. P GO:0030125 clathrin vesicle coat
2. P GO:0048012 hepatocyte growth factor receptor signaling pathway
2. P GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
2. P GO:0051592 response to calcium ion
2. P GO:0034098 VCP-NPL4-UFD1 AAA ATPase complex
2. P GO:0097512 cardiac myofibril
2. P GO:0005634 nucleus
2. P GO:0072583 clathrin-dependent endocytosis
2. P GO:0031593 polyubiquitin modification-dependent protein binding
2. P GO:1905037 autophagosome organization
2. P GO:0061564 axon development
2. P GO:0043462 regulation of ATP-dependent activity
2. P GO:0000722 telomere maintenance via recombination
2. P GO:0055010 ventricular cardiac muscle tissue morphogenesis
2. P GO:0042769 obsolete DNA damage response, detection of DNA damage
2. P GO:0051117 ATPase binding
2. P GO:0030672 synaptic vesicle membrane
2. P GO:0062209 spatial regulation of meiotic DNA double-strand break formation involved in reciprocal meiotic recombination
2. P GO:0060271 cilium assembly
2. P GO:0003009 skeletal muscle contraction
2. P GO:0000781 chromosome, telomeric region
2. P GO:0030317 flagellated sperm motility
2. P GO:0051272 positive regulation of cellular component movement
2. P GO:0031175 neuron projection development
2. P GO:0032972 regulation of muscle filament sliding speed
2. P GO:0006915 apoptotic process
2. P GO:0036435 K48-linked polyubiquitin modification-dependent protein binding
2. P GO:0099631 postsynaptic endocytic zone cytoplasmic component
2. P GO:0098835 presynaptic endocytic zone membrane
2. P GO:0031014 troponin T binding
2. P GO:0032196 transposition
2. P GO:0006364 rRNA processing
2. P GO:0032797 SMN complex
2. P GO:0034274 Atg12-Atg5-Atg16 complex
2. P GO:0015631 tubulin binding
2. P GO:0045334 clathrin-coated endocytic vesicle
2. P GO:1904855 proteasome regulatory particle binding
2. P GO:0030017 sarcomere
2. P GO:0071439 clathrin complex
2. P GO:0030674 protein-macromolecule adaptor activity
3. B GO:0040008 regulation of growth
3. B GO:0016607 nuclear speck
3. B GO:0007605 sensory perception of sound

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB A5A6J4 Actin-associated protein FAM107A 8.62e-07 7.40e-27 1.67e-34
1. PB Q3TGF2 Protein FAM107B 3.43e-11 7.14e-131 1.41e-86
1. PB Q9H098 Protein FAM107B 0 7.34e-160 1.45e-87
1. PB Q5U4F3 Protein FAM107B 0.00e+00 1.01e-133 4.11e-87
1. PB M0R3K6 Actin-associated protein FAM107A 1.06e-06 2.19e-27 3.40e-32
1. PB Q5NVP3 Actin-associated protein FAM107A 6.85e-07 4.97e-27 2.76e-34
1. PB Q2KI00 Protein FAM107B 2.28e-11 2.38e-111 3.87e-85
1. PB O95990 Actin-associated protein FAM107A 4.21e-06 2.37e-24 1.65e-34
