Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
Q9ER81
(Torsin-1A-interacting protein 2, isoform IFRG15) with a FATCAT P-Value: 0.0 and RMSD of 1.71 angstrom. The sequence alignment identity is 97.7%.
Structural alignment shown in left. Query protein Q9H496 colored as red in alignment, homolog Q9ER81 colored as blue.
Query protein Q9H496 is also shown in right top, homolog Q9ER81 showed in right bottom. They are colored based on secondary structures.
Q9H496 MFSDNSHCPDCGQQWFPSLELGHWLYQTELVENECYQVFLDRINRADYCPECYPDNPANRSLVLPWSFPLEWAPQNLTRWTFEKACHPFLLGPPLVRKRI 100 Q9ER81 MFSDNSHCPDCGQQWFPSLELGHWLYQTELVENECYQVFLDRINRADYCPECYPDNPANRSLVLPWSFPLEWAPQNLTRWTFEKACHPFLLGPPLVRKKI 100 Q9H496 HDSRVAGFNPALQLILTRTDKTLNKKLGQNK 131 Q9ER81 HDSRVAGFNPALQLILSRTDKTLNKKLGQSK 131
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0090435 | protein localization to nuclear envelope |
| 2. P | GO:0006370 | 7-methylguanosine mRNA capping |
| 2. P | GO:0005705 | polytene chromosome interband |
| 2. P | GO:0005737 | cytoplasm |
| 2. P | GO:0006342 | |
| 2. P | GO:0000182 | rDNA binding |
| 2. P | GO:0032785 | negative regulation of DNA-templated transcription, elongation |
| 2. P | GO:0006397 | mRNA processing |
| 2. P | GO:0033553 | rDNA heterochromatin |
| 2. P | GO:0005524 | ATP binding |
| 2. P | GO:2001209 | positive regulation of transcription elongation from RNA polymerase I promoter |
| 2. P | GO:0008270 | zinc ion binding |
| 2. P | GO:0000775 | chromosome, centromeric region |
| 2. P | GO:0008298 | intracellular mRNA localization |
| 2. P | GO:0000398 | mRNA splicing, via spliceosome |
| 2. P | GO:0032968 | positive regulation of transcription elongation from RNA polymerase II promoter |
| 2. P | GO:0045892 | negative regulation of transcription, DNA-templated |
| 2. P | GO:0010507 | negative regulation of autophagy |
| 2. P | GO:0006368 | transcription elongation from RNA polymerase II promoter |
| 2. P | GO:0034244 | negative regulation of transcription elongation from RNA polymerase II promoter |
| 2. P | GO:0006325 | chromatin organization |
| 2. P | GO:0001181 | RNA polymerase I general transcription initiation factor activity |
| 2. P | GO:0003711 | transcription elongation regulator activity |
| 2. P | GO:2000232 | regulation of rRNA processing |
| 2. P | GO:0001108 | bacterial-type RNA polymerase holo enzyme binding |
| 2. P | GO:0044877 | protein-containing complex binding |
| 2. P | GO:0031934 | mating-type region heterochromatin |
| 2. P | GO:2001208 | negative regulation of transcription elongation by RNA polymerase I |
| 2. P | GO:0090262 | regulation of transcription-coupled nucleotide-excision repair |
| 2. P | GO:0000993 | RNA polymerase II complex binding |
| 2. P | GO:0000776 | kinetochore |
| 2. P | GO:0034243 | regulation of transcription elongation from RNA polymerase II promoter |
