Summary

Q9H2J1

Homolog: Q8N8V8.
Function: Transmembrane protein 105.

Statistics

Total GO Annotation: 122
Unique PROST Go: 80
Unique BLAST Go: 42

Total Homologs: 64
Unique PROST Homologs: 48
Unique BLAST Homologs: 15

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was Q8N8V8 (Transmembrane protein 105) with a FATCAT P-Value: 0.0235 and RMSD of 2.34 angstrom. The sequence alignment identity is 25.3%.
Structural alignment shown in left. Query protein Q9H2J1 colored as red in alignment, homolog Q8N8V8 colored as blue. Query protein Q9H2J1 is also shown in right top, homolog Q8N8V8 showed in right bottom. They are colored based on secondary structures. 

  Q9H2J1 MEFHYVAQADLELL----TSSNPPASASQSTGITGGSHRARPGPVHFIDKVTDKPSHSHPFALKENWNLNPEPSSPPSPLFLEAPSRQASQHHGASPGAG 96
  Q8N8V8 -----------MLLKVRRASLKPPATPHQ------GAFRA--GNV--IGQLI--------YLL--TWSLFTAWLRPPT-L-LQGP-RTSPQ--GSPPRS- 63

  Q9H2J1 TSAGCPFEKCCSTEP-CLSGLGDVGRGEAASLRARPGSGASRGQ-G--PGSRVSCRRDLGKPLH-APAGFS---AGEVHTTPL-GNLGA----- 176
  Q8N8V8 -----PWGDCA--EPSCLC---EM------KIRRRRHEGPAWGQSGFLAG---------G--LHLVPSSLSLAACGVVRMKGLWGR-GAGIRGR 129

