Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 3. B was
Q9DAM9
(Fibronectin type 3 and ankyrin repeat domains 1 protein) with a FATCAT P-Value: 0.0 and RMSD of 1.99 angstrom. The sequence alignment identity is 21.5%.
Structural alignment shown in left. Query protein Q9H560 colored as red in alignment, homolog Q9DAM9 colored as blue.
Query protein Q9H560 is also shown in right top, homolog Q9DAM9 showed in right bottom. They are colored based on secondary structures.
Q9H560 -------------------------------MRKLFSFGRRLG---QALLDSMDQE------YAG---RGY---HIRD-WELRKIHRAAIK-----GD-- 46 Q9DAM9 MEPHKVVPLSKPHPPVVGKVTHHSIELYWDLEQK----EKRQGPQEQWLRFSIEEEDPKMHSY-GVIYTGYATRHVVEGLEPRTLYKFRLKVTSPSGEYE 95 Q9H560 -AAEVEHCLTR------RF-RDLDARDRKD---RTVL---HL----------T----CAH-GRVEVVTLLLSRRCQINIYDRLNRTPLMKAVHCQEEACA 117 Q9DAM9 YSPVVSVATTREPISSEHFHRAVSVND-EDLLLR-ILEGGHVMIDVPNKFGFTALMVAAQKGYTRLVKILVSNGTDVNLKNGSGKDSLM--LACYAGHLD 191 Q9H560 II--LLEHGANPNIKDIYSNTALHYAVYNKG-TSLAEKLLSHHANIEALNEEGN--TPL--LFAINSRRQQIVEFLLKNQANLHAIDNFRRTALMLAVQH 210 Q9DAM9 VVKYLRRHGASWEARDLGGCTALHWAA-DGGHCSVIDWMIKDGCEVDVV-DTGSGWTPLMRVSAV-TGSQKVASLLIEAGADVNIKDKDGKTPLMVAVLN 288 Q9H560 NSSSIVSLLLQQNINIFSQDLFGQTAEDYAVCYNFRSIQQQILEHKNKIL--KS--HL 264 Q9DAM9 NHEQLVQLLLDKGADATVKNEFGKGVLEMARVFDRQNV-LSLLEEKKKKMPRKSSVH- 344
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0036336 | dendritic cell migration |
| 1. PB | GO:0042994 | cytoplasmic sequestering of transcription factor |
| 1. PB | GO:0000122 | negative regulation of transcription by RNA polymerase II |
| 1. PB | GO:0032496 | response to lipopolysaccharide |
| 1. PB | GO:0050729 | positive regulation of inflammatory response |
| 1. PB | GO:0048709 | oligodendrocyte differentiation |
| 1. PB | GO:0043619 | regulation of transcription from RNA polymerase II promoter in response to oxidative stress |
| 1. PB | GO:0031670 | cellular response to nutrient |
| 1. PB | GO:0030016 | myofibril |
| 1. PB | GO:0006584 | catecholamine metabolic process |
| 1. PB | GO:0043161 | proteasome-mediated ubiquitin-dependent protein catabolic process |
| 1. PB | GO:0071345 | cellular response to cytokine stimulus |
| 1. PB | GO:0030424 | axon |
| 1. PB | GO:0051146 | striated muscle cell differentiation |
| 1. PB | GO:0090263 | positive regulation of canonical Wnt signaling pathway |
| 1. PB | GO:0042088 | T-helper 1 type immune response |
| 1. PB | GO:0016567 | protein ubiquitination |
| 1. PB | GO:0051059 | NF-kappaB binding |
| 1. PB | GO:0003714 | transcription corepressor activity |
| 1. PB | GO:0007605 | sensory perception of sound |
| 1. PB | GO:0051247 | positive regulation of protein metabolic process |
| 1. PB | GO:0010888 | negative regulation of lipid storage |
| 1. PB | GO:0008290 | F-actin capping protein complex |
| 1. PB | GO:0010468 | regulation of gene expression |
| 1. PB | GO:0085020 | protein K6-linked ubiquitination |
| 1. PB | GO:0036371 | protein localization to T-tubule |
| 1. PB | GO:0043403 | skeletal muscle tissue regeneration |
| 1. PB | GO:0002467 | germinal center formation |
| 1. PB | GO:0043066 | negative regulation of apoptotic process |
| 1. PB | GO:2000812 | regulation of barbed-end actin filament capping |
| 1. PB | GO:0051101 | regulation of DNA binding |
| 1. PB | GO:0010745 | negative regulation of macrophage derived foam cell differentiation |
| 1. PB | GO:0055013 | cardiac muscle cell development |
| 1. PB | GO:0045737 | positive regulation of cyclin-dependent protein serine/threonine kinase activity |
| 1. PB | GO:0061630 | ubiquitin protein ligase activity |
| 1. PB | GO:0031466 | Cul5-RING ubiquitin ligase complex |
| 1. PB | GO:0033257 | Bcl3/NF-kappaB2 complex |
| 1. PB | GO:0071260 | cellular response to mechanical stimulus |
| 1. PB | GO:0014704 | intercalated disc |
| 1. PB | GO:2000321 | positive regulation of T-helper 17 cell differentiation |
| 1. PB | GO:0019901 | protein kinase binding |
| 1. PB | GO:0010557 | positive regulation of macromolecule biosynthetic process |
| 1. PB | GO:0035690 | |
| 1. PB | GO:0007219 | Notch signaling pathway |
| 1. PB | GO:2001214 | positive regulation of vasculogenesis |
| 1. PB | GO:0001650 | fibrillar center |
| 1. PB | GO:0048536 | spleen development |
| 1. PB | GO:0035994 | response to muscle stretch |
| 1. PB | GO:0042826 | histone deacetylase binding |
| 1. PB | GO:1902230 | negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage |
| 1. PB | GO:0051092 | positive regulation of NF-kappaB transcription factor activity |
| 1. PB | GO:0070427 | nucleotide-binding oligomerization domain containing 1 signaling pathway |
| 1. PB | GO:1902807 | negative regulation of cell cycle G1/S phase transition |
| 1. PB | GO:0033280 | response to vitamin D |
| 1. PB | GO:0002040 | sprouting angiogenesis |
| 1. PB | GO:0002039 | p53 binding |
| 1. PB | GO:0045064 | T-helper 2 cell differentiation |
| 1. PB | GO:0080173 | male-female gamete recognition during double fertilization forming a zygote and endosperm |
| 1. PB | GO:2000279 | negative regulation of DNA biosynthetic process |
| 1. PB | GO:0071222 | cellular response to lipopolysaccharide |
| 1. PB | GO:0035914 | skeletal muscle cell differentiation |
| 1. PB | GO:0000731 | DNA synthesis involved in DNA repair |
| 1. PB | GO:0032996 | Bcl3-Bcl10 complex |
| 1. PB | GO:0071800 | podosome assembly |
| 1. PB | GO:0043517 | positive regulation of DNA damage response, signal transduction by p53 class mediator |
| 1. PB | GO:0031462 | Cul2-RING ubiquitin ligase complex |
| 1. PB | GO:0034142 | toll-like receptor 4 signaling pathway |
| 1. PB | GO:0000082 | G1/S transition of mitotic cell cycle |
| 1. PB | GO:0002455 | humoral immune response mediated by circulating immunoglobulin |
| 1. PB | GO:1901222 | regulation of NIK/NF-kappaB signaling |
| 1. PB | GO:0000151 | ubiquitin ligase complex |
| 1. PB | GO:0043409 | negative regulation of MAPK cascade |
| 1. PB | GO:0045662 | negative regulation of myoblast differentiation |
| 1. PB | GO:0071347 | cellular response to interleukin-1 |
| 1. PB | GO:0055007 | cardiac muscle cell differentiation |
| 1. PB | GO:0031674 | I band |
| 1. PB | GO:2000134 | negative regulation of G1/S transition of mitotic cell cycle |
| 1. PB | GO:0031625 | ubiquitin protein ligase binding |
| 1. PB | GO:0003713 | transcription coactivator activity |
| 1. PB | GO:0007249 | I-kappaB kinase/NF-kappaB signaling |
| 1. PB | GO:0008285 | negative regulation of cell population proliferation |
| 1. PB | GO:0010313 | phytochrome binding |
| 1. PB | GO:0045638 | negative regulation of myeloid cell differentiation |
| 1. PB | GO:0033209 | tumor necrosis factor-mediated signaling pathway |
| 1. PB | GO:0008139 | nuclear localization sequence binding |
| 1. PB | GO:0090201 | negative regulation of release of cytochrome c from mitochondria |
| 1. PB | GO:0001947 | heart looping |
| 1. PB | GO:0043065 | positive regulation of apoptotic process |
| 1. PB | GO:0048102 | autophagic cell death |
| 1. PB | GO:0030496 | midbody |
| 1. PB | GO:0005634 | nucleus |
| 1. PB | GO:0055008 | cardiac muscle tissue morphogenesis |
| 1. PB | GO:0010613 | positive regulation of cardiac muscle hypertrophy |
| 1. PB | GO:0008361 | regulation of cell size |
| 1. PB | GO:0045732 | positive regulation of protein catabolic process |
| 1. PB | GO:0070528 | protein kinase C signaling |
| 1. PB | GO:0097129 | cyclin D2-CDK4 complex |
| 1. PB | GO:0007253 | cytoplasmic sequestering of NF-kappaB |
| 1. PB | GO:1990756 | ubiquitin ligase-substrate adaptor activity |
| 1. PB | GO:0014732 | skeletal muscle atrophy |
| 1. PB | GO:0031432 | titin binding |
| 1. PB | GO:0010875 | positive regulation of cholesterol efflux |
| 1. PB | GO:0048471 | perinuclear region of cytoplasm |
| 1. PB | GO:0045746 | negative regulation of Notch signaling pathway |
| 1. PB | GO:0043518 | negative regulation of DNA damage response, signal transduction by p53 class mediator |
| 1. PB | GO:0043330 | response to exogenous dsRNA |
| 1. PB | GO:0050714 | positive regulation of protein secretion |
| 1. PB | GO:0071356 | cellular response to tumor necrosis factor |
| 1. PB | GO:0031663 | lipopolysaccharide-mediated signaling pathway |
| 1. PB | GO:0002315 | marginal zone B cell differentiation |
| 1. PB | GO:0061629 | RNA polymerase II-specific DNA-binding transcription factor binding |
| 1. PB | GO:0070682 | proteasome regulatory particle assembly |
| 1. PB | GO:0060253 | negative regulation of glial cell proliferation |
| 1. PB | GO:0042981 | regulation of apoptotic process |
| 1. PB | GO:0016021 | integral component of membrane |
| 1. PB | GO:0070412 | R-SMAD binding |
| 1. PB | GO:0021707 | cerebellar granule cell differentiation |
| 1. PB | GO:0033256 | I-kappaB/NF-kappaB complex |
| 1. PB | GO:0032991 | protein-containing complex |
| 1. PB | GO:0032495 | response to muramyl dipeptide |
| 1. PB | GO:0005829 | cytosol |
| 1. PB | GO:0004861 | cyclin-dependent protein serine/threonine kinase inhibitor activity |
| 1. PB | GO:0070431 | nucleotide-binding oligomerization domain containing 2 signaling pathway |
| 1. PB | GO:0051726 | regulation of cell cycle |
| 1. PB | GO:0002268 | follicular dendritic cell differentiation |
| 1. PB | GO:0031436 | BRCA1-BARD1 complex |
| 1. PB | GO:1902531 | regulation of intracellular signal transduction |
| 1. PB | GO:0035556 | intracellular signal transduction |
| 1. PB | GO:0071407 | cellular response to organic cyclic compound |
| 1. PB | GO:0042326 | negative regulation of phosphorylation |
| 1. PB | GO:0030307 | positive regulation of cell growth |
| 1. PB | GO:0045893 | positive regulation of transcription, DNA-templated |
| 1. PB | GO:0019730 | antimicrobial humoral response |
| 1. PB | GO:0032270 | positive regulation of cellular protein metabolic process |
| 1. PB | GO:0032088 | negative regulation of NF-kappaB transcription factor activity |
| 1. PB | GO:0005654 | nucleoplasm |
| 2. P | GO:0045581 | negative regulation of T cell differentiation |
| 2. P | GO:0022407 | regulation of cell-cell adhesion |
| 2. P | GO:0001938 | positive regulation of endothelial cell proliferation |
| 2. P | GO:0050680 | negative regulation of epithelial cell proliferation |
| 2. P | GO:0030511 | positive regulation of transforming growth factor beta receptor signaling pathway |
| 2. P | GO:0071560 | cellular response to transforming growth factor beta stimulus |
| 2. P | GO:0090398 | cellular senescence |
| 2. P | GO:0031542 | positive regulation of anthocyanin biosynthetic process |
| 2. P | GO:0042771 | intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator |
| 2. P | GO:0031398 | positive regulation of protein ubiquitination |
| 2. P | GO:0032717 | negative regulation of interleukin-8 production |
| 2. P | GO:0035986 | obsolete senescence-associated heterochromatin focus assembly |
| 2. P | GO:0045111 | intermediate filament cytoskeleton |
| 2. P | GO:2000291 | regulation of myoblast proliferation |
| 2. P | GO:2000813 | negative regulation of barbed-end actin filament capping |
| 2. P | GO:0032720 | negative regulation of tumor necrosis factor production |
| 2. P | GO:0010923 | negative regulation of phosphatase activity |
| 2. P | GO:0031532 | actin cytoskeleton reorganization |
| 2. P | GO:0030308 | negative regulation of cell growth |
| 2. P | GO:1902253 | regulation of intrinsic apoptotic signaling pathway by p53 class mediator |
| 2. P | GO:0039517 | modulation by virus of host protein serine/threonine phosphatase activity |
| 2. P | GO:0002043 | blood vessel endothelial cell proliferation involved in sprouting angiogenesis |
| 2. P | GO:0009411 | response to UV |
| 2. P | GO:1902367 | negative regulation of Notch signaling pathway involved in somitogenesis |
| 2. P | GO:0010225 | response to UV-C |