| 2. P | GO:0032786 | positive regulation of DNA-templated transcription, elongation |
| 2. P | GO:0003727 | single-stranded RNA binding |
| 2. P | GO:0001000 | bacterial-type RNA polymerase core enzyme binding |
| 2. P | GO:0005703 | polytene chromosome puff |
| 2. P | GO:0032044 | DSIF complex |
| 2. P | GO:0007059 | chromosome segregation |
| 2. P | GO:0003677 | DNA binding |
| 3. B | GO:0005783 | endoplasmic reticulum |
| 3. B | GO:0051117 | ATPase binding |
| 3. B | GO:0016020 | membrane |
| 3. B | GO:0007029 | endoplasmic reticulum organization |
| 3. B | GO:0001671 | ATPase activator activity |
| 3. B | GO:0061024 | membrane organization |
| 3. B | GO:0032781 | positive regulation of ATP-dependent activity |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q9H496 | Torsin-1A-interacting protein 2, isoform IFRG15 | 0 | 8.02e-122 | 3.56e-96 |
| 1. PB | Q9ER81 | Torsin-1A-interacting protein 2, isoform IFRG15 | 0.00e+00 | 5.54e-98 | 9.70e-95 |
| 2. P | A8FSR0 | Transcriptional repressor NrdR | 8.25e-02 | 3.97e-02 | NA |
| 2. P | A0KNH2 | Transcriptional repressor NrdR | 8.37e-02 | 2.31e-02 | NA |
| 2. P | A4Y965 | Transcriptional repressor NrdR | 5.96e-02 | 2.67e-02 | NA |
| 2. P | B1XF01 | Transcriptional repressor NrdR | 8.52e-02 | 3.84e-02 | NA |
| 2. P | Q9BI88 | UPF0587 protein F46B6.12 | 9.06e-01 | 4.62e-02 | NA |
| 2. P | B5Z3R7 | Transcriptional repressor NrdR | 8.87e-02 | 3.84e-02 | NA |
| 2. P | Q4QLW5 | Transcriptional repressor NrdR | 8.01e-02 | 6.35e-03 | NA |
| 2. P | Q0HXJ5 | Transcriptional repressor NrdR | 8.17e-02 | 3.84e-02 | NA |
| 2. P | P81205 | Transcription elongation factor SPT4 | 7.86e-01 | 1.83e-04 | NA |
| 2. P | Q752J8 | Transcription elongation factor SPT4 | 7.62e-01 | 1.33e-05 | NA |
| 2. P | Q57950 | Uncharacterized ZPR1-like protein MJ0530 | 1.03e-01 | 3.14e-02 | NA |
| 2. P | Q7S743 | Transcription elongation factor spt4 | 7.18e-01 | 6.22e-05 | NA |
| 2. P | C0H3U9 | Protein BsdD | 6.85e-01 | 1.33e-03 | NA |
| 2. P | Q037Z3 | Transcriptional repressor NrdR | 3.23e-02 | 4.62e-02 | NA |
| 2. P | B7L647 | Transcriptional repressor NrdR | 8.49e-02 | 3.84e-02 | NA |
| 2. P | Q32JG7 | Transcriptional repressor NrdR | 8.70e-02 | 3.84e-02 | NA |
| 2. P | B5Y0X8 | Transcriptional repressor NrdR | 8.62e-02 | 4.01e-02 | NA |
| 2. P | Q8SWQ4 | Uncharacterized protein ECU01_0250 | 9.75e-01 | 3.64e-03 | NA |
| 2. P | P63272 | Transcription elongation factor SPT4 | 5.46e-01 | 6.77e-04 | NA |
| 2. P | Q9TVQ5 | Transcription elongation factor SPT4 | 7.09e-01 | 2.49e-03 | NA |
| 2. P | A6VP30 | Transcriptional repressor NrdR | 1.21e-01 | 1.53e-02 | NA |
| 2. P | P38048 | Uncharacterized protein YhgB | 1.60e-01 | 3.75e-02 | NA |
| 2. P | Q8XJJ7 | Transcriptional repressor NrdR | 2.26e-01 | 4.86e-02 | NA |