1. PB Q78TU8 Actin-associated protein FAM107A 1.04e-06 2.18e-18 2.68e-32
2. P Q5BK43 Epithelial-stromal interaction protein 1 1.29e-03 1.71e-04 NA
2. P P0CU44 Cytosolic-abundant heat soluble protein 77611 3.00e-04 5.74e-05 NA
2. P A9YWH3 Stathmin 3.18e-05 1.98e-08 NA
2. P Q08BG7 Short coiled-coil protein A 5.70e-04 5.99e-04 NA
2. P B6LI37 Cilia- and flagella-associated protein HOATZ 9.15e-04 1.63e-04 NA
2. P Q6DUB7 Stathmin 3.02e-05 1.98e-08 NA
2. P Q6FUQ5 rRNA-processing protein FYV7 6.80e-05 4.99e-07 NA
2. P Q3E772 Protein LSO2 1.63e-04 6.62e-06 NA
2. P P16949 Stathmin 5.13e-04 1.98e-08 NA
2. P O14276 rRNA-processing protein fyv7 3.39e-05 7.23e-08 NA
2. P Q12247 rRNA-processing protein FYV7 5.77e-05 5.75e-04 NA
2. P P04975 Clathrin light chain B 5.53e-04 1.10e-02 NA
2. P Q10492 Pinin homolog 1 6.77e-05 4.77e-05 NA
2. P Q9USR4 Meiotic recombination protein rec27 1.51e-05 1.52e-03 NA
2. P Q6CIS0 Protein FYV6 4.39e-04 9.57e-04 NA
2. P W0T661 Autophagy-related protein 16 2.16e-06 4.41e-02 NA
2. P Q99LQ4 Small vasohibin-binding protein 4.28e-05 5.01e-03 NA
2. P P0C746 HTLV-1 basic zipper factor NA 3.23e-02 NA
2. P Q5R9E5 Protein FAM32A 4.49e-04 3.15e-04 NA
2. P P02642 Troponin T, cardiac muscle isoforms 1.28e-03 6.50e-04 NA
2. P Q9USY8 Uncharacterized protein C16H5.15 4.22e-03 4.64e-03 NA
2. P Q9VWA1 Clathrin light chain 1.86e-03 7.65e-03 NA
2. P B4YNF1 Uncharacterized protein V11 NA 1.54e-03 NA
2. P Q6IP50 UBX domain-containing protein 1-A 4.38e-03 2.50e-02 NA
2. P Q9Y708 rRNA-processing protein cgrA 4.80e-06 6.57e-11 NA
2. P A5PN52 Cilia- and flagella-associated protein HOATZ 6.28e-04 2.89e-09 NA
2. P Q9HEG2 60S ribosomal subunit assembly/export protein loc-1 3.11e-03 1.42e-03 NA
2. P J7M799 Cytosolic-abundant heat soluble protein 1 2.47e-04 5.41e-03 NA
2. P Q24JV4 UPF0390 protein zgc136864 2.95e-02 3.64e-02 NA
2. P Q96J88 Epithelial-stromal interaction protein 1 4.25e-04 4.82e-02 NA
2. P P0CU50 Cytosolic-abundant heat soluble protein 94063 1.84e-04 8.79e-06 NA
2. P Q7SDA6 rRNA-processing protein cgr-1 3.95e-05 4.70e-07 NA
2. P Q6PI97 Cilia- and flagella-associated protein HOATZ 4.03e-03 3.48e-02 NA
2. P O14181 54S ribosomal protein L28, mitochondrial 7.37e-04 3.29e-04 NA
2. P Q4KLG3 Small vasohibin-binding protein 1.99e-04 5.01e-03 NA
2. P Q2TVY9 rRNA-processing protein cgrA 1.02e-05 4.55e-14 NA
2. P P54227 Stathmin 3.24e-05 6.22e-11 NA
2. P P45378 Troponin T, fast skeletal muscle 5.88e-03 2.96e-03 NA
2. P P12620 Troponin T, fast skeletal muscle isoforms 4.47e-03 7.23e-03 NA
2. P Q8MKH6 Troponin T, slow skeletal muscle 2.47e-03 1.18e-02 NA
2. P Q922Y1 UBX domain-containing protein 1 4.20e-04 1.35e-02 NA