| 2. P | GO:2000111 | positive regulation of macrophage apoptotic process |
| 2. P | GO:0019005 | SCF ubiquitin ligase complex |
| 2. P | GO:0070316 | regulation of G0 to G1 transition |
| 2. P | GO:0000079 | regulation of cyclin-dependent protein serine/threonine kinase activity |
| 2. P | GO:0030539 | male genitalia development |
| 2. P | GO:0043231 | intracellular membrane-bounded organelle |
| 2. P | GO:0007265 | Ras protein signal transduction |
| 2. P | GO:0048868 | pollen tube development |
| 2. P | GO:0035985 | senescence-associated heterochromatin focus |
| 2. P | GO:0032733 | positive regulation of interleukin-10 production |
| 2. P | GO:0000502 | proteasome complex |
| 2. P | GO:0060297 | regulation of sarcomere organization |
| 2. P | GO:0000086 | G2/M transition of mitotic cell cycle |
| 2. P | GO:0019902 | phosphatase binding |
| 2. P | GO:0014866 | skeletal myofibril assembly |
| 2. P | GO:0043154 | negative regulation of cysteine-type endopeptidase activity involved in apoptotic process |
| 2. P | GO:0009567 | double fertilization forming a zygote and endosperm |
| 2. P | GO:0050852 | T cell receptor signaling pathway |
| 2. P | GO:0050931 | pigment cell differentiation |
| 2. P | GO:0033085 | negative regulation of T cell differentiation in thymus |
| 2. P | GO:0000791 | euchromatin |
| 2. P | GO:0032729 | positive regulation of interferon-gamma production |
| 2. P | GO:0006606 | protein import into nucleus |
| 2. P | GO:0042942 | D-serine transport |
| 2. P | GO:0030330 | DNA damage response, signal transduction by p53 class mediator |
| 2. P | GO:0039513 | suppression by virus of host catalytic activity |
| 2. P | GO:0031146 | SCF-dependent proteasomal ubiquitin-dependent protein catabolic process |
| 2. P | GO:0070245 | positive regulation of thymocyte apoptotic process |
| 2. P | GO:0004864 | protein phosphatase inhibitor activity |
| 2. P | GO:2000288 | positive regulation of myoblast proliferation |
| 2. P | GO:0031668 | cellular response to extracellular stimulus |
| 2. P | GO:0042832 | defense response to protozoan |
| 2. P | GO:0045736 | negative regulation of cyclin-dependent protein serine/threonine kinase activity |
| 2. P | GO:0009553 | embryo sac development |
| 2. P | GO:0042127 | regulation of cell population proliferation |
| 2. P | GO:0030219 | megakaryocyte differentiation |
| 2. P | GO:0032525 | somite rostral/caudal axis specification |
| 2. P | GO:1904855 | proteasome regulatory particle binding |
| 2. P | GO:0031425 | chloroplast RNA processing |
| 2. P | GO:0032436 | positive regulation of proteasomal ubiquitin-dependent protein catabolic process |
| 2. P | GO:0097602 | cullin family protein binding |
| 2. P | GO:0030858 | positive regulation of epithelial cell differentiation |
| 2. P | GO:0043422 | protein kinase B binding |
| 2. P | GO:0039644 | suppression by virus of host NF-kappaB cascade |
| 2. P | GO:0046426 | negative regulation of receptor signaling pathway via JAK-STAT |
| 2. P | GO:0016202 | regulation of striated muscle tissue development |
| 2. P | GO:0001569 | branching involved in blood vessel morphogenesis |
| 2. P | GO:0048145 | regulation of fibroblast proliferation |
| 2. P | GO:0032526 | response to retinoic acid |
| 2. P | GO:0006878 | cellular copper ion homeostasis |
| 3. B | GO:0005770 | late endosome |
| 3. B | GO:0034765 | regulation of ion transmembrane transport |
| 3. B | GO:0007094 | mitotic spindle assembly checkpoint signaling |
| 3. B | GO:0071625 | vocalization behavior |
| 3. B | GO:0048337 | positive regulation of mesodermal cell fate specification |
| 3. B | GO:0090037 | positive regulation of protein kinase C signaling |
| 3. B | GO:0051835 | positive regulation of synapse structural plasticity |
| 3. B | GO:0003215 | cardiac right ventricle morphogenesis |
| 3. B | GO:0006511 | ubiquitin-dependent protein catabolic process |
| 3. B | GO:0043011 | myeloid dendritic cell differentiation |
| 3. B | GO:0035148 | tube formation |
| 3. B | GO:0032456 | endocytic recycling |
| 3. B | GO:0007507 | heart development |
| 3. B | GO:0001701 | in utero embryonic development |
| 3. B | GO:0072104 | glomerular capillary formation |
| 3. B | GO:1903779 | regulation of cardiac conduction |
| 3. B | GO:0070563 | negative regulation of vitamin D receptor signaling pathway |
| 3. B | GO:0030334 | regulation of cell migration |
| 3. B | GO:0032421 | stereocilium bundle |
| 3. B | GO:0003270 | Notch signaling pathway involved in regulation of secondary heart field cardioblast proliferation |
| 3. B | GO:0010812 | negative regulation of cell-substrate adhesion |
| 3. B | GO:0001756 | somitogenesis |
| 3. B | GO:2001259 | positive regulation of cation channel activity |
| 3. B | GO:0021514 | ventral spinal cord interneuron differentiation |
| 3. B | GO:1903522 | regulation of blood circulation |
| 3. B | GO:0070372 | regulation of ERK1 and ERK2 cascade |
| 3. B | GO:0060412 | ventricular septum morphogenesis |
| 3. B | GO:0014044 | Schwann cell development |
| 3. B | GO:0006306 | DNA methylation |
| 3. B | GO:0097190 | apoptotic signaling pathway |
| 3. B | GO:0106310 | protein serine kinase activity |
| 3. B | GO:0019903 | protein phosphatase binding |
| 3. B | GO:0003252 | negative regulation of cell proliferation involved in heart valve morphogenesis |
| 3. B | GO:0006959 | humoral immune response |
| 3. B | GO:0004842 | ubiquitin-protein transferase activity |
| 3. B | GO:0047499 | calcium-independent phospholipase A2 activity |
| 3. B | GO:0007140 | male meiotic nuclear division |
| 3. B | GO:0001837 | epithelial to mesenchymal transition |
| 3. B | GO:0051494 | negative regulation of cytoskeleton organization |
| 3. B | GO:0048259 | regulation of receptor-mediated endocytosis |
| 3. B | GO:0045070 | positive regulation of viral genome replication |
| 3. B | GO:0003950 | NAD+ ADP-ribosyltransferase activity |
| 3. B | GO:0035264 | multicellular organism growth |
| 3. B | GO:0021519 | spinal cord association neuron specification |
| 3. B | GO:0050885 | neuromuscular process controlling balance |
| 3. B | GO:0015095 | magnesium ion transmembrane transporter activity |
| 3. B | GO:0045611 | negative regulation of hemocyte differentiation |
| 3. B | GO:0051489 | regulation of filopodium assembly |
| 3. B | GO:0035622 | intrahepatic bile duct development |
| 3. B | GO:2000822 | regulation of behavioral fear response |
| 3. B | GO:0045036 | protein targeting to chloroplast |
| 3. B | GO:0016571 | histone methylation |
| 3. B | GO:0043254 | regulation of protein-containing complex assembly |
| 3. B | GO:0010765 | positive regulation of sodium ion transport |
| 3. B | GO:0035304 | regulation of protein dephosphorylation |
| 3. B | GO:0071546 | pi-body |
| 3. B | GO:0003162 | atrioventricular node development |
| 3. B | GO:0007283 | spermatogenesis |
| 3. B | GO:0007492 | endoderm development |
| 3. B | GO:0048549 | positive regulation of pinocytosis |
| 3. B | GO:0010956 | negative regulation of calcidiol 1-monooxygenase activity |
| 3. B | GO:0030534 | adult behavior |
| 3. B | GO:0031069 | hair follicle morphogenesis |
| 3. B | GO:0086015 | SA node cell action potential |
| 3. B | GO:0032466 | negative regulation of cytokinesis |
| 3. B | GO:1990404 | protein ADP-ribosylase activity |
| 3. B | GO:0005903 | brush border |
| 3. B | GO:0097107 | postsynaptic density assembly |
| 3. B | GO:0061073 | ciliary body morphogenesis |
| 3. B | GO:0007520 | myoblast fusion |
| 3. B | GO:0003151 | outflow tract morphogenesis |
| 3. B | GO:0006913 | nucleocytoplasmic transport |
| 3. B | GO:0072014 | proximal tubule development |
| 3. B | GO:0002437 | inflammatory response to antigenic stimulus |
| 3. B | GO:0002052 | positive regulation of neuroblast proliferation |
| 3. B | GO:0071354 | cellular response to interleukin-6 |
| 3. B | GO:0042734 | presynaptic membrane |
| 3. B | GO:1902309 | negative regulation of peptidyl-serine dephosphorylation |
| 3. B | GO:0048715 | negative regulation of oligodendrocyte differentiation |
| 3. B | GO:1990433 | CSL-Notch-Mastermind transcription factor complex |
| 3. B | GO:0005123 | death receptor binding |
| 3. B | GO:0032426 | stereocilium tip |
| 3. B | GO:0008608 | attachment of spindle microtubules to kinetochore |
| 3. B | GO:1900273 | positive regulation of long-term synaptic potentiation |
| 3. B | GO:0043008 | ATP-dependent protein binding |
| 3. B | GO:0048056 | R3/R4 cell differentiation |
| 3. B | GO:0003160 | endocardium morphogenesis |
| 3. B | GO:0043086 | negative regulation of catalytic activity |
| 3. B | GO:0022011 | myelination in peripheral nervous system |
| 3. B | GO:0050894 | determination of affect |
| 3. B | GO:0001709 | cell fate determination |
| 3. B | GO:0000209 | protein polyubiquitination |
| 3. B | GO:0097546 | ciliary base |
| 3. B | GO:0035116 | embryonic hindlimb morphogenesis |
| 3. B | GO:0002027 | regulation of heart rate |
| 3. B | GO:2000178 | negative regulation of neural precursor cell proliferation |
| 3. B | GO:1904970 | brush border assembly |
| 3. B | GO:0044325 | transmembrane transporter binding |
| 3. B | GO:0008593 | regulation of Notch signaling pathway |
| 3. B | GO:0072116 | pronephros formation |
| 3. B | GO:0072574 | hepatocyte proliferation |
| 3. B | GO:1990760 | osmolarity-sensing cation channel activity |
| 3. B | GO:0010629 | negative regulation of gene expression |
| 3. B | GO:0019888 | protein phosphatase regulator activity |
| 3. B | GO:0046875 | ephrin receptor binding |
| 3. B | GO:0010366 | negative regulation of ethylene biosynthetic process |
| 3. B | GO:0001763 | morphogenesis of a branching structure |
| 3. B | GO:0030660 | Golgi-associated vesicle membrane |
| 3. B | GO:0002789 | negative regulation of antifungal peptide production |
| 3. B | GO:0072044 | collecting duct development |
| 3. B | GO:0046826 | negative regulation of protein export from nucleus |
| 3. B | GO:1900246 | positive regulation of RIG-I signaling pathway |
| 3. B | GO:1904901 | positive regulation of myosin II filament organization |
| 3. B | GO:0060999 | positive regulation of dendritic spine development |
| 3. B | GO:0005516 | calmodulin binding |
| 3. B | GO:0045603 | positive regulation of endothelial cell differentiation |
| 3. B | GO:0035774 | positive regulation of insulin secretion involved in cellular response to glucose stimulus |
| 3. B | GO:0051289 | protein homotetramerization |
| 3. B | GO:0097604 | temperature-gated cation channel activity |
| 3. B | GO:0070213 | protein auto-ADP-ribosylation |
| 3. B | GO:0004672 | protein kinase activity |
| 3. B | GO:0046427 | positive regulation of receptor signaling pathway via JAK-STAT |
| 3. B | GO:0055016 | hypochord development |
| 3. B | GO:0031877 | somatostatin receptor binding |
| 3. B | GO:0048812 | neuron projection morphogenesis |
| 3. B | GO:0033292 | T-tubule organization |
| 3. B | GO:0006967 | positive regulation of antifungal peptide biosynthetic process |
| 3. B | GO:0005769 | early endosome |
| 3. B | GO:0045665 | negative regulation of neuron differentiation |
| 3. B | GO:0071372 | cellular response to follicle-stimulating hormone stimulus |
| 3. B | GO:1904108 | protein localization to ciliary inversin compartment |
| 3. B | GO:0009950 | dorsal/ventral axis specification |
| 3. B | GO:0005525 | GTP binding |
| 3. B | GO:1900245 | positive regulation of MDA-5 signaling pathway |
| 3. B | GO:0006915 | apoptotic process |
| 3. B | GO:0045747 | positive regulation of Notch signaling pathway |
| 3. B | GO:0035924 | cellular response to vascular endothelial growth factor stimulus |
| 3. B | GO:0097114 | NMDA glutamate receptor clustering |
| 3. B | GO:0106311 | |