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0033088 negative regulation of immature T cell proliferation in thymus
2. P GO:0090398 cellular senescence
2. P GO:0090399 replicative senescence
2. P GO:0004566 beta-glucuronidase activity
2. P GO:0060058 positive regulation of apoptotic process involved in mammary gland involution
2. P GO:0035986 obsolete senescence-associated heterochromatin focus assembly
2. P GO:0050873 brown fat cell differentiation
2. P GO:0021549 cerebellum development
2. P GO:0090482 vitamin transmembrane transporter activity
2. P GO:0070542 response to fatty acid
2. P GO:0039592 suppression by virus of G2/M transition of host mitotic cell cycle
2. P GO:0097371 MDM2/MDM4 family protein binding
2. P GO:0008285 negative regulation of cell population proliferation
2. P GO:0055105 ubiquitin-protein transferase inhibitor activity
2. P GO:0005977 glycogen metabolic process
2. P GO:0000209 protein polyubiquitination
2. P GO:0035985 senescence-associated heterochromatin focus
2. P GO:0043065 positive regulation of apoptotic process
2. P GO:1903051 negative regulation of proteolysis involved in cellular protein catabolic process
2. P GO:0051059 NF-kappaB binding
2. P GO:0051168 nuclear export
2. P GO:0030545 signaling receptor regulator activity
2. P GO:2000059 negative regulation of ubiquitin-dependent protein catabolic process
2. P GO:0051090 regulation of DNA-binding transcription factor activity
2. P GO:0009860 pollen tube growth
2. P GO:0106071 positive regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway
2. P GO:0106072 negative regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway
2. P GO:0070996 type 1 melanocortin receptor binding
2. P GO:0031781 type 3 melanocortin receptor binding
2. P GO:0004864 protein phosphatase inhibitor activity
2. P GO:0022008 neurogenesis
2. P GO:0050850 positive regulation of calcium-mediated signaling
2. P GO:0001953 negative regulation of cell-matrix adhesion
2. P GO:0008544 epidermis development
2. P GO:0035019 somatic stem cell population maintenance
2. P GO:0050848 regulation of calcium-mediated signaling
2. P GO:0061771 response to caloric restriction
2. P GO:0019391 glucuronoside catabolic process
2. P GO:2000346 negative regulation of hepatocyte proliferation
2. P GO:0031780 corticotropin hormone receptor binding
2. P GO:0045746 negative regulation of Notch signaling pathway
2. P GO:0070534 protein K63-linked ubiquitination
2. P GO:0044196 host cell nucleolus
2. P GO:0046822 regulation of nucleocytoplasmic transport
2. P GO:0017157 regulation of exocytosis
2. P GO:0045786 negative regulation of cell cycle
2. P GO:0051650 establishment of vesicle localization
2. P GO:0010243 response to organonitrogen compound
2. P GO:2000111 positive regulation of macrophage apoptotic process
2. P GO:0007219 Notch signaling pathway
2. P GO:0033600 negative regulation of mammary gland epithelial cell proliferation
2. P GO:0043231 intracellular membrane-bounded organelle
2. P GO:0106070 regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway
2. P GO:0034393 positive regulation of smooth muscle cell apoptotic process
2. P GO:0072659 protein localization to plasma membrane
2. P GO:0031783 type 5 melanocortin receptor binding
2. P GO:0005783 endoplasmic reticulum
2. P GO:0044095 host cell nucleoplasm
2. P GO:0008452 RNA ligase activity
2. P GO:0005813 centrosome
2. P GO:0030834 regulation of actin filament depolymerization
2. P GO:1903077 negative regulation of protein localization to plasma membrane
2. P GO:0031782 type 4 melanocortin receptor binding
2. P GO:0004861 cyclin-dependent protein serine/threonine kinase inhibitor activity
2. P GO:0030889 negative regulation of B cell proliferation
2. P GO:0007569 cell aging
2. P GO:0000137 Golgi cis cisterna
2. P GO:0045736 negative regulation of cyclin-dependent protein serine/threonine kinase activity
2. P GO:0051726 regulation of cell cycle
2. P GO:0005801 cis-Golgi network
2. P GO:0015631 tubulin binding
2. P GO:0042326 negative regulation of phosphorylation
2. P GO:0044782 cilium organization
2. P GO:0001652 granular component
2. P GO:0048103 somatic stem cell division
2. P GO:0009303 rRNA transcription
2. P GO:0051444 negative regulation of ubiquitin-protein transferase activity
2. P GO:0051225 spindle assembly
2. P GO:0004865 protein serine/threonine phosphatase inhibitor activity
2. P GO:2000774 positive regulation of cellular senescence
3. B GO:0051213 dioxygenase activity
3. B GO:0048642 negative regulation of skeletal muscle tissue development
3. B GO:0030433 ubiquitin-dependent ERAD pathway
3. B GO:1904292 regulation of ERAD pathway
3. B GO:0000151 ubiquitin ligase complex
3. B GO:0030175 filopodium
3. B GO:0050821 protein stabilization
3. B GO:0033634 positive regulation of cell-cell adhesion mediated by integrin
3. B GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
3. B GO:0031528 microvillus membrane
3. B GO:0030136 clathrin-coated vesicle
3. B GO:0102751 UDP-alpha-D-glucose:glucosyl-glycogenin alpha-D-glucosyltransferase activity
3. B GO:0016579 protein deubiquitination
3. B GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
3. B GO:1900037 regulation of cellular response to hypoxia
3. B GO:0072015 glomerular visceral epithelial cell development
3. B GO:0007249 I-kappaB kinase/NF-kappaB signaling
3. B GO:1901215 negative regulation of neuron death
3. B GO:0090068 positive regulation of cell cycle process
3. B GO:0022408 negative regulation of cell-cell adhesion
3. B GO:0034451 centriolar satellite
3. B GO:0034976 response to endoplasmic reticulum stress
3. B GO:0031490 chromatin DNA binding
3. B GO:0036057 slit diaphragm
3. B GO:0044666 MLL3/4 complex
3. B GO:0071558 histone H3-tri/di-methyl-lysine-27 demethylase activity
3. B GO:0007162 negative regulation of cell adhesion
3. B GO:0043947 obsolete positive regulation by host of symbiont catalytic activity
3. B GO:0072583 clathrin-dependent endocytosis
3. B GO:0034097 response to cytokine
3. B GO:1990380 Lys48-specific deubiquitinase activity
3. B GO:0031647 regulation of protein stability
3. B GO:1901799 negative regulation of proteasomal protein catabolic process
3. B GO:0032688 negative regulation of interferon-beta production
3. B GO:0072175 epithelial tube formation
3. B GO:0008466 glycogenin glucosyltransferase activity
3. B GO:0032050 clathrin heavy chain binding
3. B GO:0032534 regulation of microvillus assembly
3. B GO:0038061 NIK/NF-kappaB signaling
3. B GO:0051879 Hsp90 protein binding
3. B GO:0001726 ruffle
3. B GO:0071557 histone H3-K27 demethylation