| 2. P | B5EXF6 | Transcriptional repressor NrdR | 8.41e-02 | 4.21e-02 | NA |
| 2. P | Q57SE9 | Transcriptional repressor NrdR | 3.03e-01 | 4.21e-02 | NA |
| 2. P | A3QC58 | Transcriptional repressor NrdR | 7.27e-02 | 1.74e-02 | NA |
| 2. P | Q5QXT5 | Transcriptional repressor NrdR | 8.55e-02 | 1.58e-02 | NA |
| 2. P | C0QQA0 | Transcriptional repressor NrdR | 4.83e-02 | 2.07e-02 | NA |
| 2. P | Q9RKY0 | RNA polymerase-binding protein RbpA | 7.33e-01 | 2.93e-02 | NA |
| 2. P | Q31CL5 | Transcriptional repressor NrdR | 1.99e-02 | 1.80e-02 | NA |
| 2. P | A6T5E6 | Transcriptional repressor NrdR | 8.60e-02 | 4.01e-02 | NA |
| 2. P | B4SWQ7 | Transcriptional repressor NrdR | 8.44e-02 | 4.21e-02 | NA |
| 2. P | Q9P7K8 | Transcription elongation factor spt4 | 2.80e-01 | 2.48e-04 | NA |
| 2. P | B7UJN6 | Transcriptional repressor NrdR | 8.70e-02 | 3.84e-02 | NA |
| 2. P | Q0TPJ5 | Transcriptional repressor NrdR | 2.25e-01 | 4.86e-02 | NA |
| 2. P | Q3Z4Z6 | Transcriptional repressor NrdR | 8.52e-02 | 3.84e-02 | NA |
| 2. P | Q3K647 | Transcriptional repressor NrdR | 5.93e-02 | 2.81e-02 | NA |
| 2. P | Q4R941 | Transcription elongation factor SPT4 | 6.78e-01 | 6.77e-04 | NA |
| 2. P | Q0TKM8 | Transcriptional repressor NrdR | 8.59e-02 | 3.84e-02 | NA |
| 2. P | A5GR10 | Transcriptional repressor NrdR | 1.93e-02 | 2.60e-03 | NA |
| 2. P | B5BDB7 | Transcriptional repressor NrdR | 8.71e-02 | 4.21e-02 | NA |
| 2. P | C4ZTH0 | Transcriptional repressor NrdR | 8.78e-02 | 3.84e-02 | NA |
| 2. P | Q9CMR2 | Transcriptional repressor NrdR | 8.18e-02 | 1.57e-02 | NA |
| 2. P | A1WVG5 | Transcriptional repressor NrdR | 1.51e-01 | 4.47e-02 | NA |
| 2. P | A5UDC6 | Transcriptional repressor NrdR | 7.72e-02 | 4.33e-03 | NA |
| 2. P | B8CJM8 | Transcriptional repressor NrdR | 8.22e-02 | 1.10e-02 | NA |
| 2. P | Q5PFS6 | Transcriptional repressor NrdR | 3.00e-01 | 4.21e-02 | NA |
| 2. P | C4LAE5 | Transcriptional repressor NrdR | 8.53e-02 | 2.74e-02 | NA |
| 2. P | Q6DGQ0 | Transcription elongation factor SPT4 | 5.42e-01 | 1.08e-04 | NA |
| 2. P | B7NJ84 | Transcriptional repressor NrdR | 8.77e-02 | 3.84e-02 | NA |
| 2. P | P63271 | Transcription elongation factor SPT4-A | 5.43e-01 | 6.77e-04 | NA |
| 2. P | B0UUR2 | Transcriptional repressor NrdR | 8.50e-02 | 8.89e-03 | NA |
| 2. P | O31831 | Uncharacterized protein YoaQ | 2.73e-01 | 3.21e-06 | NA |
| 2. P | B7M3Q2 | Transcriptional repressor NrdR | 8.77e-02 | 3.84e-02 | NA |
| 2. P | Q5HZ97 | Transcription elongation factor SPT4 | 6.17e-01 | 4.37e-04 | NA |
| 2. P | Q0HL92 | Transcriptional repressor NrdR | 8.17e-02 | 3.84e-02 | NA |
| 2. P | O51824 | Transcriptional repressor NrdR | 8.47e-02 | 4.94e-02 | NA |
| 2. P | O31838 | Uncharacterized protein YozI | 2.96e-01 | 8.30e-08 | NA |