| 3. B | GO:0014832 | urinary bladder smooth muscle contraction |
| 3. B | GO:0071889 | 14-3-3 protein binding |
| 3. B | GO:1990166 | protein localization to site of double-strand break |
| 3. B | GO:0090521 | glomerular visceral epithelial cell migration |
| 3. B | GO:0045944 | positive regulation of transcription by RNA polymerase II |
| 3. B | GO:0050768 | negative regulation of neurogenesis |
| 3. B | GO:0099092 | postsynaptic density, intracellular component |
| 3. B | GO:0005249 | voltage-gated potassium channel activity |
| 3. B | GO:0045211 | postsynaptic membrane |
| 3. B | GO:0010838 | positive regulation of keratinocyte proliferation |
| 3. B | GO:0014070 | response to organic cyclic compound |
| 3. B | GO:0010976 | positive regulation of neuron projection development |
| 3. B | GO:0030017 | sarcomere |
| 3. B | GO:0043491 | protein kinase B signaling |
| 3. B | GO:0005902 | microvillus |
| 3. B | GO:0016055 | Wnt signaling pathway |
| 3. B | GO:0048873 | homeostasis of number of cells within a tissue |
| 3. B | GO:0051967 | negative regulation of synaptic transmission, glutamatergic |
| 3. B | GO:0061195 | taste bud formation |
| 3. B | GO:0018345 | protein palmitoylation |
| 3. B | GO:1904106 | protein localization to microvillus |
| 3. B | GO:0032288 | myelin assembly |
| 3. B | GO:0021515 | cell differentiation in spinal cord |
| 3. B | GO:1900127 | positive regulation of hyaluronan biosynthetic process |
| 3. B | GO:0002011 | morphogenesis of an epithelial sheet |
| 3. B | GO:0006537 | glutamate biosynthetic process |
| 3. B | GO:0071212 | subsynaptic reticulum |
| 3. B | GO:0014807 | regulation of somitogenesis |
| 3. B | GO:0090090 | negative regulation of canonical Wnt signaling pathway |
| 3. B | GO:0030279 | negative regulation of ossification |
| 3. B | GO:0048663 | neuron fate commitment |
| 3. B | GO:0061344 | regulation of cell adhesion involved in heart morphogenesis |
| 3. B | GO:0060743 | epithelial cell maturation involved in prostate gland development |
| 3. B | GO:0003182 | coronary sinus valve morphogenesis |
| 3. B | GO:0055117 | regulation of cardiac muscle contraction |
| 3. B | GO:1902339 | positive regulation of apoptotic process involved in morphogenesis |
| 3. B | GO:0044605 | phosphocholine transferase activity |
| 3. B | GO:0006929 | substrate-dependent cell migration |
| 3. B | GO:0035307 | positive regulation of protein dephosphorylation |
| 3. B | GO:0007409 | axonogenesis |
| 3. B | GO:0045171 | intercellular bridge |
| 3. B | GO:0035255 | ionotropic glutamate receptor binding |
| 3. B | GO:0043069 | negative regulation of programmed cell death |
| 3. B | GO:1902260 | negative regulation of delayed rectifier potassium channel activity |
| 3. B | GO:0031013 | troponin I binding |
| 3. B | GO:0031430 | M band |
| 3. B | GO:0043046 | DNA methylation involved in gamete generation |
| 3. B | GO:0070198 | protein localization to chromosome, telomeric region |
| 3. B | GO:0090238 | positive regulation of arachidonic acid secretion |
| 3. B | GO:0045751 | negative regulation of Toll signaling pathway |
| 3. B | GO:0072576 | liver morphogenesis |
| 3. B | GO:0007030 | Golgi organization |
| 3. B | GO:0045838 | positive regulation of membrane potential |
| 3. B | GO:0005929 | cilium |
| 3. B | GO:1902263 | apoptotic process involved in embryonic digit morphogenesis |
| 3. B | GO:0035172 | hemocyte proliferation |
| 3. B | GO:0003344 | pericardium morphogenesis |
| 3. B | GO:0006543 | glutamine catabolic process |
| 3. B | GO:0044030 | regulation of DNA methylation |
| 3. B | GO:0060076 | excitatory synapse |
| 3. B | GO:0070742 | C2H2 zinc finger domain binding |
| 3. B | GO:0140627 | ubiquitin-dependent protein catabolic process via the C-end degron rule pathway |
| 3. B | GO:0003208 | cardiac ventricle morphogenesis |
| 3. B | GO:0003214 | cardiac left ventricle morphogenesis |
| 3. B | GO:0007613 | memory |
| 3. B | GO:0010424 | DNA methylation on cytosine within a CG sequence |
| 3. B | GO:0014731 | spectrin-associated cytoskeleton |
| 3. B | GO:0044309 | neuron spine |
| 3. B | GO:0005737 | cytoplasm |
| 3. B | GO:0098978 | glutamatergic synapse |
| 3. B | GO:2000001 | regulation of DNA damage checkpoint |
| 3. B | GO:0072114 | pronephros morphogenesis |
| 3. B | GO:0010882 | regulation of cardiac muscle contraction by calcium ion signaling |
| 3. B | GO:0043005 | neuron projection |
| 3. B | GO:0098871 | postsynaptic actin cytoskeleton |
| 3. B | GO:0097435 | supramolecular fiber organization |
| 3. B | GO:1904385 | cellular response to angiotensin |
| 3. B | GO:0035153 | epithelial cell type specification, open tracheal system |
| 3. B | GO:0046331 | lateral inhibition |
| 3. B | GO:0097113 | AMPA glutamate receptor clustering |
| 3. B | GO:0042995 | cell projection |
| 3. B | GO:0046959 | habituation |
| 3. B | GO:0001955 | blood vessel maturation |
| 3. B | GO:0099519 | dense core granule cytoskeletal transport |
| 3. B | GO:0038023 | signaling receptor activity |
| 3. B | GO:0060354 | negative regulation of cell adhesion molecule production |
| 3. B | GO:0031441 | negative regulation of mRNA 3'-end processing |
| 3. B | GO:0032232 | negative regulation of actin filament bundle assembly |
| 3. B | GO:0034638 | phosphatidylcholine catabolic process |
| 3. B | GO:0021546 | rhombomere development |
| 3. B | GO:0003332 | negative regulation of extracellular matrix constituent secretion |
| 3. B | GO:0046976 | histone methyltransferase activity (H3-K27 specific) |
| 3. B | GO:1905274 | regulation of modification of postsynaptic actin cytoskeleton |
| 3. B | GO:0045794 | negative regulation of cell volume |
| 3. B | GO:0005856 | cytoskeleton |
| 3. B | GO:1904717 | regulation of AMPA glutamate receptor clustering |
| 3. B | GO:0031047 | gene silencing by RNA |
| 3. B | GO:0042048 | olfactory behavior |
| 3. B | GO:0071447 | cellular response to hydroperoxide |
| 3. B | GO:0032580 | Golgi cisterna membrane |
| 3. B | GO:0016529 | sarcoplasmic reticulum |
| 3. B | GO:0060288 | formation of a compartment boundary |
| 3. B | GO:0051497 | negative regulation of stress fiber assembly |
| 3. B | GO:0140374 | antiviral innate immune response |
| 3. B | GO:0005096 | GTPase activator activity |
| 3. B | GO:0030034 | microvillar actin bundle assembly |
| 3. B | GO:0045672 | positive regulation of osteoclast differentiation |
| 3. B | GO:1904743 | negative regulation of telomeric DNA binding |
| 3. B | GO:1900383 | regulation of synaptic plasticity by receptor localization to synapse |
| 3. B | GO:0003241 | growth involved in heart morphogenesis |
| 3. B | GO:0072660 | maintenance of protein location in plasma membrane |
| 3. B | GO:0015629 | actin cytoskeleton |
| 3. B | GO:0009967 | positive regulation of signal transduction |
| 3. B | GO:0071359 | cellular response to dsRNA |
| 3. B | GO:0060289 | compartment boundary maintenance |
| 3. B | GO:0043197 | dendritic spine |
| 3. B | GO:0005112 | Notch binding |
| 3. B | GO:0003198 | epithelial to mesenchymal transition involved in endocardial cushion formation |
| 3. B | GO:0102991 | myristoyl-CoA hydrolase activity |
| 3. B | GO:1901187 | regulation of ephrin receptor signaling pathway |
| 3. B | GO:0061028 | establishment of endothelial barrier |
| 3. B | GO:0001889 | liver development |
| 3. B | GO:0045197 | establishment or maintenance of epithelial cell apical/basal polarity |
| 3. B | GO:0043054 | dauer exit |
| 3. B | GO:0060674 | placenta blood vessel development |
| 3. B | GO:0039529 | RIG-I signaling pathway |
| 3. B | GO:0036309 | protein localization to M-band |
| 3. B | GO:0065001 | specification of axis polarity |
| 3. B | GO:0060317 | cardiac epithelial to mesenchymal transition |
| 3. B | GO:0097117 | guanylate kinase-associated protein clustering |
| 3. B | GO:0086069 | bundle of His cell to Purkinje myocyte communication |
| 3. B | GO:0060948 | cardiac vascular smooth muscle cell development |
| 3. B | GO:0098919 | structural constituent of postsynaptic density |
| 3. B | GO:0034446 | substrate adhesion-dependent cell spreading |
| 3. B | GO:0002357 | defense response to tumor cell |
| 3. B | GO:0002070 | epithelial cell maturation |
| 3. B | GO:0051968 | positive regulation of synaptic transmission, glutamatergic |
| 3. B | GO:0034112 | positive regulation of homotypic cell-cell adhesion |
| 3. B | GO:0001967 | suckling behavior |
| 3. B | GO:0060442 | branching involved in prostate gland morphogenesis |
| 3. B | GO:0006471 | protein ADP-ribosylation |
| 3. B | GO:0070531 | BRCA1-A complex |
| 3. B | GO:0030154 | cell differentiation |
| 3. B | GO:0060842 | arterial endothelial cell differentiation |
| 3. B | GO:0086070 | SA node cell to atrial cardiac muscle cell communication |
| 3. B | GO:1900452 | regulation of long-term synaptic depression |
| 3. B | GO:0003229 | ventricular cardiac muscle tissue development |
| 3. B | GO:0045955 | negative regulation of calcium ion-dependent exocytosis |
| 3. B | GO:0070972 | protein localization to endoplasmic reticulum |
| 3. B | GO:0090160 | Golgi to lysosome transport |
| 3. B | GO:2001027 | negative regulation of endothelial cell chemotaxis |
| 3. B | GO:0043268 | positive regulation of potassium ion transport |
| 3. B | GO:0031267 | small GTPase binding |
| 3. B | GO:0060035 | notochord cell development |
| 3. B | GO:0002193 | MAML1-RBP-Jkappa- ICN1 complex |
| 3. B | GO:0046579 | positive regulation of Ras protein signal transduction |
| 3. B | GO:0045685 | regulation of glial cell differentiation |
| 3. B | GO:0030513 | positive regulation of BMP signaling pathway |
| 3. B | GO:2000737 | negative regulation of stem cell differentiation |
| 3. B | GO:0048754 | branching morphogenesis of an epithelial tube |
| 3. B | GO:2001279 | regulation of unsaturated fatty acid biosynthetic process |
| 3. B | GO:0010001 | glial cell differentiation |
| 3. B | GO:0000062 | fatty-acyl-CoA binding |
| 3. B | GO:1900827 | positive regulation of membrane depolarization during cardiac muscle cell action potential |
| 3. B | GO:0031960 | response to corticosteroid |
| 3. B | GO:0060074 | synapse maturation |
| 3. B | GO:0003256 | regulation of transcription from RNA polymerase II promoter involved in myocardial precursor cell differentiation |
| 3. B | GO:1901201 | regulation of extracellular matrix assembly |
| 3. B | GO:0048892 | lateral line nerve development |
| 3. B | GO:0032049 | cardiolipin biosynthetic process |
| 3. B | GO:0008093 | cytoskeletal anchor activity |
| 3. B | GO:0010667 | negative regulation of cardiac muscle cell apoptotic process |
| 3. B | GO:0038061 | NIK/NF-kappaB signaling |
| 3. B | GO:0005938 | cell cortex |
| 3. B | GO:0042802 | identical protein binding |
| 3. B | GO:0048708 | astrocyte differentiation |
| 3. B | GO:0030674 | protein-macromolecule adaptor activity |
| 3. B | GO:0001708 | cell fate specification |
| 3. B | GO:0034058 | endosomal vesicle fusion |
| 3. B | GO:0003222 | ventricular trabecula myocardium morphogenesis |
| 3. B | GO:0030326 | embryonic limb morphogenesis |
| 3. B | GO:0060740 | prostate gland epithelium morphogenesis |
| 3. B | GO:0030837 | negative regulation of actin filament polymerization |
| 3. B | GO:0071286 | cellular response to magnesium ion |
| 3. B | GO:0090309 | positive regulation of DNA methylation-dependent heterochromatin assembly |
| 3. B | GO:0060411 | cardiac septum morphogenesis |
| 3. B | GO:0097237 | cellular response to toxic substance |
| 3. B | GO:1905938 | positive regulation of germ cell proliferation |
| 3. B | GO:0050775 | positive regulation of dendrite morphogenesis |
| 3. B | GO:0060113 | inner ear receptor cell differentiation |
| 3. B | GO:0045967 | negative regulation of growth rate |
| 3. B | GO:0043034 | costamere |