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q9H2J1 Uncharacterized protein ARRDC1-AS1 0 7.27e-171 4.50e-125
2. P P75675 Putative uncharacterized protein YkfJ 5.04e-01 7.13e-03 NA
2. P Q8TCY5 Melanocortin-2 receptor accessory protein 2.35e-01 6.56e-03 NA
2. P P9WKY3 Uncharacterized protein Rv3424c 6.07e-01 1.64e-05 NA
2. P P06926 Protein E4 NA 1.78e-05 NA
2. P O77618 Tumor suppressor ARF 6.95e-02 6.50e-07 NA
2. P F4I5N6 CRIB domain-containing protein RIC3 4.47e-02 3.17e-03 NA
2. P Q77MT6 Uncharacterized gene 1 protein NA 8.08e-03 NA
2. P B9ELP3 Protein Flattop 2.43e-01 1.02e-02 NA
2. P Q6ZS52 Putative uncharacterized protein FLJ45825 5.32e-02 6.76e-07 NA
2. P P92537 Uncharacterized mitochondrial protein AtMg01030 1.43e-01 7.21e-03 NA
2. P P23788 Uncharacterized 12.3 kDa protein in repressor 5'region NA 1.02e-05 NA
2. P P9WKY2 Uncharacterized protein MT3532.2 6.38e-01 1.64e-05 NA
2. P Q8WMS3 Protein phosphatase 1 regulatory subunit 1A 1.32e-01 8.42e-03 NA
2. P P58512 Uncharacterized protein encoded by LINC01547 4.59e-01 8.91e-04 NA
2. P P86434 Putative uncharacterized protein ADORA2A-AS1 7.03e-01 1.59e-07 NA
2. P P87318 Uncharacterized protein C31F10.17c 2.35e-01 5.00e-03 NA
2. P Q3ZCB6 Pancreatic progenitor cell differentiation and proliferation factor 1.02e-01 3.68e-03 NA
2. P Q96K30 RBPJ-interacting and tubulin-associated protein 1 1.22e-01 2.59e-03 NA
2. P G2TRK6 Putative uncharacterized protein C9G1.14 3.84e-01 2.48e-02 NA
2. P Q5SWW7 Uncharacterized protein C10orf55 1.05e-02 3.25e-02 NA
2. P Q8N9X3 Putative uncharacterized protein encoded by LINC01356 3.72e-01 8.61e-08 NA
2. P O83993 Uncharacterized protein TP_1030 8.96e-02 2.16e-05 NA
2. P Q6GZQ9 Uncharacterized protein 066L NA 1.32e-05 NA
2. P P16819 Uncharacterized protein UL62 NA 4.84e-03 NA
2. P P0C880 Putative uncharacterized protein FLJ40606 4.47e-02 3.72e-03 NA
2. P Q2HJ75 RBPJ-interacting and tubulin-associated protein 1 7.07e-02 3.28e-02 NA
2. P Q7Z4U5 Uncharacterized protein C6orf201 5.28e-01 3.34e-03 NA
2. P P05865 Protein Rev NA 3.12e-02 NA
2. P Q9NTK1 Protein DEPP1 8.91e-02 1.42e-02 NA
2. P B2GHI7 Putative hydro-lyase KRH_21160 6.56e-01 1.78e-02 NA
2. P Q15486 Putative inactive beta-glucuronidase-like protein SMA3 6.41e-01 3.15e-02 NA
2. P P65086 Uncharacterized protein Mb3458c 6.37e-01 1.64e-05 NA
2. P Q8N5N4 Uncharacterized protein C3orf22 1.85e-01 2.69e-05 NA
2. P Q8N8V8 Transmembrane protein 105 2.35e-02 3.81e-02 NA
2. P P0DJX2 U exon protein NA 1.27e-02 NA
2. P P0CT01 UPF0329 protein ECU11_0080 4.67e-01 4.00e-02 NA
2. P Q8QZZ9 Tumor suppressor ARF 2.58e-02 4.22e-03 NA
2. P Q68UT4 Melanocortin-2 receptor accessory protein 2.91e-02 1.06e-02 NA
2. P P75600 Putative MgpC-like protein MPN_092 6.87e-01 1.23e-03 NA
2. P Q53S99 Folate transporter-like protein C2orf83 2.96e-01 1.30e-05 NA
2. P Q69552 Protein U17 NA 2.71e-02 NA
2. P Q9D159 Melanocortin-2 receptor accessory protein 2.04e-01 6.54e-04 NA
2. P Q6ZR54 Putative uncharacterized protein FLJ46641 5.41e-02 1.15e-02 NA
2. P Q5RBE4 Protein DEPP 1.43e-01 1.42e-02 NA
2. P P38362 Putative uncharacterized protein YBR300C 4.63e-01 1.54e-02 NA
2. P Q9HBQ8 Putative golgin subfamily A member 2B 1.35e-01 1.24e-03 NA
2. P Q13522 Protein phosphatase 1 regulatory subunit 1A 1.26e-01 1.35e-02 NA
2. P Q0P140 Putative uncharacterized protein HSD52 3.59e-01 2.56e-03 NA
3. B O00592 Podocalyxin 4.92e-01 NA 0.012
3. B Q5SR53 Putative uncharacterized protein PIK3CD-AS1 1.57e-01 NA 1.81e-04
3. B Q8N2A0 Putative uncharacterized protein encoded by LINC00269 9.92e-02 NA 4.57e-08
3. B Q04864 Proto-oncogene c-Rel 3.42e-01 NA 0.031
3. B Q6ZUF6 Putative uncharacterized protein encoded by LINC00336 6.26e-02 NA 2.70e-06
3. B Q9Y2Z0 Protein SGT1 homolog 8.63e-01 NA 8.08e-04
3. B Q6B4Z3 Histone demethylase UTY 5.10e-01 NA 6.38e-05
3. B Q8N976 Putative uncharacterized protein FLJ38264 3.24e-01 NA 3.04e-09
3. B O15488 Glycogenin-2 4.20e-01 NA 0.009
3. B Q3ZCU0 Protein GVQW3 1.76e-01 NA 6.73e-07
3. B Q8N769 Uncharacterized protein C14orf178 2.69e-01 NA 1.62e-09
3. B O94966 Ubiquitin carboxyl-terminal hydrolase 19 9.32e-01 NA 0.007
3. B Q5VW38 Protein GPR107 8.67e-01 NA 5.14e-05
3. B O14628 Zinc finger protein 195 9.54e-01 NA 1.31e-08
3. B Q9NV72 Zinc finger protein 701 3.33e-01 NA 5.66e-05