Summary

Q9H496

Homolog: Q9ER81.
Function: Torsin-1A-interacting protein 2, isoform IFRG15.

Statistics

Total GO Annotation: 46
Unique PROST Go: 38
Unique BLAST Go: 7

Total Homologs: 131
Unique PROST Homologs: 129
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q9ER81 (Torsin-1A-interacting protein 2, isoform IFRG15) with a FATCAT P-Value: 0.0 and RMSD of 1.71 angstrom. The sequence alignment identity is 97.7%.
Structural alignment shown in left. Query protein Q9H496 colored as red in alignment, homolog Q9ER81 colored as blue. Query protein Q9H496 is also shown in right top, homolog Q9ER81 showed in right bottom. They are colored based on secondary structures. 

  Q9H496 MFSDNSHCPDCGQQWFPSLELGHWLYQTELVENECYQVFLDRINRADYCPECYPDNPANRSLVLPWSFPLEWAPQNLTRWTFEKACHPFLLGPPLVRKRI 100
  Q9ER81 MFSDNSHCPDCGQQWFPSLELGHWLYQTELVENECYQVFLDRINRADYCPECYPDNPANRSLVLPWSFPLEWAPQNLTRWTFEKACHPFLLGPPLVRKKI 100

  Q9H496 HDSRVAGFNPALQLILTRTDKTLNKKLGQNK 131
  Q9ER81 HDSRVAGFNPALQLILSRTDKTLNKKLGQSK 131

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0090435 protein localization to nuclear envelope
2. P GO:0006370 7-methylguanosine mRNA capping
2. P GO:0005705 polytene chromosome interband
2. P GO:0005737 cytoplasm
2. P GO:0006342
2. P GO:0000182 rDNA binding
2. P GO:0032785 negative regulation of DNA-templated transcription, elongation
2. P GO:0006397 mRNA processing
2. P GO:0033553 rDNA heterochromatin
2. P GO:0005524 ATP binding
2. P GO:2001209 positive regulation of transcription elongation from RNA polymerase I promoter
2. P GO:0008270 zinc ion binding
2. P GO:0000775 chromosome, centromeric region
2. P GO:0008298 intracellular mRNA localization
2. P GO:0000398 mRNA splicing, via spliceosome
2. P GO:0032968 positive regulation of transcription elongation from RNA polymerase II promoter
2. P GO:0045892 negative regulation of transcription, DNA-templated
2. P GO:0010507 negative regulation of autophagy
2. P GO:0006368 transcription elongation from RNA polymerase II promoter
2. P GO:0034244 negative regulation of transcription elongation from RNA polymerase II promoter
2. P GO:0006325 chromatin organization
2. P GO:0001181 RNA polymerase I general transcription initiation factor activity
2. P GO:0003711 transcription elongation regulator activity
2. P GO:2000232 regulation of rRNA processing
2. P GO:0001108 bacterial-type RNA polymerase holo enzyme binding
2. P GO:0044877 protein-containing complex binding
2. P GO:0031934 mating-type region heterochromatin
2. P GO:2001208 negative regulation of transcription elongation by RNA polymerase I
2. P GO:0090262 regulation of transcription-coupled nucleotide-excision repair
2. P GO:0000993 RNA polymerase II complex binding
2. P GO:0000776 kinetochore
2. P GO:0034243 regulation of transcription elongation from RNA polymerase II promoter
2. P GO:0032786 positive regulation of DNA-templated transcription, elongation
2. P GO:0003727 single-stranded RNA binding
2. P GO:0001000 bacterial-type RNA polymerase core enzyme binding
2. P GO:0005703 polytene chromosome puff
2. P GO:0032044 DSIF complex
2. P GO:0007059 chromosome segregation
2. P GO:0003677 DNA binding
3. B GO:0005783 endoplasmic reticulum
3. B GO:0051117 ATPase binding
3. B GO:0016020 membrane
3. B GO:0007029 endoplasmic reticulum organization
3. B GO:0001671 ATPase activator activity
3. B GO:0061024 membrane organization
3. B GO:0032781 positive regulation of ATP-dependent activity