2. P Q09006 Stathmin-1-A 6.97e-05 5.33e-06 NA
2. P A6ZR60 Regulator of Ty1 transposition protein 105 3.60e-04 6.90e-05 NA
2. P P08082 Clathrin light chain B 5.20e-04 3.80e-04 NA
2. P B2RYG1 Protein FAM32A 3.47e-04 9.43e-05 NA
2. P P0CU43 Cytosolic-abundant heat soluble protein 77580 3.87e-04 5.37e-05 NA
2. P Q9Y421 Protein FAM32A 3.02e-04 3.15e-04 NA
2. P P0CU51 Cytosolic-abundant heat soluble protein 107838 1.05e-04 6.39e-05 NA
2. P Q0UVD1 rRNA-processing protein CGR1 1.23e-04 2.58e-12 NA
2. P P50751 Troponin T, cardiac muscle 1.15e-03 1.09e-02 NA
2. P Q6BVJ8 EKC/KEOPS complex subunit GON7 7.08e-03 2.67e-02 NA
2. P A6QR31 Protein FAM32A 1.34e-03 3.15e-04 NA
2. P Q4I5Z5 rRNA-processing protein CGR1 1.54e-04 4.60e-12 NA
2. P P50752 Troponin T, cardiac muscle 3.97e-03 5.79e-03 NA
2. P Q10273 Uncharacterized protein C13G7.09c 3.88e-04 1.08e-02 NA
2. P Q9UTM1 Uncharacterized protein C144.01 5.28e-04 2.69e-07 NA
2. P Q6CXR4 EKC/KEOPS complex subunit GON7 9.84e-03 9.87e-04 NA
2. P P06398 Troponin T, fast skeletal muscle isoforms 6.01e-04 3.93e-03 NA
2. P P50753 Troponin T, cardiac muscle 3.17e-03 3.93e-03 NA
2. P P20885 Probable protein Rev NA 2.79e-02 NA
2. P Q4WK56 UPF0390 protein AFUA_1G03640 2.24e-02 2.61e-04 NA
2. P Q63ZW2 MICOS complex subunit mic25a 7.62e-05 1.02e-02 NA
2. P Q6CNQ3 rRNA-processing protein CGR1 1.28e-04 1.60e-13 NA
2. P Q6BIC4 rRNA-processing protein CGR1 5.29e-05 1.46e-08 NA
2. P P02641 Troponin T, fast skeletal muscle 3.10e-03 4.05e-04 NA
2. P P13789 Troponin T, cardiac muscle 6.36e-04 3.15e-04 NA
2. P P09497 Clathrin light chain B 8.53e-04 1.38e-03 NA
2. P P13668 Stathmin 4.62e-04 1.70e-10 NA
2. P P0C745 HTLV-1 basic zipper factor NA 1.39e-02 NA
2. P Q6FMA5 Protein FYV6 3.84e-04 3.09e-04 NA
2. P Q6CRY6 rRNA-processing protein FYV7 4.61e-06 5.09e-05 NA
2. P B4YNE5 Uncharacterized protein V5 NA 1.49e-04 NA
2. P Q148I0 Leydig cell tumor 10 kDa protein homolog 1.39e-02 1.15e-02 NA
2. P P53188 rRNA-processing protein CGR1 1.54e-04 1.66e-11 NA
2. P A3LP19 Regulator of rDNA transcription 14 1.90e-04 8.50e-03 NA
2. P Q9HEQ8 rRNA-processing protein cgrA 4.13e-04 3.23e-13 NA
2. P Q32P68 Cilia- and flagella-associated protein HOATZ 4.70e-03 3.78e-02 NA
2. P Q9BYN8 28S ribosomal protein S26, mitochondrial 2.28e-04 4.68e-03 NA
2. P Q8MKI3 Troponin T, fast skeletal muscle 3.22e-03 3.15e-02 NA
2. P Q54B75 Uncharacterized protein DDB_G0293860 1.42e-03 2.59e-02 NA
2. P Q4R712 Stathmin 3.21e-05 1.98e-08 NA
2. P Q9UTJ4 rRNA-processing protein cgr1 2.67e-04 2.77e-12 NA
2. P P0CM66 rRNA-processing protein CGR1 3.00e-03 5.69e-07 NA
2. P Q5ZKU0 PRKR-interacting protein 1 homolog 4.54e-04 2.18e-02 NA