| 3. B | GO:0021986 | habenula development |
| 3. B | GO:0018230 | peptidyl-L-cysteine S-palmitoylation |
| 3. B | GO:0032791 | lead ion binding |
| 3. B | GO:0031297 | replication fork processing |
| 3. B | GO:0030046 | parallel actin filament bundle assembly |
| 3. B | GO:0046843 | dorsal appendage formation |
| 3. B | GO:0036166 | phenotypic switching |
| 3. B | GO:0046469 | platelet activating factor metabolic process |
| 3. B | GO:0044877 | protein-containing complex binding |
| 3. B | GO:0070986 | left/right axis specification |
| 3. B | GO:1990416 | cellular response to brain-derived neurotrophic factor stimulus |
| 3. B | GO:0005576 | extracellular region |
| 3. B | GO:0002087 | regulation of respiratory gaseous exchange by nervous system process |
| 3. B | GO:0019887 | protein kinase regulator activity |
| 3. B | GO:0046974 | histone methyltransferase activity (H3-K9 specific) |
| 3. B | GO:0098908 | regulation of neuronal action potential |
| 3. B | GO:0018024 | histone-lysine N-methyltransferase activity |
| 3. B | GO:0045814 | negative regulation of gene expression, epigenetic |
| 3. B | GO:0021915 | neural tube development |
| 3. B | GO:0030018 | Z disc |
| 3. B | GO:0042805 | actinin binding |
| 3. B | GO:0036377 | arbuscular mycorrhizal association |
| 3. B | GO:0043063 | intercellular bridge organization |
| 3. B | GO:0046473 | phosphatidic acid metabolic process |
| 3. B | GO:0007221 | positive regulation of transcription of Notch receptor target |
| 3. B | GO:0099612 | protein localization to axon |
| 3. B | GO:0061419 | positive regulation of transcription from RNA polymerase II promoter in response to hypoxia |
| 3. B | GO:0005524 | ATP binding |
| 3. B | GO:1902041 | regulation of extrinsic apoptotic signaling pathway via death domain receptors |
| 3. B | GO:0045669 | positive regulation of osteoblast differentiation |
| 3. B | GO:0042686 | regulation of cardioblast cell fate specification |
| 3. B | GO:0046338 | phosphatidylethanolamine catabolic process |
| 3. B | GO:0097422 | tubular endosome |
| 3. B | GO:0071316 | cellular response to nicotine |
| 3. B | GO:0018027 | peptidyl-lysine dimethylation |
| 3. B | GO:0035176 | social behavior |
| 3. B | GO:0010960 | magnesium ion homeostasis |
| 3. B | GO:2001204 | regulation of osteoclast development |
| 3. B | GO:2000114 | regulation of establishment of cell polarity |
| 3. B | GO:1990090 | cellular response to nerve growth factor stimulus |
| 3. B | GO:0140261 | BCOR complex |
| 3. B | GO:0035418 | protein localization to synapse |
| 3. B | GO:0005886 | plasma membrane |
| 3. B | GO:0042325 | regulation of phosphorylation |
| 3. B | GO:0010614 | negative regulation of cardiac muscle hypertrophy |
| 3. B | GO:0021675 | nerve development |
| 3. B | GO:0035646 | endosome to melanosome transport |
| 3. B | GO:0044232 | organelle membrane contact site |
| 3. B | GO:0048899 | anterior lateral line development |
| 3. B | GO:0033147 | negative regulation of intracellular estrogen receptor signaling pathway |
| 3. B | GO:0062043 | positive regulation of cardiac epithelial to mesenchymal transition |
| 3. B | GO:0001222 | transcription corepressor binding |
| 3. B | GO:0045316 | negative regulation of compound eye photoreceptor development |
| 3. B | GO:0007009 | plasma membrane organization |
| 3. B | GO:0045607 | regulation of inner ear auditory receptor cell differentiation |
| 3. B | GO:0043292 | contractile fiber |
| 3. B | GO:0019843 | rRNA binding |
| 3. B | GO:0070212 | protein poly-ADP-ribosylation |
| 3. B | GO:1900271 | regulation of long-term synaptic potentiation |
| 3. B | GO:2000048 | negative regulation of cell-cell adhesion mediated by cadherin |
| 3. B | GO:1904058 | positive regulation of sensory perception of pain |
| 3. B | GO:0060979 | vasculogenesis involved in coronary vascular morphogenesis |
| 3. B | GO:0007160 | cell-matrix adhesion |
| 3. B | GO:0009066 | aspartate family amino acid metabolic process |
| 3. B | GO:0030160 | synaptic receptor adaptor activity |
| 3. B | GO:2000209 | regulation of anoikis |
| 3. B | GO:0019228 | neuronal action potential |
| 3. B | GO:0072017 | distal tubule development |
| 3. B | GO:0007440 | foregut morphogenesis |
| 3. B | GO:0048711 | positive regulation of astrocyte differentiation |
| 3. B | GO:0072073 | kidney epithelium development |
| 3. B | GO:0045859 | regulation of protein kinase activity |
| 3. B | GO:0004622 | lysophospholipase activity |
| 3. B | GO:0035023 | regulation of Rho protein signal transduction |
| 3. B | GO:0072357 | PTW/PP1 phosphatase complex |
| 3. B | GO:0007386 | compartment pattern specification |
| 3. B | GO:0009925 | basal plasma membrane |
| 3. B | GO:0008022 | protein C-terminus binding |
| 3. B | GO:0010650 | positive regulation of cell communication by electrical coupling |
| 3. B | GO:0003181 | atrioventricular valve morphogenesis |
| 3. B | GO:0090051 | negative regulation of cell migration involved in sprouting angiogenesis |
| 3. B | GO:0021773 | striatal medium spiny neuron differentiation |
| 3. B | GO:0010638 | positive regulation of organelle organization |
| 3. B | GO:0060768 | regulation of epithelial cell proliferation involved in prostate gland development |
| 3. B | GO:0060998 | regulation of dendritic spine development |
| 3. B | GO:2000811 | negative regulation of anoikis |
| 3. B | GO:0006897 | endocytosis |
| 3. B | GO:0045608 | negative regulation of inner ear auditory receptor cell differentiation |
| 3. B | GO:1901339 | regulation of store-operated calcium channel activity |
| 3. B | GO:2000630 | positive regulation of miRNA metabolic process |
| 3. B | GO:0014066 | regulation of phosphatidylinositol 3-kinase signaling |
| 3. B | GO:0006887 | exocytosis |
| 3. B | GO:0071314 | cellular response to cocaine |
| 3. B | GO:0000242 | pericentriolar material |
| 3. B | GO:2000096 | positive regulation of Wnt signaling pathway, planar cell polarity pathway |
| 3. B | GO:0003197 | endocardial cushion development |
| 3. B | GO:0016604 | nuclear body |
| 3. B | GO:0003723 | RNA binding |
| 3. B | GO:0042665 | regulation of ectodermal cell fate specification |
| 3. B | GO:1903589 | positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis |
| 3. B | GO:0098907 | regulation of SA node cell action potential |
| 3. B | GO:0003203 | endocardial cushion morphogenesis |
| 3. B | GO:0008157 | protein phosphatase 1 binding |
| 3. B | GO:1900026 | positive regulation of substrate adhesion-dependent cell spreading |
| 3. B | GO:0035965 | cardiolipin acyl-chain remodeling |
| 3. B | GO:0003677 | DNA binding |
| 3. B | GO:0030155 | regulation of cell adhesion |
| 3. B | GO:0086014 | atrial cardiac muscle cell action potential |
| 3. B | GO:0016409 | palmitoyltransferase activity |
| 3. B | GO:0008270 | zinc ion binding |
| 3. B | GO:0003184 | pulmonary valve morphogenesis |
| 3. B | GO:0090461 | glutamate homeostasis |
| 3. B | GO:0030507 | spectrin binding |
| 3. B | GO:0032695 | negative regulation of interleukin-12 production |
| 3. B | GO:0003169 | coronary vein morphogenesis |
| 3. B | GO:1904908 | negative regulation of maintenance of mitotic sister chromatid cohesion, telomeric |
| 3. B | GO:0060528 | secretory columnal luminar epithelial cell differentiation involved in prostate glandular acinus development |
| 3. B | GO:0047389 | glycerophosphocholine phosphodiesterase activity |
| 3. B | GO:0010832 | negative regulation of myotube differentiation |
| 3. B | GO:0071532 | ankyrin repeat binding |
| 3. B | GO:0070936 | protein K48-linked ubiquitination |
| 3. B | GO:0140439 | protein-cysteine S-stearoyltransferase activity |
| 3. B | GO:0051438 | regulation of ubiquitin-protein transferase activity |
| 3. B | GO:0045648 | positive regulation of erythrocyte differentiation |
| 3. B | GO:0031143 | pseudopodium |
| 3. B | GO:0051017 | actin filament bundle assembly |
| 3. B | GO:0007368 | determination of left/right symmetry |
| 3. B | GO:0071244 | cellular response to carbon dioxide |
| 3. B | GO:0060982 | coronary artery morphogenesis |
| 3. B | GO:0007616 | long-term memory |
| 3. B | GO:0014069 | postsynaptic density |
| 3. B | GO:0045687 | positive regulation of glial cell differentiation |
| 3. B | GO:0001954 | positive regulation of cell-matrix adhesion |
| 3. B | GO:0014912 | negative regulation of smooth muscle cell migration |
| 3. B | GO:0031359 | integral component of chloroplast outer membrane |
| 3. B | GO:0010780 | meiotic DNA double-strand break formation involved in reciprocal meiotic recombination |
| 3. B | GO:0031867 | EP4 subtype prostaglandin E2 receptor binding |
| 3. B | GO:1904107 | protein localization to microvillus membrane |
| 3. B | GO:0015248 | sterol transporter activity |
| 3. B | GO:0048103 | somatic stem cell division |
| 3. B | GO:0043266 | regulation of potassium ion transport |
| 3. B | GO:1902412 | regulation of mitotic cytokinesis |
| 3. B | GO:0050955 | thermoception |
| 3. B | GO:0060843 | venous endothelial cell differentiation |
| 3. B | GO:0001838 | embryonic epithelial tube formation |
| 3. B | GO:2000651 | positive regulation of sodium ion transmembrane transporter activity |
| 3. B | GO:0006528 | asparagine metabolic process |
| 3. B | GO:0140031 | phosphorylation-dependent protein binding |
| 3. B | GO:0051306 | mitotic sister chromatid separation |
| 3. B | GO:0050957 | equilibrioception |
| 3. B | GO:0003207 | cardiac chamber formation |
| 3. B | GO:0061384 | heart trabecula morphogenesis |
| 3. B | GO:0048060 | negative gravitaxis |
| 3. B | GO:0072015 | glomerular visceral epithelial cell development |
| 3. B | GO:2000304 | positive regulation of ceramide biosynthetic process |
| 3. B | GO:0070171 | negative regulation of tooth mineralization |
| 3. B | GO:0019208 | phosphatase regulator activity |
| 3. B | GO:0030315 | T-tubule |
| 3. B | GO:0043280 | positive regulation of cysteine-type endopeptidase activity involved in apoptotic process |
| 3. B | GO:0003209 | cardiac atrium morphogenesis |
| 3. B | GO:1905936 | regulation of germ cell proliferation |
| 3. B | GO:0048052 | R1/R6 cell differentiation |
| 3. B | GO:1903670 | regulation of sprouting angiogenesis |
| 3. B | GO:0021531 | spinal cord radial glial cell differentiation |
| 3. B | GO:0010761 | fibroblast migration |
| 3. B | GO:2000969 | positive regulation of AMPA receptor activity |
| 3. B | GO:0005262 | calcium channel activity |
| 3. B | GO:0017020 | myosin phosphatase regulator activity |
| 3. B | GO:0102545 | phosphatidyl phospholipase B activity |
| 3. B | GO:0097062 | dendritic spine maintenance |
| 3. B | GO:0031901 | early endosome membrane |
| 3. B | GO:0031672 | A band |
| 3. B | GO:0003213 | cardiac right atrium morphogenesis |
| 3. B | GO:0045869 | negative regulation of single stranded viral RNA replication via double stranded DNA intermediate |
| 3. B | GO:0045602 | negative regulation of endothelial cell differentiation |
| 3. B | GO:0050793 | regulation of developmental process |
| 3. B | GO:0098910 | regulation of atrial cardiac muscle cell action potential |
| 3. B | GO:0043194 | axon initial segment |
| 3. B | GO:0090575 | RNA polymerase II transcription regulator complex |
| 3. B | GO:0009912 | auditory receptor cell fate commitment |
| 3. B | GO:0030941 | chloroplast targeting sequence binding |
| 3. B | GO:0099527 | postsynapse to nucleus signaling pathway |
| 3. B | GO:0046849 | bone remodeling |
| 3. B | GO:2000249 | regulation of actin cytoskeleton reorganization |
| 3. B | GO:0048265 | response to pain |
| 3. B | GO:0016279 | protein-lysine N-methyltransferase activity |
| 3. B | GO:0007165 | signal transduction |
| 3. B | GO:1904355 | positive regulation of telomere capping |