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q9H496 Torsin-1A-interacting protein 2, isoform IFRG15 0 8.02e-122 3.56e-96
1. PB Q9ER81 Torsin-1A-interacting protein 2, isoform IFRG15 0.00e+00 5.54e-98 9.70e-95
2. P A8FSR0 Transcriptional repressor NrdR 8.25e-02 3.97e-02 NA
2. P A0KNH2 Transcriptional repressor NrdR 8.37e-02 2.31e-02 NA
2. P A4Y965 Transcriptional repressor NrdR 5.96e-02 2.67e-02 NA
2. P B1XF01 Transcriptional repressor NrdR 8.52e-02 3.84e-02 NA
2. P Q9BI88 UPF0587 protein F46B6.12 9.06e-01 4.62e-02 NA
2. P B5Z3R7 Transcriptional repressor NrdR 8.87e-02 3.84e-02 NA
2. P Q4QLW5 Transcriptional repressor NrdR 8.01e-02 6.35e-03 NA
2. P Q0HXJ5 Transcriptional repressor NrdR 8.17e-02 3.84e-02 NA
2. P P81205 Transcription elongation factor SPT4 7.86e-01 1.83e-04 NA
2. P Q752J8 Transcription elongation factor SPT4 7.62e-01 1.33e-05 NA
2. P Q57950 Uncharacterized ZPR1-like protein MJ0530 1.03e-01 3.14e-02 NA
2. P Q7S743 Transcription elongation factor spt4 7.18e-01 6.22e-05 NA
2. P C0H3U9 Protein BsdD 6.85e-01 1.33e-03 NA
2. P Q037Z3 Transcriptional repressor NrdR 3.23e-02 4.62e-02 NA
2. P B7L647 Transcriptional repressor NrdR 8.49e-02 3.84e-02 NA
2. P Q32JG7 Transcriptional repressor NrdR 8.70e-02 3.84e-02 NA
2. P B5Y0X8 Transcriptional repressor NrdR 8.62e-02 4.01e-02 NA
2. P Q8SWQ4 Uncharacterized protein ECU01_0250 9.75e-01 3.64e-03 NA
2. P P63272 Transcription elongation factor SPT4 5.46e-01 6.77e-04 NA
2. P Q9TVQ5 Transcription elongation factor SPT4 7.09e-01 2.49e-03 NA
2. P A6VP30 Transcriptional repressor NrdR 1.21e-01 1.53e-02 NA
2. P P38048 Uncharacterized protein YhgB 1.60e-01 3.75e-02 NA
2. P Q8XJJ7 Transcriptional repressor NrdR 2.26e-01 4.86e-02 NA
2. P B5EXF6 Transcriptional repressor NrdR 8.41e-02 4.21e-02 NA
2. P Q57SE9 Transcriptional repressor NrdR 3.03e-01 4.21e-02 NA
2. P A3QC58 Transcriptional repressor NrdR 7.27e-02 1.74e-02 NA
2. P Q5QXT5 Transcriptional repressor NrdR 8.55e-02 1.58e-02 NA
2. P C0QQA0 Transcriptional repressor NrdR 4.83e-02 2.07e-02 NA
2. P Q9RKY0 RNA polymerase-binding protein RbpA 7.33e-01 2.93e-02 NA
2. P Q31CL5 Transcriptional repressor NrdR 1.99e-02 1.80e-02 NA
2. P A6T5E6 Transcriptional repressor NrdR 8.60e-02 4.01e-02 NA
2. P B4SWQ7 Transcriptional repressor NrdR 8.44e-02 4.21e-02 NA
2. P Q9P7K8 Transcription elongation factor spt4 2.80e-01 2.48e-04 NA
2. P B7UJN6 Transcriptional repressor NrdR 8.70e-02 3.84e-02 NA
2. P Q0TPJ5 Transcriptional repressor NrdR 2.25e-01 4.86e-02 NA
2. P Q3Z4Z6 Transcriptional repressor NrdR 8.52e-02 3.84e-02 NA
2. P Q3K647 Transcriptional repressor NrdR 5.93e-02 2.81e-02 NA
2. P Q4R941 Transcription elongation factor SPT4 6.78e-01 6.77e-04 NA
2. P Q0TKM8 Transcriptional repressor NrdR 8.59e-02 3.84e-02 NA
2. P A5GR10 Transcriptional repressor NrdR 1.93e-02 2.60e-03 NA
2. P B5BDB7 Transcriptional repressor NrdR 8.71e-02 4.21e-02 NA