2. P Q752U2 rRNA-processing protein CGR1 1.20e-05 4.73e-10 NA
2. P P31395 Stathmin 7.86e-05 3.04e-09 NA
2. P Q54EP0 Putative uncharacterized protein DDB_G0291422 9.11e-06 3.23e-02 NA
2. P A1C8E1 rRNA-processing protein cgrA 1.42e-04 9.12e-13 NA
2. P P0CU45 Cytosolic-abundant heat soluble protein 94205 2.49e-04 2.31e-05 NA
2. P P09741 Troponin T, cardiac muscle 3.92e-04 3.43e-03 NA
2. P Q3T0C7 Stathmin 3.34e-05 1.98e-08 NA
2. P P0CM67 rRNA-processing protein CGR1 1.93e-03 5.69e-07 NA
2. P J7MDG6 Cytosolic-abundant heat soluble protein 2 1.33e-04 1.21e-05 NA
2. P Q0C7E6 rRNA-processing protein cgrA 2.39e-05 2.28e-14 NA
2. P P0CU46 Cytosolic-abundant heat soluble protein 86272 1.27e-04 3.65e-04 NA
2. P Q1E554 rRNA-processing protein CGR1 4.53e-05 5.74e-05 NA
2. P Q9C108 Uncharacterized protein PB1E7.01c 1.46e-02 2.00e-02 NA
2. P B5FZ42 Small vasohibin-binding protein 1.12e-03 2.93e-03 NA
2. P A5DFI4 Regulator of rDNA transcription 14 1.12e-04 6.32e-03 NA
2. P Q6GLV4 UBX domain-containing protein 1-B 6.11e-04 3.06e-02 NA
2. P C5DP87 Regulator of rDNA transcription 14 2.11e-03 4.37e-02 NA
2. P Q8R0E5 Putative uncharacterized protein ZNRD1-AS1 1.31e-02 1.32e-03 NA
2. P Q2HDR6 rRNA-processing protein CGR1 1.55e-04 1.26e-09 NA
2. P Q59WI7 rRNA-processing protein CGR1 1.74e-04 1.09e-07 NA
2. P P0CU52 Cytosolic-abundant heat soluble protein 106094 2.22e-04 5.40e-04 NA
2. P Q6GQN4 Protein FAM32A-like 1.09e-03 1.66e-02 NA
2. P Q6IRU5 Clathrin light chain B 2.38e-03 9.48e-04 NA
2. P P0CU48 Cytosolic-abundant heat soluble protein 94205 2.51e-04 8.79e-06 NA
2. P O04209 Clathrin light chain 2 5.39e-03 3.42e-02 NA
2. P Q499N6 UBX domain-containing protein 1 4.40e-03 2.28e-02 NA
2. P B8Y7Y5 INO80 complex subunit 5 3.13e-04 1.05e-08 NA
2. P Q75CZ6 rRNA-processing protein FYV7 3.40e-06 3.02e-04 NA
2. P P53913 Protein FYV6 4.33e-04 3.08e-03 NA
2. P P19032 Probable protein Rev NA 5.52e-04 NA
2. P Q75NG9 Troponin T, fast skeletal muscle 2.37e-03 1.15e-02 NA
2. P Q5REM2 Leydig cell tumor 10 kDa protein homolog 9.29e-03 3.35e-02 NA
2. P Q6FVC7 rRNA-processing protein CGR1 6.55e-05 1.21e-14 NA
2. P P45379 Troponin T, cardiac muscle 7.83e-03 2.66e-05 NA
2. P Q4SUE2 Translation machinery-associated protein 7 2.25e-03 3.89e-03 NA
2. P Q6NXA9 UBX domain-containing protein 1 3.16e-03 2.34e-03 NA
2. P P09739 Troponin T, fast skeletal muscle 4.20e-03 2.24e-02 NA
2. P Q3E827 Protein LSO1 3.99e-04 3.84e-04 NA
2. P Q6C1V5 rRNA-processing protein CGR1 2.94e-04 2.00e-17 NA
2. P B0JZ89 Protein FAM32A 1.71e-03 7.28e-05 NA
2. P P40063 Regulator of Ty1 transposition protein 105 1.49e-03 6.90e-05 NA
2. P Q9CR80 Protein FAM32A 1.55e-03 1.05e-04 NA