| 3. B | GO:0001895 | retina homeostasis |
| 3. B | GO:1901223 | negative regulation of NIK/NF-kappaB signaling |
| 3. B | GO:0097543 | ciliary inversin compartment |
| 3. B | GO:0017124 | SH3 domain binding |
| 3. B | GO:0003847 | 1-alkyl-2-acetylglycerophosphocholine esterase activity |
| 3. B | GO:0046822 | regulation of nucleocytoplasmic transport |
| 3. B | GO:0048170 | positive regulation of long-term neuronal synaptic plasticity |
| 3. B | GO:0048854 | brain morphogenesis |
| 3. B | GO:0003219 | cardiac right ventricle formation |
| 3. B | GO:0043235 | receptor complex |
| 3. B | GO:0001658 | branching involved in ureteric bud morphogenesis |
| 3. B | GO:0017171 | serine hydrolase activity |
| 3. B | GO:0072144 | glomerular mesangial cell development |
| 3. B | GO:0016235 | aggresome |
| 3. B | GO:0060956 | endocardial cell differentiation |
| 3. B | GO:1904632 | cellular response to glucoside |
| 3. B | GO:0042383 | sarcolemma |
| 3. B | GO:0071322 | cellular response to carbohydrate stimulus |
| 3. B | GO:1901189 | positive regulation of ephrin receptor signaling pathway |
| 3. B | GO:0060038 | cardiac muscle cell proliferation |
| 3. B | GO:0030029 | actin filament-based process |
| 3. B | GO:0032212 | positive regulation of telomere maintenance via telomerase |
| 3. B | GO:0042297 | vocal learning |
| 3. B | GO:0061001 | regulation of dendritic spine morphogenesis |
| 3. B | GO:0045596 | negative regulation of cell differentiation |
| 3. B | GO:0061025 | membrane fusion |
| 3. B | GO:0051386 | regulation of neurotrophin TRK receptor signaling pathway |
| 3. B | GO:0097110 | scaffold protein binding |
| 3. B | GO:1990393 | 3M complex |
| 3. B | GO:0034184 | positive regulation of maintenance of mitotic sister chromatid cohesion |
| 3. B | GO:0060803 | BMP signaling pathway involved in mesodermal cell fate specification |
| 3. B | GO:0045618 | positive regulation of keratinocyte differentiation |
| 3. B | GO:0003180 | aortic valve morphogenesis |
| 3. B | GO:1990705 | cholangiocyte proliferation |
| 3. B | GO:0060013 | righting reflex |
| 3. B | GO:0007411 | axon guidance |
| 3. B | GO:0050968 | detection of chemical stimulus involved in sensory perception of pain |
| 3. B | GO:0042246 | tissue regeneration |
| 3. B | GO:0003157 | endocardium development |
| 3. B | GO:0007229 | integrin-mediated signaling pathway |
| 3. B | GO:1900451 | positive regulation of glutamate receptor signaling pathway |
| 3. B | GO:1903343 | positive regulation of meiotic DNA double-strand break formation |
| 3. B | GO:0090029 | negative regulation of pheromone-dependent signal transduction involved in conjugation with cellular fusion |
| 3. B | GO:0046533 | negative regulation of photoreceptor cell differentiation |
| 3. B | GO:0097150 | neuronal stem cell population maintenance |
| 3. B | GO:0060045 | positive regulation of cardiac muscle cell proliferation |
| 3. B | GO:0048013 | ephrin receptor signaling pathway |
| 3. B | GO:1901019 | regulation of calcium ion transmembrane transporter activity |
| 3. B | GO:0035171 | lamellocyte differentiation |
| 3. B | GO:0004067 | asparaginase activity |
| 3. B | GO:1903849 | positive regulation of aorta morphogenesis |
| 3. B | GO:0045162 | clustering of voltage-gated sodium channels |
| 3. B | GO:0042633 | hair cycle |
| 3. B | GO:0060413 | atrial septum morphogenesis |
| 3. B | GO:0051865 | protein autoubiquitination |
| 3. B | GO:0050728 | negative regulation of inflammatory response |
| 3. B | GO:0003192 | mitral valve formation |
| 3. B | GO:0030027 | lamellipodium |
| 3. B | GO:0000415 | negative regulation of histone H3-K36 methylation |
| 3. B | GO:0033268 | node of Ranvier |
| 3. B | GO:0048665 | neuron fate specification |
| 3. B | GO:0090200 | positive regulation of release of cytochrome c from mitochondria |
| 3. B | GO:1904630 | cellular response to diterpene |
| 3. B | GO:0003264 | regulation of cardioblast proliferation |
| 3. B | GO:0019705 | protein-cysteine S-myristoyltransferase activity |
| 3. B | GO:0043596 | nuclear replication fork |
| 3. B | GO:0001835 | blastocyst hatching |
| 3. B | GO:0050807 | regulation of synapse organization |
| 3. B | GO:0061314 | Notch signaling involved in heart development |
| 3. B | GO:0071709 | membrane assembly |
| 3. B | GO:0015278 | calcium-release channel activity |
| 3. B | GO:0045921 | positive regulation of exocytosis |
| 3. B | GO:0060992 | response to fungicide |
| 3. B | GO:2000463 | positive regulation of excitatory postsynaptic potential |
| 3. B | GO:0016290 | palmitoyl-CoA hydrolase activity |
| 3. B | GO:0019899 | enzyme binding |
| 3. B | GO:1902647 | negative regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate biosynthetic process |
| 3. B | GO:0099173 | postsynapse organization |
| 3. B | GO:0051570 | regulation of histone H3-K9 methylation |
| 3. B | GO:0034587 | piRNA metabolic process |
| 3. B | GO:0004857 | enzyme inhibitor activity |
| 3. B | GO:2000974 | negative regulation of pro-B cell differentiation |
| 3. B | GO:0060997 | dendritic spine morphogenesis |
| 3. B | GO:0048845 | venous blood vessel morphogenesis |
| 3. B | GO:1901018 | positive regulation of potassium ion transmembrane transporter activity |
| 3. B | GO:0060135 | maternal process involved in female pregnancy |
| 3. B | GO:2000311 | regulation of AMPA receptor activity |
| 3. B | GO:0043055 | maintenance of dauer |
| 3. B | GO:0086066 | atrial cardiac muscle cell to AV node cell communication |
| 3. B | GO:1901021 | positive regulation of calcium ion transmembrane transporter activity |
| 3. B | GO:1901224 | positive regulation of NIK/NF-kappaB signaling |
| 3. B | GO:0050966 | detection of mechanical stimulus involved in sensory perception of pain |
| 3. B | GO:0006621 | protein retention in ER lumen |
| 3. B | GO:0014031 | mesenchymal cell development |
| 3. B | GO:0051151 | negative regulation of smooth muscle cell differentiation |
| 3. B | GO:0046872 | metal ion binding |
| 3. B | GO:0035544 | negative regulation of SNARE complex assembly |
| 3. B | GO:0035508 | positive regulation of myosin-light-chain-phosphatase activity |
| 3. B | GO:0097553 | calcium ion transmembrane import into cytosol |
| 3. B | GO:0048871 | multicellular organismal homeostasis |
| 3. B | GO:2000821 | regulation of grooming behavior |
| 3. B | GO:0000139 | Golgi membrane |
| 3. B | GO:0019706 | protein-cysteine S-palmitoyltransferase activity |
| 3. B | GO:0003273 | cell migration involved in endocardial cushion formation |
| 3. B | GO:0051572 | negative regulation of histone H3-K4 methylation |
| 3. B | GO:0030900 | forebrain development |
| 3. B | GO:1903793 | positive regulation of anion transport |
| 3. B | GO:0070168 | negative regulation of biomineral tissue development |
| 3. B | GO:0044354 | macropinosome |
| 3. B | GO:0035507 | regulation of myosin-light-chain-phosphatase activity |
| 3. B | GO:1904357 | negative regulation of telomere maintenance via telomere lengthening |
| 3. B | GO:0031076 | embryonic camera-type eye development |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q9H560 | Putative ankyrin repeat domain-containing protein 19 | 0 | 2.71e-168 | 0.0 |
| 1. PB | Q9BGT9 | Ankyrin repeat and SOCS box protein 7 | 6.94e-14 | 1.47e-05 | 3.30e-12 |
| 1. PB | Q5BKI6 | Ankyrin repeat domain-containing protein 1 | 4.35e-12 | 2.18e-03 | 3.52e-08 |
| 1. PB | Q4UKJ3 | Putative ankyrin repeat protein RF_1087 | 1.56e-10 | 8.67e-03 | 2.12e-05 |
| 1. PB | Q9D738 | Ankyrin repeat and SOCS box protein 12 | 7.19e-11 | 2.26e-12 | 0.009 |
| 1. PB | Q86SG2 | Ankyrin repeat domain-containing protein 23 | 2.12e-12 | 5.34e-03 | 7.78e-10 |
| 1. PB | Q92527 | Ankyrin repeat domain-containing protein 7 | 7.77e-16 | 5.73e-39 | 6.31e-63 |
| 1. PB | Q5U2S6 | Ankyrin repeat and SOCS box protein 2 | 6.71e-13 | 1.57e-04 | 1.63e-08 |
| 1. PB | Q15327 | Ankyrin repeat domain-containing protein 1 | 1.92e-11 | 4.76e-03 | 1.26e-07 |
| 1. PB | Q5EA33 | Ankyrin repeat domain-containing protein 49 | 8.56e-09 | 3.48e-07 | 9.56e-05 |
| 1. PB | Q6AFL2 | Putative ankyrin-containing lipoprotein Lxx09580 | 1.23e-12 | 1.28e-03 | 0.002 |
| 1. PB | Q502M6 | Ankyrin repeat domain-containing protein 29 | 0.00e+00 | 4.13e-08 | 3.14e-07 |
| 1. PB | Q862Z2 | Ankyrin repeat and SOCS box protein 5 | 1.11e-16 | 2.71e-15 | 7.08e-06 |
| 1. PB | Q499M5 | Ankyrin repeat domain-containing protein 16 | 4.29e-14 | 5.20e-09 | 3.04e-05 |
| 1. PB | Q53RE8 | Ankyrin repeat domain-containing protein 39 | 1.42e-14 | 2.44e-17 | 1.55e-08 |
| 1. PB | Q8WWX0 | Ankyrin repeat and SOCS box protein 5 | 4.44e-16 | 1.81e-13 | 2.33e-06 |
| 1. PB | Q54HW1 | 26S proteasome non-ATPase regulatory subunit 10 | 0.00e+00 | 1.01e-14 | 6.31e-18 |
| 1. PB | Q9J5H8 | Putative ankyrin repeat protein FPV023 | NA | 7.67e-05 | 6.19e-07 |
| 1. PB | Q0P5B9 | Ankyrin repeat domain-containing protein 39 | 3.22e-15 | 4.04e-14 | 7.01e-08 |
| 1. PB | Q06527 | Ankyrin homolog | 2.22e-16 | 4.39e-09 | 1.04e-14 |
| 1. PB | Q641X1 | Ankyrin repeat domain-containing protein 61 | 2.19e-11 | 9.78e-10 | 2.37e-04 |
| 1. PB | Q566C8 | Ankyrin repeat domain-containing protein 54 | 1.36e-05 | 1.14e-02 | 4.49e-08 |
| 1. PB | Q9JIA3 | NF-kappa-B inhibitor beta | 4.35e-10 | 7.72e-06 | 1.57e-04 |
| 1. PB | Q60773 | Cyclin-dependent kinase 4 inhibitor D | 1.11e-16 | 1.26e-17 | 6.86e-09 |
| 1. PB | O14593 | DNA-binding protein RFXANK | 1.56e-09 | 6.71e-04 | 1.57e-05 |
| 1. PB | Q6P1S6 | Myotrophin | 7.59e-13 | 4.98e-09 | 0.002 |
| 1. PB | Q3SX45 | Ankyrin repeat and SOCS box protein 2 | 6.10e-10 | 2.40e-03 | 2.75e-11 |
| 1. PB | Q9D1A4 | Ankyrin repeat and SOCS box protein 5 | 2.22e-16 | 1.45e-14 | 1.63e-05 |
| 1. PB | Q91955 | Myotrophin | 8.77e-13 | 2.17e-09 | 5.34e-05 |
| 1. PB | Q4KL97 | Ankyrin repeat domain-containing protein 1 | 3.80e-13 | 3.34e-04 | 2.01e-09 |
| 1. PB | P62774 | Myotrophin | 7.41e-13 | 5.97e-06 | 2.62e-04 |
| 1. PB | P58546 | Myotrophin | 6.92e-13 | 9.99e-07 | 6.11e-04 |
| 1. PB | Q9Z2X2 | 26S proteasome non-ATPase regulatory subunit 10 | 0.00e+00 | 1.31e-16 | 6.16e-16 |
| 1. PB | Q4R544 | Ankyrin repeat and SOCS box protein 8 | 1.99e-10 | 7.51e-03 | 3.20e-14 |
| 1. PB | Q8N6D5 | Ankyrin repeat domain-containing protein 29 | 0.00e+00 | 2.64e-08 | 1.69e-04 |
| 1. PB | Q9WV06 | Ankyrin repeat domain-containing protein 2 | 3.30e-10 | 7.95e-05 | 1.51e-10 |
| 1. PB | Q60772 | Cyclin-dependent kinase 4 inhibitor C | 3.42e-14 | 1.19e-09 | 6.28e-06 |
| 1. PB | Q7T2B9 | Myotrophin | 4.69e-14 | 1.25e-08 | 1.99e-05 |
| 1. PB | Q5RFS1 | Ankyrin repeat and SOCS box protein 11 | 1.11e-16 | 4.73e-15 | 3.08e-06 |
| 1. PB | E5RJM6 | Ankyrin repeat domain-containing protein 65 | 7.88e-15 | 2.26e-10 | 1.04e-08 |
| 1. PB | Q6NSI1 | Putative ankyrin repeat domain-containing protein 26-like protein | 3.96e-13 | 9.43e-04 | 4.78e-62 |
| 1. PB | Q9GZV1 | Ankyrin repeat domain-containing protein 2 | 2.22e-10 | 1.05e-04 | 2.00e-09 |
| 1. PB | Q9D504 | Ankyrin repeat domain-containing protein 7 | 0.00e+00 | 2.11e-50 | 2.52e-72 |
| 1. PB | P77736 | Putative ankyrin repeat protein YahD | 0.00e+00 | 8.80e-07 | 3.38e-05 |
| 1. PB | Q5R6D7 | Ankyrin repeat and SOCS box protein 8 | 3.41e-12 | 9.81e-03 | 2.16e-14 |
| 1. PB | P42773 | Cyclin-dependent kinase 4 inhibitor C | 0.00e+00 | 2.40e-10 | 6.23e-05 |
| 1. PB | B4E2M5 | Ankyrin repeat domain-containing protein 66 | 1.30e-06 | 4.22e-04 | 0.004 |
| 1. PB | Q8WXK3 | Ankyrin repeat and SOCS box protein 13 | 0.00e+00 | 3.46e-09 | 2.38e-11 |
| 1. PB | Q08353 | NF-kappa-B inhibitor alpha | 3.18e-12 | 2.79e-13 | 1.31e-07 |
| 1. PB | Q8K0L0 | Ankyrin repeat and SOCS box protein 2 | 2.72e-13 | 1.57e-03 | 4.55e-08 |
| 1. PB | A0PJZ0 | Putative ankyrin repeat domain-containing protein 20A5 | 1.45e-07 | 4.93e-14 | 2.47e-77 |