2. P C4ZTH0 Transcriptional repressor NrdR 8.78e-02 3.84e-02 NA
2. P Q9CMR2 Transcriptional repressor NrdR 8.18e-02 1.57e-02 NA
2. P A1WVG5 Transcriptional repressor NrdR 1.51e-01 4.47e-02 NA
2. P A5UDC6 Transcriptional repressor NrdR 7.72e-02 4.33e-03 NA
2. P B8CJM8 Transcriptional repressor NrdR 8.22e-02 1.10e-02 NA
2. P Q5PFS6 Transcriptional repressor NrdR 3.00e-01 4.21e-02 NA
2. P C4LAE5 Transcriptional repressor NrdR 8.53e-02 2.74e-02 NA
2. P Q6DGQ0 Transcription elongation factor SPT4 5.42e-01 1.08e-04 NA
2. P B7NJ84 Transcriptional repressor NrdR 8.77e-02 3.84e-02 NA
2. P P63271 Transcription elongation factor SPT4-A 5.43e-01 6.77e-04 NA
2. P B0UUR2 Transcriptional repressor NrdR 8.50e-02 8.89e-03 NA
2. P O31831 Uncharacterized protein YoaQ 2.73e-01 3.21e-06 NA
2. P B7M3Q2 Transcriptional repressor NrdR 8.77e-02 3.84e-02 NA
2. P Q5HZ97 Transcription elongation factor SPT4 6.17e-01 4.37e-04 NA
2. P Q0HL92 Transcriptional repressor NrdR 8.17e-02 3.84e-02 NA
2. P O51824 Transcriptional repressor NrdR 8.47e-02 4.94e-02 NA
2. P O31838 Uncharacterized protein YozI 2.96e-01 8.30e-08 NA
2. P Q3II24 Transcriptional repressor NrdR 8.71e-02 3.24e-02 NA
2. P B1J036 Transcriptional repressor NrdR 8.51e-02 3.84e-02 NA
2. P Q5UPC4 Uncharacterized protein L48 NA 3.61e-07 NA
2. P P0A8D1 Transcriptional repressor NrdR 8.71e-02 3.84e-02 NA
2. P Q1RFC8 Transcriptional repressor NrdR 8.52e-02 3.84e-02 NA
2. P A8H1Q1 Transcriptional repressor NrdR 6.13e-02 3.11e-02 NA
2. P Q9Z199 Transcription elongation factor SPT4-B 6.17e-01 1.06e-02 NA
2. P Q6FMX1 Transcription elongation factor SPT4 7.58e-01 1.20e-05 NA
2. P B2V5T9 Transcriptional repressor NrdR 3.73e-02 2.91e-03 NA
2. P A1A883 Transcriptional repressor NrdR 8.52e-02 3.84e-02 NA
2. P C5BS89 Transcriptional repressor NrdR 5.54e-02 1.53e-02 NA
2. P B7N8W5 Transcriptional repressor NrdR 8.74e-02 3.84e-02 NA
2. P Q2GE55 Transcriptional repressor NrdR 6.23e-02 2.93e-03 NA
2. P Q4I5W5 Transcription elongation factor SPT4 5.89e-01 1.71e-02 NA
2. P B8CWK6 Transcriptional repressor NrdR 3.87e-02 3.87e-02 NA
2. P A7ZIG6 Transcriptional repressor NrdR 8.50e-02 3.84e-02 NA
2. P Q8EBN9 Transcriptional repressor NrdR 6.03e-02 3.84e-02 NA
2. P B9MJV0 Transcriptional repressor NrdR 4.42e-02 4.21e-02 NA
2. P B6EI95 Transcriptional repressor NrdR 6.46e-02 4.36e-02 NA
2. P Q65SS8 Transcriptional repressor NrdR 7.86e-02 4.07e-02 NA
2. P A7ZX65 Transcriptional repressor NrdR 8.83e-02 3.84e-02 NA
2. P Q4K592 Transcriptional repressor NrdR 5.98e-02 4.98e-02 NA
2. P Q0T7H6 Transcriptional repressor NrdR 8.66e-02 4.94e-02 NA
2. P Q5AK73 Transcription elongation factor SPT4 5.71e-01 3.51e-04 NA
2. P A4XL57 Transcriptional repressor NrdR 4.64e-02 2.88e-02 NA
2. P P0A8D0 Transcriptional repressor NrdR 8.49e-02 3.84e-02 NA
2. P A1SUU1 Transcriptional repressor NrdR 6.32e-02 8.00e-03 NA