| 2. P | Q3II24 | Transcriptional repressor NrdR | 8.71e-02 | 3.24e-02 | NA |
| 2. P | B1J036 | Transcriptional repressor NrdR | 8.51e-02 | 3.84e-02 | NA |
| 2. P | Q5UPC4 | Uncharacterized protein L48 | NA | 3.61e-07 | NA |
| 2. P | P0A8D1 | Transcriptional repressor NrdR | 8.71e-02 | 3.84e-02 | NA |
| 2. P | Q1RFC8 | Transcriptional repressor NrdR | 8.52e-02 | 3.84e-02 | NA |
| 2. P | A8H1Q1 | Transcriptional repressor NrdR | 6.13e-02 | 3.11e-02 | NA |
| 2. P | Q9Z199 | Transcription elongation factor SPT4-B | 6.17e-01 | 1.06e-02 | NA |
| 2. P | Q6FMX1 | Transcription elongation factor SPT4 | 7.58e-01 | 1.20e-05 | NA |
| 2. P | B2V5T9 | Transcriptional repressor NrdR | 3.73e-02 | 2.91e-03 | NA |
| 2. P | A1A883 | Transcriptional repressor NrdR | 8.52e-02 | 3.84e-02 | NA |
| 2. P | C5BS89 | Transcriptional repressor NrdR | 5.54e-02 | 1.53e-02 | NA |
| 2. P | B7N8W5 | Transcriptional repressor NrdR | 8.74e-02 | 3.84e-02 | NA |
| 2. P | Q2GE55 | Transcriptional repressor NrdR | 6.23e-02 | 2.93e-03 | NA |
| 2. P | Q4I5W5 | Transcription elongation factor SPT4 | 5.89e-01 | 1.71e-02 | NA |
| 2. P | B8CWK6 | Transcriptional repressor NrdR | 3.87e-02 | 3.87e-02 | NA |
| 2. P | A7ZIG6 | Transcriptional repressor NrdR | 8.50e-02 | 3.84e-02 | NA |
| 2. P | Q8EBN9 | Transcriptional repressor NrdR | 6.03e-02 | 3.84e-02 | NA |
| 2. P | B9MJV0 | Transcriptional repressor NrdR | 4.42e-02 | 4.21e-02 | NA |
| 2. P | B6EI95 | Transcriptional repressor NrdR | 6.46e-02 | 4.36e-02 | NA |
| 2. P | Q65SS8 | Transcriptional repressor NrdR | 7.86e-02 | 4.07e-02 | NA |
| 2. P | A7ZX65 | Transcriptional repressor NrdR | 8.83e-02 | 3.84e-02 | NA |
| 2. P | Q4K592 | Transcriptional repressor NrdR | 5.98e-02 | 4.98e-02 | NA |
| 2. P | Q0T7H6 | Transcriptional repressor NrdR | 8.66e-02 | 4.94e-02 | NA |
| 2. P | Q5AK73 | Transcription elongation factor SPT4 | 5.71e-01 | 3.51e-04 | NA |
| 2. P | A4XL57 | Transcriptional repressor NrdR | 4.64e-02 | 2.88e-02 | NA |
| 2. P | P0A8D0 | Transcriptional repressor NrdR | 8.49e-02 | 3.84e-02 | NA |
| 2. P | A1SUU1 | Transcriptional repressor NrdR | 6.32e-02 | 8.00e-03 | NA |
| 2. P | B5FKS0 | Transcriptional repressor NrdR | 8.50e-02 | 4.21e-02 | NA |
| 2. P | B3WF53 | Transcriptional repressor NrdR | 8.76e-02 | 4.62e-02 | NA |
| 2. P | B0TJY6 | Transcriptional repressor NrdR | 6.00e-02 | 4.66e-02 | NA |
| 2. P | B5R6R6 | Transcriptional repressor NrdR | 8.47e-02 | 4.21e-02 | NA |
| 2. P | Q0I495 | Transcriptional repressor NrdR | 8.45e-02 | 8.89e-03 | NA |
| 2. P | A0KU61 | Transcriptional repressor NrdR | 6.07e-02 | 3.84e-02 | NA |
| 2. P | C6DB31 | Transcriptional repressor NrdR | 8.57e-02 | 2.65e-02 | NA |
| 2. P | Q6BHA5 | Transcription elongation factor SPT4 | 6.31e-01 | 1.66e-04 | NA |
| 2. P | B8F3G6 | Transcriptional repressor NrdR | 8.52e-02 | 1.21e-02 | NA |