| 1. PB | Q7T0Q1 | Myotrophin | 1.14e-12 | 3.27e-09 | 0.001 |
| 1. PB | Q8WXH4 | Ankyrin repeat and SOCS box protein 11 | 1.52e-14 | 5.32e-15 | 1.87e-06 |
| 1. PB | Q6P6B7 | Ankyrin repeat domain-containing protein 16 | 1.74e-12 | 1.15e-10 | 1.27e-07 |
| 1. PB | A6QPE7 | Ankyrin repeat domain-containing protein 65 | 3.64e-14 | 6.73e-10 | 2.96e-14 |
| 1. PB | Q8VHS5 | Ankyrin repeat and SOCS box protein 16 | 1.71e-11 | 1.47e-08 | 1.91e-05 |
| 1. PB | Q8Q0U0 | Putative ankyrin repeat protein MM_0045 | 3.33e-16 | 3.17e-03 | 6.71e-17 |
| 1. PB | Q9H765 | Ankyrin repeat and SOCS box protein 8 | 3.26e-12 | 8.76e-03 | 2.14e-14 |
| 1. PB | Q9Z2X3 | 26S proteasome non-ATPase regulatory subunit 10 | 0.00e+00 | 2.21e-16 | 1.86e-13 |
| 1. PB | P20749 | B-cell lymphoma 3 protein | 3.16e-11 | 1.41e-04 | 2.23e-14 |
| 1. PB | Q5VYY1 | Ankyrin repeat domain-containing protein 22 | 1.11e-16 | 7.91e-06 | 1.33e-04 |
| 1. PB | Q1RJR6 | Putative ankyrin repeat protein RBE_0317 | 2.20e-10 | 6.57e-03 | 2.89e-10 |
| 1. PB | Q63746 | NF-kappa-B inhibitor alpha | 1.76e-13 | 1.24e-11 | 7.59e-07 |
| 1. PB | Q9FNP4 | Phytochrome-interacting ankyrin-repeat protein 2 | 2.91e-10 | 9.56e-05 | 0.004 |
| 1. PB | Q10311 | Ankyrin repeat-containing protein C6C3.08 | 0.00e+00 | 1.30e-08 | 7.00e-09 |
| 1. PB | O75832 | 26S proteasome non-ATPase regulatory subunit 10 | 0.00e+00 | 1.42e-19 | 3.93e-16 |
| 1. PB | P62775 | Myotrophin | 7.12e-13 | 5.97e-06 | 2.62e-04 |
| 1. PB | Q9CQM6 | Ankyrin repeat domain-containing protein 61 | 3.67e-11 | 8.41e-08 | 2.14e-07 |
| 1. PB | A6NGH8 | Ankyrin repeat domain-containing protein 61 | 1.68e-09 | 2.53e-11 | 4.47e-09 |
| 1. PB | Q4R3S3 | Ankyrin repeat domain-containing protein 7 | 0.00e+00 | 5.39e-61 | 1.70e-70 |
| 1. PB | Q1RHQ8 | Putative ankyrin repeat protein RBE_1025 | 2.33e-08 | 3.67e-02 | 0.004 |
| 1. PB | Q9CR42 | Ankyrin repeat domain-containing protein 1 | 1.50e-11 | 1.36e-02 | 2.77e-10 |
| 1. PB | A6NK59 | Ankyrin repeat and SOCS box protein 14 | 4.75e-10 | 1.10e-02 | 6.87e-05 |
| 1. PB | Q9Z1E3 | NF-kappa-B inhibitor alpha | 2.04e-12 | 1.17e-12 | 7.59e-07 |
| 1. PB | Q17QS6 | Ankyrin repeat and SOCS box protein 5 | 1.11e-16 | 8.80e-15 | 3.83e-06 |
| 1. PB | Q9TU71 | Ankyrin repeat domain-containing protein 1 | 2.43e-11 | 2.18e-04 | 1.90e-10 |
| 1. PB | Q55FM5 | Myotrophin homolog | 9.87e-12 | 1.49e-07 | 0.014 |
| 1. PB | Q9D2X0 | Ankyrin repeat domain-containing protein 39 | 2.50e-10 | 4.07e-15 | 1.14e-06 |
| 1. PB | Q9Y574 | Ankyrin repeat and SOCS box protein 4 | 1.36e-13 | 6.29e-04 | 4.91e-05 |
| 1. PB | Q9Z2F6 | B-cell lymphoma 3 protein homolog | 7.93e-12 | 4.81e-03 | 5.27e-11 |
| 1. PB | Q8WXK4 | Ankyrin repeat and SOCS box protein 12 | 5.59e-11 | 3.78e-12 | 0.010 |
| 1. PB | Q9HYV6 | Putative ankyrin repeat protein PA3287 | 0.00e+00 | 7.57e-15 | 3.24e-06 |
| 1. PB | Q7ZT11 | Ankyrin repeat domain-containing protein 1 | 1.53e-14 | 1.75e-03 | 2.60e-10 |
| 1. PB | Q8TC84 | Fibronectin type 3 and ankyrin repeat domains protein 1 | 0.00e+00 | 1.15e-02 | 2.35e-12 |
| 1. PB | Q5UPH1 | Putative ankyrin repeat protein L99 | NA | 4.23e-06 | 0.008 |
| 1. PB | Q2T9W8 | Ankyrin repeat domain-containing protein 61 | 6.82e-13 | 2.33e-10 | 0.001 |
| 1. PB | Q2TB02 | NF-kappa-B inhibitor delta | 3.67e-12 | 2.59e-14 | 2.62e-04 |
| 1. PB | Q8VHA6 | Ankyrin repeat and SOCS box protein 18 | 1.28e-11 | 9.13e-05 | 2.56e-04 |
| 1. PB | Q812A3 | Ankyrin repeat domain-containing protein 23 | 2.62e-11 | 1.32e-03 | 6.72e-10 |
| 1. PB | Q3T0F7 | Myotrophin | 7.46e-13 | 9.99e-07 | 6.11e-04 |
| 1. PB | Q91ZT7 | Ankyrin repeat and SOCS box protein 10 | 6.13e-12 | 1.03e-08 | 1.56e-11 |
| 1. PB | Q9D3J5 | Ankyrin repeat domain-containing protein 22 | 8.88e-16 | 2.36e-04 | 0.009 |
| 1. PB | P55273 | Cyclin-dependent kinase 4 inhibitor D | 1.03e-14 | 5.94e-19 | 1.29e-07 |
| 1. PB | Q1RK83 | Putative ankyrin repeat protein RBE_0150 | 1.16e-09 | 2.57e-08 | 6.26e-04 |
| 1. PB | Q5RCK5 | Ankyrin repeat and SOCS box protein 7 | 1.85e-11 | 8.91e-07 | 3.36e-12 |
| 1. PB | P18954 | Protein PhlB | 1.46e-10 | 1.10e-02 | 0.005 |
| 1. PB | Q9HFE7 | Ankyrin repeat-containing protein P16F5.05c | 1.37e-12 | 2.42e-06 | 0.021 |
| 1. PB | Q978J0 | Putative ankyrin repeat protein TV1425 | 0.00e+00 | 1.87e-12 | 6.30e-17 |
| 1. PB | Q91ZU0 | Ankyrin repeat and SOCS box protein 7 | 6.06e-13 | 5.48e-06 | 3.30e-12 |
| 1. PB | Q6ZVZ8 | Ankyrin repeat and SOCS box protein 18 | 7.77e-16 | 1.96e-05 | 1.10e-06 |
| 1. PB | Q91ZT8 | Ankyrin repeat and SOCS box protein 9 | 0.00e+00 | 7.17e-08 | 0.017 |
| 1. PB | Q8NI38 | NF-kappa-B inhibitor delta | 4.63e-13 | 3.26e-15 | 2.29e-05 |
| 1. PB | Q8WXI3 | Ankyrin repeat and SOCS box protein 10 | 4.43e-12 | 1.48e-09 | 3.27e-07 |
| 1. PB | Q29RV0 | Cyclin-dependent kinase 4 inhibitor D | 4.44e-15 | 1.24e-17 | 7.33e-07 |
| 1. PB | Q9HLN1 | Putative ankyrin repeat protein Ta0196 | 0.00e+00 | 2.82e-18 | 4.37e-09 |
| 1. PB | B0G124 | Ankyrin repeat-containing protein DDB_G0279043 | 0.00e+00 | 1.58e-03 | 2.48e-11 |
| 1. PB | Q6B858 | Fibronectin type 3 and ankyrin repeat domains protein 1 | 0.00e+00 | 1.66e-02 | 4.12e-11 |
| 1. PB | Q5UPJ9 | Putative ankyrin repeat protein L122 | NA | 8.41e-03 | 2.16e-08 |
| 1. PB | Q91974 | NF-kappa-B inhibitor alpha | 1.58e-11 | 2.13e-10 | 8.35e-08 |
| 1. PB | P25963 | NF-kappa-B inhibitor alpha | 2.73e-13 | 1.01e-12 | 2.92e-06 |
| 1. PB | P0C927 | Ankyrin repeat and SOCS box protein 14 | 5.52e-14 | 1.27e-04 | 5.41e-10 |
| 1. PB | Q9H672 | Ankyrin repeat and SOCS box protein 7 | 7.36e-14 | 6.91e-06 | 3.60e-12 |
| 1. PB | Q863Z4 | Myotrophin | 7.55e-13 | 9.99e-07 | 6.11e-04 |
| 1. PB | Q9CQ31 | Ankyrin repeat and SOCS box protein 11 | 6.11e-14 | 1.33e-13 | 4.80e-10 |
| 1. PB | Q9ZCL3 | Putative ankyrin repeat protein RP714 | 1.11e-11 | 1.90e-03 | 5.55e-05 |
| 1. PB | A2AS55 | Ankyrin repeat domain-containing protein 16 | 1.12e-12 | 2.76e-09 | 2.29e-07 |
| 1. PB | Q3ZBX7 | Ankyrin repeat domain-containing protein 1 | 4.85e-13 | 4.29e-03 | 2.12e-09 |
| 1. PB | Q8ZWC4 | Putative ankyrin repeat protein PAE1861 | 5.55e-16 | 3.89e-02 | 1.34e-08 |
| 1. PB | O54910 | NF-kappa-B inhibitor epsilon | 0.00e+00 | 1.61e-10 | 6.47e-08 |
| 1. PB | Q08E43 | Ankyrin repeat and SOCS box protein 8 | 2.31e-12 | 6.29e-04 | 3.43e-14 |
| 1. PB | Q1RK82 | Putative ankyrin repeat protein RBE_0151 | 7.83e-10 | 1.95e-06 | 8.30e-04 |
| 1. PB | Q8VBX0 | Ankyrin repeat and SOCS box protein 13 | 0.00e+00 | 8.58e-09 | 3.01e-12 |
| 1. PB | Q96NS5 | Ankyrin repeat and SOCS box protein 16 | 8.73e-12 | 6.47e-07 | 8.24e-05 |
| 1. PB | Q60778 | NF-kappa-B inhibitor beta | 1.55e-09 | 8.32e-05 | 3.79e-04 |
| 1. PB | Q865U8 | Ankyrin repeat domain-containing protein 1 | 1.64e-11 | 1.13e-03 | 4.71e-10 |
| 1. PB | Q9WV71 | Ankyrin repeat and SOCS box protein 4 | 2.01e-11 | 8.41e-03 | 2.03e-04 |
| 1. PB | Q96Q27 | Ankyrin repeat and SOCS box protein 2 | 7.28e-11 | 7.41e-04 | 3.52e-10 |
| 1. PB | Q3SZE4 | Ankyrin repeat and SOCS box protein 11 | 1.11e-16 | 4.77e-18 | 1.34e-09 |
| 1. PB | Q96DX5 | Ankyrin repeat and SOCS box protein 9 | 0.00e+00 | 1.07e-10 | 4.76e-05 |
| 1. PB | Q4UKI1 | Putative ankyrin repeat protein RF_1099 | 2.44e-09 | 1.72e-07 | 0.040 |
| 1. PB | A7E2S9 | Putative ankyrin repeat domain-containing protein 30B-like | 7.58e-10 | 6.51e-15 | 1.05e-55 |
| 1. PB | Q8WVL7 | Ankyrin repeat domain-containing protein 49 | 1.11e-08 | 2.19e-06 | 0.002 |
| 1. PB | Q8VE42 | Ankyrin repeat domain-containing protein 49 | 8.69e-08 | 2.54e-08 | 0.001 |
| 2. P | Q5I159 | I-Kappa-B like protein C2 | NA | 3.10e-07 | NA |
| 2. P | Q5UPD5 | Putative ankyrin repeat protein L59 | NA | 3.70e-02 | NA |
| 2. P | Q5I140 | I-Kappa-B like protein J1 | NA | 4.33e-05 | NA |
| 2. P | Q6ZQY2 | Leucine-rich repeat-containing protein 74B | 2.16e-01 | 4.12e-03 | NA |
| 2. P | A1L2L5 | Pentatricopeptide repeat-containing protein 2, mitochondrial | 6.43e-03 | 4.96e-02 | NA |
| 2. P | A4II29 | Notch-regulated ankyrin repeat-containing protein | 1.73e-07 | 5.02e-03 | NA |
| 2. P | Q5I160 | I-Kappa-B like protein C1 | NA | 2.72e-16 | NA |
| 2. P | Q32L08 | Protein AMN1 homolog | 1.65e-01 | 4.33e-06 | NA |
| 2. P | Q5I125 | I-Kappa-B like protein N3 | NA | 9.03e-05 | NA |
| 2. P | Q9WV74 | Ankyrin repeat and SOCS box protein 1 | 3.73e-11 | 3.82e-10 | NA |
| 2. P | Q1RIW0 | Putative ankyrin repeat protein RBE_0623 | 8.16e-04 | 2.73e-02 | NA |
| 2. P | A7LN87 | Pentatricopeptide repeat-containing protein PPR5, chloroplastic | 2.17e-03 | 3.36e-02 | NA |
| 2. P | Q9Y576 | Ankyrin repeat and SOCS box protein 1 | 5.64e-11 | 4.91e-09 | NA |
| 2. P | A0QSY0 | Pentapeptide repeat protein MfpA | 9.30e-01 | 4.17e-02 | NA |
| 2. P | Q9SQU6 | Pentatricopeptide repeat-containing protein At3g06430, chloroplastic | 1.10e-03 | 2.56e-03 | NA |
| 2. P | Q4UKY3 | Putative ankyrin repeat protein RF_0939 | 5.80e-08 | 6.55e-07 | NA |
| 2. P | Q5I148 | I-Kappa-B like protein G2 | NA | 2.48e-05 | NA |
| 2. P | A3ABE1 | Pentatricopeptide repeat-containing protein PPR5 homolog, chloroplastic | 3.05e-03 | 4.73e-02 | NA |
| 2. P | Q5UPB9 | Putative ankyrin repeat protein L42 | NA | 1.60e-04 | NA |
| 2. P | A6NM36 | Leucine-rich repeat-containing protein 30 | 8.00e-01 | 1.89e-05 | NA |
| 2. P | P53066 | Ankyrin repeat-containing protein YGL242C | 1.18e-08 | 2.44e-04 | NA |
| 2. P | B8JKV0 | Protein AMN1 homolog | 9.66e-02 | 1.52e-05 | NA |
| 2. P | Q5EFR1 | I-Kappa-B like protein I1 | NA | 1.15e-05 | NA |
| 2. P | Q15653 | NF-kappa-B inhibitor beta | 3.80e-10 | 9.67e-05 | NA |
| 2. P | Q5I126 | I-kappa-B like protein N2 | NA | 5.51e-04 | NA |
| 2. P | Q5UP49 | Putative ankyrin repeat protein L589 | NA | 6.22e-04 | NA |
| 2. P | P14356 | Ankyrin repeat protein M1 | NA | 6.99e-03 | NA |
| 2. P | Q9P7I0 | Ankyrin repeat-containing protein C105.02c | 4.87e-09 | 9.56e-05 | NA |
| 2. P | Q3UV48 | Leucine-rich repeat-containing protein 30 | 7.97e-01 | 3.38e-04 | NA |
| 2. P | Q5UP64 | Putative ankyrin repeat protein R599 | NA | 6.44e-03 | NA |
| 2. P | Q5BIV3 | Pentatricopeptide repeat-containing protein At1g11900 | 6.54e-03 | 3.04e-03 | NA |
| 2. P | P55272 | Cyclin-dependent kinase 4 inhibitor B | 1.28e-11 | 2.26e-05 | NA |
| 2. P | Q9SAB4 | Pentatricopeptide repeat-containing protein At1g11630, mitochondrial | 5.14e-03 | 1.58e-04 | NA |
| 2. P | Q5UP62 | Putative ankyrin repeat protein R601 | NA | 6.57e-04 | NA |
| 2. P | Q5R8X9 | Protein AMN1 homolog | 1.99e-01 | 5.02e-06 | NA |
| 2. P | Q5I149 | I-Kappa-B like protein G1 | NA | 7.26e-08 | NA |
| 2. P | Q54KH3 | Ankyrin repeat domain-containing protein 39 homolog | 3.10e-13 | 6.82e-10 | NA |
| 2. P | Q4V8D9 | Leucine-rich repeat-containing protein 34 | 3.28e-01 | 2.90e-02 | NA |
| 2. P | Q0P4D1 | Protein AMN1 homolog | 2.50e-01 | 3.95e-04 | NA |
| 2. P | P50037 | Phycocyanobilin lyase subunit alpha | 1.79e-02 | 6.05e-03 | NA |
| 2. P | P0C966 | IkB-like protein | NA | 6.23e-07 | NA |
| 2. P | Q5I156 | I-Kappa-B like protein F1 | NA | 3.77e-09 | NA |
| 2. P | Q5UP65 | Putative ankyrin repeat protein R598 | NA | 5.12e-03 | NA |
| 2. P | Q5UQX8 | Putative ankyrin repeat protein R880 | NA | 1.41e-02 | NA |
| 2. P | Q5I144 | I-Kappa-B like protein H1 | NA | 1.04e-09 | NA |
| 2. P | Q0VAA2 | Leucine-rich repeat-containing protein 74A | 5.32e-01 | 4.05e-02 | NA |
| 2. P | Q4ULD9 | Putative ankyrin repeat protein RF_0783 | 8.21e-10 | 2.27e-13 | NA |
| 2. P | Q8WXJ9 | Ankyrin repeat and SOCS box protein 17 | 4.35e-03 | 3.63e-03 | NA |
| 2. P | Q5UP66 | Putative ankyrin repeat protein R597 | NA | 4.16e-03 | NA |
| 2. P | Q7T3X9 | Notch-regulated ankyrin repeat-containing protein B | 5.02e-07 | 6.23e-05 | NA |
| 2. P | Q7T3Y0 | Notch-regulated ankyrin repeat-containing protein A | 2.57e-10 | 3.04e-05 | NA |