2. P B5FKS0 Transcriptional repressor NrdR 8.50e-02 4.21e-02 NA
2. P B3WF53 Transcriptional repressor NrdR 8.76e-02 4.62e-02 NA
2. P B0TJY6 Transcriptional repressor NrdR 6.00e-02 4.66e-02 NA
2. P B5R6R6 Transcriptional repressor NrdR 8.47e-02 4.21e-02 NA
2. P Q0I495 Transcriptional repressor NrdR 8.45e-02 8.89e-03 NA
2. P A0KU61 Transcriptional repressor NrdR 6.07e-02 3.84e-02 NA
2. P C6DB31 Transcriptional repressor NrdR 8.57e-02 2.65e-02 NA
2. P Q6BHA5 Transcription elongation factor SPT4 6.31e-01 1.66e-04 NA
2. P B8F3G6 Transcriptional repressor NrdR 8.52e-02 1.21e-02 NA
2. P B1LJG3 Transcriptional repressor NrdR 8.74e-02 3.84e-02 NA
2. P B6HZL4 Transcriptional repressor NrdR 8.56e-02 3.84e-02 NA
2. P Q94C60 Transcription elongation factor SPT4 homolog 2 5.47e-01 1.60e-03 NA
2. P P32914 Transcription elongation factor SPT4 7.60e-01 8.41e-04 NA
2. P Q3SYX6 Transcription elongation factor SPT4 5.41e-01 6.77e-04 NA
2. P B1KJK0 Transcriptional repressor NrdR 8.25e-02 4.74e-02 NA
2. P Q12Q47 Transcriptional repressor NrdR 5.97e-02 1.44e-02 NA
2. P Q15WA2 Transcriptional repressor NrdR 8.08e-02 3.68e-02 NA
2. P C5CHN3 Transcriptional repressor NrdR 2.59e-02 2.83e-02 NA
2. P Q5RFH5 Transcription elongation factor SPT4 6.31e-01 3.09e-04 NA
2. P Q7VLP8 Transcriptional repressor NrdR 2.16e-01 4.14e-02 NA
2. P B4TM95 Transcriptional repressor NrdR 8.77e-02 4.21e-02 NA
2. P Q73N26 Transcriptional repressor NrdR 1.15e-01 3.68e-02 NA
2. P P0A8D2 Transcriptional repressor NrdR 8.51e-02 3.84e-02 NA
2. P B7MQC8 Transcriptional repressor NrdR 8.77e-02 3.84e-02 NA
2. P A1WQP5 Transcriptional repressor NrdR 9.02e-02 2.69e-02 NA
2. P B8D6L8 Ribosome biogenesis protein Nop10 5.35e-01 4.07e-02 NA
2. P P0A2M1 Transcriptional repressor NrdR 8.46e-02 4.21e-02 NA
2. P A4XZ39 Transcriptional repressor NrdR 6.11e-02 3.53e-02 NA
2. P O27252 Protein MTH_1184 2.23e-01 4.90e-02 NA
2. P Q6D850 Transcriptional repressor NrdR 8.86e-02 3.65e-02 NA
2. P A9MX16 Transcriptional repressor NrdR 8.44e-02 4.21e-02 NA
2. P A1RHD1 Transcriptional repressor NrdR 5.96e-02 2.67e-02 NA
2. P B7MD71 Transcriptional repressor NrdR 8.50e-02 3.84e-02 NA
2. P Q4WU00 Transcription elongation factor spt4 7.35e-01 1.54e-02 NA
2. P B5QTG3 Transcriptional repressor NrdR 3.06e-01 4.21e-02 NA
2. P P0A2M2 Putative transcriptional repressor NrdR 8.72e-02 4.21e-02 NA
2. P P44946 Transcriptional repressor NrdR 8.11e-02 6.35e-03 NA
2. P Q8LCQ3 Transcription elongation factor SPT4 homolog 1 6.89e-01 1.38e-03 NA
2. P B7LMH4 Transcriptional repressor NrdR 8.49e-02 3.44e-02 NA
2. P Q38VS7 Transcriptional repressor NrdR 5.91e-02 1.75e-02 NA
2. P Q325I8 Transcriptional repressor NrdR 8.50e-02 3.84e-02 NA
2. P O29624 Uncharacterized protein AF_0631 1.03e-01 1.56e-03 NA
2. P B4T8Q6 Transcriptional repressor NrdR 8.52e-02 4.21e-02 NA
2. P Q8EPF0 Transcriptional repressor NrdR 5.81e-02 2.69e-02 NA