| 2. P | B1LJG3 | Transcriptional repressor NrdR | 8.74e-02 | 3.84e-02 | NA |
| 2. P | B6HZL4 | Transcriptional repressor NrdR | 8.56e-02 | 3.84e-02 | NA |
| 2. P | Q94C60 | Transcription elongation factor SPT4 homolog 2 | 5.47e-01 | 1.60e-03 | NA |
| 2. P | P32914 | Transcription elongation factor SPT4 | 7.60e-01 | 8.41e-04 | NA |
| 2. P | Q3SYX6 | Transcription elongation factor SPT4 | 5.41e-01 | 6.77e-04 | NA |
| 2. P | B1KJK0 | Transcriptional repressor NrdR | 8.25e-02 | 4.74e-02 | NA |
| 2. P | Q12Q47 | Transcriptional repressor NrdR | 5.97e-02 | 1.44e-02 | NA |
| 2. P | Q15WA2 | Transcriptional repressor NrdR | 8.08e-02 | 3.68e-02 | NA |
| 2. P | C5CHN3 | Transcriptional repressor NrdR | 2.59e-02 | 2.83e-02 | NA |
| 2. P | Q5RFH5 | Transcription elongation factor SPT4 | 6.31e-01 | 3.09e-04 | NA |
| 2. P | Q7VLP8 | Transcriptional repressor NrdR | 2.16e-01 | 4.14e-02 | NA |
| 2. P | B4TM95 | Transcriptional repressor NrdR | 8.77e-02 | 4.21e-02 | NA |
| 2. P | Q73N26 | Transcriptional repressor NrdR | 1.15e-01 | 3.68e-02 | NA |
| 2. P | P0A8D2 | Transcriptional repressor NrdR | 8.51e-02 | 3.84e-02 | NA |
| 2. P | B7MQC8 | Transcriptional repressor NrdR | 8.77e-02 | 3.84e-02 | NA |
| 2. P | A1WQP5 | Transcriptional repressor NrdR | 9.02e-02 | 2.69e-02 | NA |
| 2. P | B8D6L8 | Ribosome biogenesis protein Nop10 | 5.35e-01 | 4.07e-02 | NA |
| 2. P | P0A2M1 | Transcriptional repressor NrdR | 8.46e-02 | 4.21e-02 | NA |
| 2. P | A4XZ39 | Transcriptional repressor NrdR | 6.11e-02 | 3.53e-02 | NA |
| 2. P | O27252 | Protein MTH_1184 | 2.23e-01 | 4.90e-02 | NA |
| 2. P | Q6D850 | Transcriptional repressor NrdR | 8.86e-02 | 3.65e-02 | NA |
| 2. P | A9MX16 | Transcriptional repressor NrdR | 8.44e-02 | 4.21e-02 | NA |
| 2. P | A1RHD1 | Transcriptional repressor NrdR | 5.96e-02 | 2.67e-02 | NA |
| 2. P | B7MD71 | Transcriptional repressor NrdR | 8.50e-02 | 3.84e-02 | NA |
| 2. P | Q4WU00 | Transcription elongation factor spt4 | 7.35e-01 | 1.54e-02 | NA |
| 2. P | B5QTG3 | Transcriptional repressor NrdR | 3.06e-01 | 4.21e-02 | NA |
| 2. P | P0A2M2 | Putative transcriptional repressor NrdR | 8.72e-02 | 4.21e-02 | NA |
| 2. P | P44946 | Transcriptional repressor NrdR | 8.11e-02 | 6.35e-03 | NA |
| 2. P | Q8LCQ3 | Transcription elongation factor SPT4 homolog 1 | 6.89e-01 | 1.38e-03 | NA |
| 2. P | B7LMH4 | Transcriptional repressor NrdR | 8.49e-02 | 3.44e-02 | NA |
| 2. P | Q38VS7 | Transcriptional repressor NrdR | 5.91e-02 | 1.75e-02 | NA |
| 2. P | Q325I8 | Transcriptional repressor NrdR | 8.50e-02 | 3.84e-02 | NA |
| 2. P | O29624 | Uncharacterized protein AF_0631 | 1.03e-01 | 1.56e-03 | NA |
| 2. P | B4T8Q6 | Transcriptional repressor NrdR | 8.52e-02 | 4.21e-02 | NA |
| 2. P | Q8EPF0 | Transcriptional repressor NrdR | 5.81e-02 | 2.69e-02 | NA |