| 2. P | Q9ZU67 | Pentatricopeptide repeat-containing protein At2g18520, mitochondrial | 5.31e-03 | 3.52e-03 | NA |
| 2. P | Q9LG23 | Pentatricopeptide repeat-containing protein At1g55890, mitochondrial | 2.50e-03 | 1.48e-04 | NA |
| 2. P | Q8IZ02 | Leucine-rich repeat-containing protein 34 | 3.95e-01 | 4.59e-02 | NA |
| 2. P | Q5UP63 | Putative ankyrin repeat protein R600 | NA | 4.12e-03 | NA |
| 2. P | Q5URA0 | Putative ankyrin repeat protein L148 | NA | 7.86e-05 | NA |
| 2. P | Q91ZA8 | Notch-regulated ankyrin repeat-containing protein | 1.56e-08 | 2.95e-04 | NA |
| 2. P | Q5UQ04 | Putative ankyrin repeat protein R791 | NA | 1.73e-03 | NA |
| 2. P | P0C965 | IkB-like protein | NA | 6.90e-07 | NA |
| 2. P | Q1RIZ8 | Putative ankyrin repeat protein RBE_0585 | 1.10e-06 | 9.37e-07 | NA |
| 2. P | Q2KJD8 | Cyclin-dependent kinase 4 inhibitor B | 9.32e-12 | 1.77e-06 | NA |
| 2. P | Q9D119 | Protein phosphatase 1 regulatory subunit 27 | 7.70e-08 | 3.30e-06 | NA |
| 2. P | O36972 | IkB-like protein | NA | 5.54e-06 | NA |
| 2. P | O51360 | Putative ankyrin repeat protein BB_0399 | 7.35e-08 | 1.43e-04 | NA |
| 2. P | P55271 | Cyclin-dependent kinase 4 inhibitor B | 2.08e-11 | 1.41e-04 | NA |
| 2. P | Q5I129 | I-Kappa-B like protein N1 | NA | 5.23e-03 | NA |
| 2. P | Q4UMP3 | Putative ankyrin repeat protein RF_0314 | 8.43e-05 | 7.86e-05 | NA |
| 2. P | Q5U201 | Protein AMN1 homolog | 1.23e-01 | 1.40e-05 | NA |
| 2. P | Q8IY45 | Protein AMN1 homolog | 1.37e-01 | 2.36e-06 | NA |
| 2. P | P0C9P4 | Protein MGF 360-10L | NA | 3.82e-02 | NA |
| 2. P | Q7Z6K4 | Notch-regulated ankyrin repeat-containing protein | 1.47e-08 | 2.95e-04 | NA |
| 2. P | Q5UP61 | Putative ankyrin repeat protein R602 | NA | 7.02e-04 | NA |
| 2. P | P42772 | Cyclin-dependent kinase 4 inhibitor B | 7.95e-11 | 9.74e-07 | NA |
| 2. P | Q5UP60 | Putative ankyrin repeat protein R603 | NA | 2.43e-02 | NA |
| 2. P | Q5UPB2 | Putative ankyrin repeat protein L38 | NA | 2.67e-06 | NA |
| 2. P | P20640 | Ankyrin repeat protein M1 | NA | 1.63e-02 | NA |
| 2. P | Q8GW57 | Pentatricopeptide repeat-containing protein At1g80150, mitochondrial | 1.88e-03 | 3.10e-03 | NA |
| 2. P | Q9S733 | Pentatricopeptide repeat-containing protein At2g40240, mitochondrial | 1.78e-03 | 7.33e-04 | NA |
| 2. P | Q5UQQ5 | Putative ankyrin repeat protein R858 | NA | 5.16e-05 | NA |
| 2. P | Q9M065 | Pentatricopeptide repeat-containing protein At4g36680, mitochondrial | 3.30e-03 | 4.92e-03 | NA |
| 2. P | P50086 | Probable 26S proteasome regulatory subunit p28 | 0.00e+00 | 8.15e-11 | NA |
| 2. P | Q32KY8 | Ankyrin repeat and SOCS box protein 17 | 8.02e-03 | 2.07e-02 | NA |
| 2. P | Q5I155 | I-Kappa-B like protein F2 | NA | 3.34e-05 | NA |
| 2. P | Q96BM1 | Ankyrin repeat domain-containing protein 9 | 1.17e-05 | 1.37e-02 | NA |
| 2. P | P42771 | Cyclin-dependent kinase inhibitor 2A | 4.91e-08 | 4.77e-04 | NA |
| 2. P | Q84J71 | Pentatricopeptide repeat-containing protein At2g17670 | 2.04e-03 | 1.89e-02 | NA |
| 2. P | Q9LQQ1 | Pentatricopeptide repeat-containing protein At1g07740, mitochondrial | 3.99e-03 | 1.18e-02 | NA |
| 2. P | Q76U48 | IkB-like protein | NA | 3.50e-05 | NA |
| 2. P | Q5U5A6 | Notch-regulated ankyrin repeat-containing protein | 4.29e-10 | 1.86e-03 | NA |
| 2. P | A8HMZ4 | Dynein regulatory complex subunit 5 | 2.35e-01 | 2.90e-02 | NA |
| 2. P | Q14BP6 | Leucine-rich repeat-containing protein 74B | 2.10e-01 | 1.50e-02 | NA |
| 2. P | Q8BH83 | Ankyrin repeat domain-containing protein 9 | 2.00e-05 | 2.08e-04 | NA |
| 2. P | Q5UP34 | Putative ankyrin repeat protein R825 | NA | 6.50e-04 | NA |
| 2. P | Q5UPK1 | Putative ankyrin repeat protein L120 | NA | 1.35e-03 | NA |
| 2. P | Q5EFZ4 | Vacuolar protein 8 | 8.12e-02 | 2.35e-02 | NA |
| 2. P | Q86WC6 | Protein phosphatase 1 regulatory subunit 27 | 1.89e-06 | 2.77e-06 | NA |
| 2. P | P0C964 | IkB-like protein | NA | 3.26e-07 | NA |
| 2. P | Q9FF09 | Phytochrome-interacting ankyrin-repeat protein 1 | 1.68e-06 | 2.40e-05 | NA |
| 3. B | Q7TQI7 | Ankyrin repeat and BTB/POZ domain-containing protein 2 | 1.29e-04 | NA | 0.006 |
| 3. B | Q8N9V6 | Ankyrin repeat domain-containing protein 53 | 1.35e-04 | NA | 0.003 |
| 3. B | Q8VHS6 | Ankyrin repeat and SOCS box protein 15 | 1.80e-09 | NA | 2.32e-08 |
| 3. B | Q8BX02 | KN motif and ankyrin repeat domain-containing protein 2 | 4.55e-05 | NA | 3.55e-07 |
| 3. B | Q5URB9 | Putative ankyrin repeat protein R840 | NA | NA | 0.002 |
| 3. B | Q9J5H9 | Putative ankyrin repeat protein FPV022 | NA | NA | 4.98e-05 |
| 3. B | Q8IUH5 | Palmitoyltransferase ZDHHC17 | 5.79e-13 | NA | 2.76e-15 |
| 3. B | Q54KA7 | Ankyrin repeat, PH and SEC7 domain containing protein secG | 6.98e-07 | NA | 1.34e-22 |
| 3. B | Q0V8G2 | GA-binding protein subunit beta-2 | 9.61e-13 | NA | 3.94e-06 |
| 3. B | P59672 | Ankyrin repeat and SAM domain-containing protein 1A | 2.60e-06 | NA | 1.18e-04 |
| 3. B | O14974 | Protein phosphatase 1 regulatory subunit 12A | 4.83e-06 | NA | 0.004 |
| 3. B | Q99NH0 | Ankyrin repeat domain-containing protein 17 | 3.53e-04 | NA | 1.13e-18 |
| 3. B | Q2QL84 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.75e-08 | NA | 6.74e-05 |
| 3. B | A9JR78 | Tonsoku-like protein | 2.33e-02 | NA | 1.50e-05 |
| 3. B | P57078 | Receptor-interacting serine/threonine-protein kinase 4 | 3.30e-08 | NA | 4.43e-10 |
| 3. B | Q6P9J5 | KN motif and ankyrin repeat domain-containing protein 4 | 1.07e-03 | NA | 3.72e-05 |
| 3. B | Q3TYL0 | IQ motif and ankyrin repeat domain-containing protein 1 | 1.47e-04 | NA | 0.003 |
| 3. B | Q9Y575 | Ankyrin repeat and SOCS box protein 3 | 9.04e-13 | NA | 9.26e-08 |
| 3. B | Q1LZC5 | Ankyrin repeat domain-containing protein 54 | 5.37e-06 | NA | 9.05e-08 |
| 3. B | Q2QLB5 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 6.47e-12 | NA | 1.64e-04 |
| 3. B | P0C6P7 | Protein fem-1 homolog B | 2.92e-11 | NA | 6.60e-08 |
| 3. B | Q8CEF1 | Protein fem-1 homolog C | 6.93e-13 | NA | 1.86e-04 |
| 3. B | D3J162 | Protein VAPYRIN | 4.10e-10 | NA | 2.59e-12 |
| 3. B | Q4UJ75 | Putative ankyrin repeat domain-containing protein 20A4 | 0.00e+00 | NA | 4.46e-113 |
| 3. B | Q9UM47 | Neurogenic locus notch homolog protein 3 | 1.09e-05 | NA | 7.19e-08 |
| 3. B | Q8N7Z5 | Ankyrin repeat domain-containing protein 31 | 5.54e-02 | NA | 0.002 |
| 3. B | Q01317 | Ankyrin repeat protein nuc-2 | 2.53e-07 | NA | 4.15e-08 |
| 3. B | P14585 | Protein lin-12 | 2.26e-07 | NA | 1.56e-07 |
| 3. B | Q96T49 | Protein phosphatase 1 regulatory inhibitor subunit 16B | 2.78e-11 | NA | 0.003 |
| 3. B | Q8LSQ2 | Probable signal recognition particle 43 kDa protein, chloroplastic | 2.00e-04 | NA | 5.35e-05 |
| 3. B | Q99466 | Neurogenic locus notch homolog protein 4 | 4.10e-06 | NA | 1.58e-09 |
| 3. B | P13264 | Glutaminase kidney isoform, mitochondrial | 2.24e-02 | NA | 1.17e-05 |
| 3. B | Q8K4M9 | Oxysterol-binding protein-related protein 1 | 6.74e-05 | NA | 0.006 |
| 3. B | Q00PJ3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 7.68e-10 | NA | 2.22e-06 |
| 3. B | Q07E41 | Cortactin-binding protein 2 | 9.27e-08 | NA | 0.002 |
| 3. B | Q95N27 | Protein phosphatase 1 regulatory inhibitor subunit 16B | 8.44e-11 | NA | 0.002 |
| 3. B | P97819 | 85/88 kDa calcium-independent phospholipase A2 | 4.63e-09 | NA | 3.92e-07 |
| 3. B | Q8N6S4 | Ankyrin repeat domain-containing protein 13C | 2.46e-04 | NA | 0.049 |
| 3. B | Q02357 | Ankyrin-1 | 1.69e-04 | NA | 1.28e-12 |
| 3. B | O44997 | Death-associated protein kinase dapk-1 | 4.02e-06 | NA | 8.93e-04 |
| 3. B | Q5FVC7 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 | 2.63e-03 | NA | 4.55e-04 |
| 3. B | P41412 | Cell division cycle-related protein res2/pct1 | 2.29e-04 | NA | 2.51e-04 |
| 3. B | Q2QLC6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 6.95e-10 | NA | 9.21e-05 |
| 3. B | Q4ULZ2 | Putative ankyrin repeat protein RF_0580 | 1.11e-16 | NA | 7.67e-09 |
| 3. B | Q8N8A2 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B | 3.87e-08 | NA | 1.54e-16 |
| 3. B | Q9NU02 | Ankyrin repeat and EF-hand domain-containing protein 1 | 2.56e-08 | NA | 2.88e-06 |
| 3. B | Q29RM5 | Protein fem-1 homolog A | 5.40e-12 | NA | 2.65e-06 |
| 3. B | Q9ZU96 | Ankyrin repeat-containing protein At2g01680 | 4.35e-12 | NA | 8.10e-05 |
| 3. B | Q5ZK62 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 | 1.23e-03 | NA | 1.42e-04 |
| 3. B | Q5TYM7 | CARD- and ANK-domain containing inflammasome adapter protein | 5.05e-09 | NA | 1.86e-12 |
| 3. B | B2FKA7 | Actin-binding protein Smlt3054 | 2.74e-05 | NA | 0.049 |
| 3. B | Q5U312 | Ankycorbin | 2.10e-09 | NA | 3.69e-13 |
| 3. B | Q21920 | Ankyrin repeat and KH domain-containing protein mask-1 | 7.16e-04 | NA | 3.01e-10 |
| 3. B | Q65XV2 | E3 ubiquitin-protein ligase XB3 | 1.53e-10 | NA | 1.11e-07 |
| 3. B | S0DPL8 | Apicidin F cluster transcription factor apf2 | 2.84e-05 | NA | 0.001 |
| 3. B | Q8WUF5 | RelA-associated inhibitor | 6.06e-03 | NA | 0.031 |
| 3. B | A1ZBY1 | Protein fem-1 homolog B | 1.45e-08 | NA | 3.73e-05 |
| 3. B | Q5UQ58 | Putative ankyrin repeat protein R664 | NA | NA | 0.028 |
| 3. B | Q554E7 | Putative ZDHHC-type palmitoyltransferase 5 | 9.57e-10 | NA | 1.10e-06 |
| 3. B | Q14DN9 | Ankyrin repeat and death domain-containing protein 1B | 9.40e-11 | NA | 8.54e-13 |
| 3. B | A6QL64 | Ankyrin repeat domain-containing protein 36A | 1.30e-05 | NA | 1.06e-63 |
| 3. B | Q9VUX2 | E3 ubiquitin-protein ligase mind-bomb | 1.33e-06 | NA | 1.71e-16 |
| 3. B | Q4JHE0 | Probable E3 ubiquitin-protein ligase XBOS36 | 2.02e-10 | NA | 0.033 |
| 3. B | P53356 | Tyrosine-protein kinase HTK16 | 3.73e-04 | NA | 6.66e-05 |
| 3. B | Q9SQK3 | Ankyrin repeat domain-containing protein EMB506, chloroplastic | 7.49e-11 | NA | 7.53e-10 |
| 3. B | Q6NRD0 | Ankyrin repeat domain-containing protein 13C-A | 2.90e-05 | NA | 0.039 |
| 3. B | A2AQH4 | BCL-6 corepressor-like protein 1 | 1.91e-01 | NA | 1.48e-05 |
| 3. B | O70511 | Ankyrin-3 | 1.62e-03 | NA | 2.57e-15 |
| 3. B | Q90623 | Protein phosphatase 1 regulatory subunit 12A | 6.32e-06 | NA | 0.004 |
| 3. B | Q3U0D9 | E3 ubiquitin-protein ligase HACE1 | 5.53e-08 | NA | 1.72e-13 |
| 3. B | P24769 | Ankyrin repeat protein B4 | NA | NA | 1.19e-04 |
| 3. B | Q9TXQ1 | Poly [ADP-ribose] polymerase tankyrase | 1.17e-03 | NA | 4.21e-05 |
| 3. B | Q7Z8U2 | Palmitoyltransferase akr1 | 5.91e-12 | NA | 2.26e-06 |
| 3. B | Q5UPE2 | Putative ankyrin repeat protein L63 | NA | NA | 0.002 |
| 3. B | Q7T163 | Kinase D-interacting substrate of 220 kDa B | 8.06e-06 | NA | 1.28e-14 |
| 3. B | Q68DC2 | Ankyrin repeat and SAM domain-containing protein 6 | 5.37e-10 | NA | 2.15e-04 |
| 3. B | Q9J505 | Putative ankyrin repeat protein FPV230 | NA | NA | 0.008 |
| 3. B | A1X154 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.29e-12 | NA | 9.81e-07 |
| 3. B | Q7XUW4 | Potassium channel KOR2 | 3.72e-07 | NA | 6.17e-09 |
| 3. B | Q6RI86 | Transient receptor potential cation channel subfamily A member 1 | 6.19e-06 | NA | 1.16e-08 |
| 3. B | Q15057 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 | 7.72e-03 | NA | 4.72e-04 |
| 3. B | Q1RMI3 | GA-binding protein subunit beta-1 | 1.31e-13 | NA | 1.44e-08 |
| 3. B | Q9WV48 | SH3 and multiple ankyrin repeat domains protein 1 | 2.38e-03 | NA | 9.65e-06 |
| 3. B | Q8N2N9 | Ankyrin repeat domain-containing protein 36B | 7.49e-10 | NA | 1.27e-69 |
| 3. B | Q63369 | Nuclear factor NF-kappa-B p105 subunit (Fragment) | 2.91e-12 | NA | 7.53e-04 |
| 3. B | D3J163 | Protein VAPYRIN-LIKE | 3.73e-09 | NA | 0.007 |
| 3. B | A2A690 | Protein TANC2 | 2.40e-03 | NA | 1.92e-09 |
| 3. B | A5A3E0 | POTE ankyrin domain family member F | 5.09e-13 | NA | 7.57e-69 |
| 3. B | Q07DW4 | Cortactin-binding protein 2 | 7.49e-08 | NA | 1.50e-04 |
| 3. B | Q6FJ70 | Palmitoyltransferase AKR1 | 4.37e-08 | NA | 0.038 |
| 3. B | Q38898 | Potassium channel AKT2/3 | 2.00e-04 | NA | 4.78e-07 |
| 3. B | Q8CGN4 | BCL-6 corepressor | 2.60e-02 | NA | 8.40e-05 |
| 3. B | Q61982 | Neurogenic locus notch homolog protein 3 | 2.99e-04 | NA | 7.87e-08 |
| 3. B | Q7T3P8 | Protein fem-1 homolog C | 7.72e-13 | NA | 3.30e-05 |
| 3. B | Q5UPX1 | Putative ankyrin repeat protein L289 | NA | NA | 1.88e-07 |
| 3. B | P17221 | Sex-determining protein fem-1 | 3.19e-08 | NA | 2.62e-07 |
| 3. B | Q8BXP5 | Photoreceptor ankyrin repeat protein | 2.01e-07 | NA | 5.98e-04 |
| 3. B | O83515 | Putative ankyrin repeat-containing protein TP_0502 | 3.30e-07 | NA | 4.36e-04 |
| 3. B | A7MB89 | Protein fem-1 homolog C | 6.37e-13 | NA | 7.25e-04 |
| 3. B | Q9WTT2 | Caseinolytic peptidase B protein homolog | 3.56e-03 | NA | 3.29e-05 |
| 3. B | Q80T11 | Usher syndrome type-1G protein homolog | 1.97e-08 | NA | 4.97e-04 |
| 3. B | Q9D2J7 | Ankyrin repeat and EF-hand domain-containing protein 1 | 2.57e-07 | NA | 1.65e-06 |
| 3. B | Q9H2K2 | Poly [ADP-ribose] polymerase tankyrase-2 | 1.47e-07 | NA | 7.26e-13 |
| 3. B | Q9D061 | Acyl-CoA-binding domain-containing protein 6 | 8.02e-06 | NA | 0.005 |
| 3. B | Q9BXX2 | Ankyrin repeat domain-containing protein 30B | 2.33e-08 | NA | 1.85e-59 |
| 3. B | Q06547 | GA-binding protein subunit beta-1 | 2.72e-13 | NA | 1.86e-08 |
| 3. B | A6NHY2 | Ankyrin repeat and death domain-containing protein 1B | 9.37e-11 | NA | 7.07e-13 |
| 3. B | Q8UVC1 | Inversin | 3.25e-08 | NA | 1.41e-10 |
| 3. B | Q5SQ80 | Putative ankyrin repeat domain-containing protein 20A2 | 0.00e+00 | NA | 1.15e-113 |
| 3. B | Q2IBD4 | Cortactin-binding protein 2 | 6.77e-08 | NA | 4.35e-04 |
| 3. B | P0CG39 | POTE ankyrin domain family member J | 2.63e-13 | NA | 1.39e-68 |
| 3. B | P46530 | Neurogenic locus notch homolog protein 1 | 9.97e-04 | NA | 1.24e-08 |
| 3. B | Q6GQW0 | Ankyrin repeat and BTB/POZ domain-containing protein BTBD11 | 9.78e-04 | NA | 0.036 |
| 3. B | Q6TGW5 | Osteoclast-stimulating factor 1 | 2.35e-09 | NA | 4.12e-04 |
| 3. B | Q2IBE3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.79e-09 | NA | 5.35e-04 |
| 3. B | Q63618 | Espin | 1.70e-09 | NA | 2.98e-04 |
| 3. B | Q1RIZ4 | Putative ankyrin repeat protein RBE_0589 | 3.43e-06 | NA | 1.66e-07 |
| 3. B | B9EJA2 | Cortactin-binding protein 2 | 3.84e-08 | NA | 0.007 |
| 3. B | Q8CGB3 | Uveal autoantigen with coiled-coil domains and ankyrin repeats | 1.11e-10 | NA | 2.20e-12 |
| 3. B | Q8IWB6 | Inactive serine/threonine-protein kinase TEX14 | 8.98e-02 | NA | 2.41e-04 |
| 3. B | Q3UES3 | Poly [ADP-ribose] polymerase tankyrase-2 | 2.26e-07 | NA | 4.52e-13 |
| 3. B | A5WVX9 | Palmitoyltransferase ZDHHC17 | 4.75e-12 | NA | 8.07e-15 |
| 3. B | Q9J504 | Putative ankyrin repeat protein FPV231 | NA | NA | 4.94e-14 |
| 3. B | Q91ZT9 | Ankyrin repeat and SOCS box protein 8 | 2.18e-12 | NA | 4.34e-14 |
| 3. B | Q6W2J9 | BCL-6 corepressor | 2.57e-02 | NA | 6.77e-05 |
| 3. B | P0DSS9 | Ankyrin repeat protein B4 | NA | NA | 0.016 |
| 3. B | Q9Y2G4 | Ankyrin repeat domain-containing protein 6 | 5.56e-10 | NA | 1.95e-12 |
| 3. B | F1LTE0 | Protein TANC2 | 1.66e-03 | NA | 1.92e-09 |
| 3. B | O08764 | Ankyrin repeat and BTB/POZ domain-containing protein 2 | 8.80e-04 | NA | 8.03e-04 |
| 3. B | B1AK53 | Espin | 4.21e-08 | NA | 5.70e-04 |
| 3. B | Q495M9 | Usher syndrome type-1G protein | 1.90e-08 | NA | 5.58e-04 |
| 3. B | Q9ERC1 | Unconventional myosin-XVI | 5.17e-04 | NA | 9.22e-08 |
| 3. B | Q9P2R3 | Rabankyrin-5 | 3.64e-05 | NA | 2.03e-11 |
| 3. B | Q8BZ25 | Ankyrin repeat and protein kinase domain-containing protein 1 | 1.86e-11 | NA | 3.91e-13 |
| 3. B | Q8UVC3 | Inversin | 5.13e-08 | NA | 6.33e-11 |
| 3. B | P13508 | Protein glp-1 | 1.70e-08 | NA | 6.20e-10 |
| 3. B | Q9SCX5 | Probable potassium channel AKT5 | 5.85e-06 | NA | 1.45e-09 |
| 3. B | Q2QLG0 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 3.03e-09 | NA | 2.78e-04 |
| 3. B | Q05823 | 2-5A-dependent ribonuclease | 1.41e-08 | NA | 3.50e-07 |
| 3. B | P57044 | Integrin-linked protein kinase | 1.17e-06 | NA | 1.62e-09 |
| 3. B | Q91XL9 | Oxysterol-binding protein-related protein 1 | 3.14e-05 | NA | 0.005 |
| 3. B | Q75HP9 | Potassium channel AKT2 | 1.79e-03 | NA | 0.004 |
| 3. B | Q4X251 | Palmitoyltransferase akr1 | 1.19e-11 | NA | 7.40e-08 |
| 3. B | Q12013 | Probable palmitoyltransferase AKR2 | 2.67e-07 | NA | 1.03e-06 |
| 3. B | Q8WMX7 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.52e-09 | NA | 6.30e-05 |
| 3. B | Q5UPG6 | Putative ankyrin repeat protein L92 | NA | NA | 3.30e-06 |
| 3. B | B7WN72 | Protein shank | 1.13e-05 | NA | 1.19e-05 |
| 3. B | Q9Z205 | DNA-binding protein RFXANK | 3.23e-12 | NA | 3.47e-05 |
| 3. B | Q14678 | KN motif and ankyrin repeat domain-containing protein 1 | 2.87e-03 | NA | 3.20e-04 |
| 3. B | Q9BXW6 | Oxysterol-binding protein-related protein 1 | 8.40e-06 | NA | 0.007 |
| 3. B | Q00653 | Nuclear factor NF-kappa-B p100 subunit | 3.56e-08 | NA | 1.87e-07 |
| 3. B | Q5ZLC8 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 4.88e-07 | NA | 1.94e-13 |
| 3. B | Q68LP1 | E3 ubiquitin-protein ligase MIB2 | 1.19e-07 | NA | 2.33e-08 |
| 3. B | Q01484 | Ankyrin-2 | NA | NA | 5.90e-15 |
| 3. B | Q9UK73 | Protein fem-1 homolog B | 6.27e-12 | NA | 7.04e-08 |
| 3. B | F8W2M1 | E3 ubiquitin-protein ligase HACE1 | 2.72e-08 | NA | 2.13e-14 |
| 3. B | Q2QLH1 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 7.58e-09 | NA | 1.09e-04 |
| 3. B | Q4R739 | Ankyrin repeat domain-containing protein 53 | 4.90e-05 | NA | 0.001 |
| 3. B | Q9J513 | Putative ankyrin repeat protein FPV222 | NA | NA | 1.76e-08 |
| 3. B | Q9DBR7 | Protein phosphatase 1 regulatory subunit 12A | 3.53e-06 | NA | 0.007 |
| 3. B | Q9U518 | L-asparaginase | 6.35e-06 | NA | 1.08e-06 |
| 3. B | Q9Y283 | Inversin | 8.62e-08 | NA | 5.23e-12 |
| 3. B | Q495B1 | Ankyrin repeat and death domain-containing protein 1A | 7.28e-13 | NA | 1.23e-11 |
| 3. B | Q9M8S6 | Potassium channel SKOR | 6.24e-06 | NA | 2.59e-10 |
| 3. B | Q9ULH0 | Kinase D-interacting substrate of 220 kDa | 4.40e-04 | NA | 4.52e-14 |
| 3. B | G3I6Z6 | Neurogenic locus notch homolog protein 1 | NA | NA | 2.79e-09 |
| 3. B | P14360 | Putative ankyrin repeat protein FPV240 | NA | NA | 8.65e-09 |
| 3. B | O70445 | BRCA1-associated RING domain protein 1 | 4.81e-03 | NA | 5.22e-09 |
| 3. B | Q09YK6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 3.49e-09 | NA | 3.96e-06 |
| 3. B | Q5UPG5 | Putative ankyrin repeat protein L93 | NA | NA | 5.39e-14 |
| 3. B | Q9J502 | Putative ankyrin repeat protein FPV233 | NA | NA | 2.35e-10 |
| 3. B | Q91WK7 | Ankyrin repeat domain-containing protein 54 | 1.23e-05 | NA | 3.80e-08 |
| 3. B | Q9WV72 | Ankyrin repeat and SOCS box protein 3 | 1.03e-11 | NA | 2.06e-06 |
| 3. B | Q876L4 | Probable palmitoyltransferase AKR2 | 1.56e-07 | NA | 2.22e-05 |
| 3. B | Q80SY4 | E3 ubiquitin-protein ligase MIB1 | 1.08e-07 | NA | 1.34e-16 |
| 3. B | Q876L5 | Palmitoyltransferase AKR1 | 1.15e-06 | NA | 1.88e-07 |
| 3. B | Q4I8B6 | Palmitoyltransferase AKR1 | 1.08e-08 | NA | 2.12e-08 |
| 3. B | P16157 | Ankyrin-1 | 1.89e-04 | NA | 5.33e-14 |
| 3. B | Q5VUR7 | Putative ankyrin repeat domain-containing protein 20A3 | 0.00e+00 | NA | 1.13e-113 |
| 3. B | O88202 | 60 kDa lysophospholipase | 3.64e-05 | NA | 2.44e-05 |
| 3. B | Q6S8J3 | POTE ankyrin domain family member E | 1.87e-09 | NA | 2.53e-69 |
| 3. B | Q96I34 | Protein phosphatase 1 regulatory subunit 16A | 3.59e-12 | NA | 0.019 |
| 3. B | Q0VGY8 | Protein TANC1 | 2.78e-04 | NA | 6.28e-09 |
| 3. B | P0C0T2 | Ankyrin repeat and SAM domain-containing protein 6 | 6.59e-10 | NA | 1.40e-07 |
| 3. B | O95271 | Poly [ADP-ribose] polymerase tankyrase-1 | 1.88e-05 | NA | 1.04e-16 |
| 3. B | A6QL63 | Ankyrin repeat and BTB/POZ domain-containing protein BTBD11 | 9.29e-04 | NA | 0.040 |
| 3. B | Q9UI32 | Glutaminase liver isoform, mitochondrial | 7.32e-03 | NA | 7.33e-04 |
| 3. B | G0LXV8 | Alpha-latrotoxin-Lh1a (Fragment) | 1.92e-05 | NA | 4.96e-11 |
| 3. B | Q15027 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 | 3.93e-04 | NA | 8.22e-04 |
| 3. B | Q9Y566 | SH3 and multiple ankyrin repeat domains protein 1 | 6.68e-04 | NA | 4.76e-05 |
| 3. B | Q653P0 | Potassium channel KOR1 | 1.09e-05 | NA | 1.15e-08 |
| 3. B | Q6PFX9 | Poly [ADP-ribose] polymerase tankyrase-1 | 7.45e-06 | NA | 6.77e-17 |
| 3. B | Q9J5I3 | Putative ankyrin repeat protein FPV018 | NA | NA | 2.81e-08 |
| 3. B | Q2IBG0 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.26e-09 | NA | 7.45e-05 |
| 3. B | Q94B55 | Putative E3 ubiquitin-protein ligase XBAT31 | 5.53e-12 | NA | 9.41e-09 |
| 3. B | C7B178 | Protein VAPYRIN | 1.11e-16 | NA | 1.40e-11 |
| 3. B | Q5R4M7 | Ankyrin repeat and SOCS box protein 6 | 2.24e-09 | NA | 3.15e-05 |
| 3. B | Q875M2 | Palmitoyltransferase AKR1 | 1.08e-09 | NA | 2.88e-07 |
| 3. B | Q71S21 | Inversin-B | 2.48e-08 | NA | 4.58e-14 |
| 3. B | Q8VHK2 | Caskin-1 | 8.34e-07 | NA | 1.99e-09 |
| 3. B | Q9R172 | Neurogenic locus notch homolog protein 3 | 1.67e-05 | NA | 6.99e-08 |
| 3. B | Q29Q26 | Ankyrin repeat domain-containing protein 2B | 6.97e-05 | NA | 7.14e-06 |
| 3. B | Q5JPF3 | Ankyrin repeat domain-containing protein 36C | 1.15e-07 | NA | 1.78e-65 |
| 3. B | Q4P6L3 | Palmitoyltransferase AKR1 | 5.16e-08 | NA | 1.61e-08 |
| 3. B | Q9P0K7 | Ankycorbin | 3.51e-09 | NA | 6.50e-14 |
| 3. B | Q6DGX3 | Ankyrin repeat domain-containing protein 54 | 4.78e-05 | NA | 1.15e-05 |
| 3. B | Q7Z020 | Transient receptor potential cation channel subfamily A member 1 | 2.36e-05 | NA | 0.001 |
| 3. B | Q3V096 | Ankyrin repeat domain-containing protein 42 | 2.44e-10 | NA | 0.001 |
| 3. B | O13987 | Ankyrin and IPT/TIG repeat-containing protein C26H5.05 | 6.75e-02 | NA | 0.007 |
| 3. B | Q96AX9 | E3 ubiquitin-protein ligase MIB2 | 4.61e-06 | NA | 1.95e-09 |
| 3. B | A0A3L7I2I8 | 85/88 kDa calcium-independent phospholipase A2 | 7.14e-09 | NA | 8.54e-09 |
| 3. B | Q5DU14 | Unconventional myosin-XVI | 3.81e-04 | NA | 8.38e-09 |
| 3. B | Q86YR6 | POTE ankyrin domain family member D | 3.00e-15 | NA | 1.44e-68 |
| 3. B | Q923M0 | Protein phosphatase 1 regulatory subunit 16A | 2.88e-11 | NA | 0.041 |
| 3. B | Q6F3J0 | Nuclear factor NF-kappa-B p105 subunit | 4.80e-08 | NA | 1.55e-07 |
| 3. B | Q5UQY4 | Putative ankyrin repeat protein R886 (Fragment) | NA | NA | 5.97e-05 |
| 3. B | Q94527 | Nuclear factor NF-kappa-B p110 subunit | 1.54e-05 | NA | 0.002 |
| 3. B | Q8N9B4 | Ankyrin repeat domain-containing protein 42 | 1.65e-12 | NA | 0.005 |
| 3. B | G5EDE9 | ANK repeat-containing protein nipk-1 | 9.54e-09 | NA | 0.025 |
| 3. B | O00522 | Krev interaction trapped protein 1 | 6.77e-03 | NA | 0.012 |
| 3. B | Q07E28 | Cortactin-binding protein 2 | 7.61e-08 | NA | 0.002 |
| 3. B | Q5H9F3 | BCL-6 corepressor-like protein 1 | 3.01e-01 | NA | 3.35e-05 |
| 3. B | Q55A55 | Probable serine/threonine-protein kinase DDB_G0272092 | 1.78e-04 | NA | 1.09e-07 |
| 3. B | Q5TYW2 | Ankyrin repeat domain-containing protein 20A1 | 0.00e+00 | NA | 3.49e-113 |
| 3. B | Q5GIG6 | Serine/threonine-protein kinase TNNI3K | 1.47e-09 | NA | 3.38e-08 |
| 3. B | Q92625 | Ankyrin repeat and SAM domain-containing protein 1A | 1.80e-06 | NA | 1.58e-05 |
| 3. B | Q3UUF8 | Ankyrin repeat domain-containing protein 34B | 1.36e-07 | NA | 5.39e-04 |
| 3. B | Q09YI3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 9.79e-10 | NA | 1.49e-05 |
| 3. B | Q9J5I9 | Putative ankyrin repeat protein FPV012 | NA | NA | 4.34e-06 |
| 3. B | A0M8T5 | Cortactin-binding protein 2 | 9.39e-08 | NA | 0.001 |
| 3. B | Q5ZM55 | Protein fem-1 homolog B | 2.52e-13 | NA | 4.48e-09 |
| 3. B | Q2KI79 | Ankyrin repeat family A protein 2 | 9.09e-09 | NA | 2.09e-07 |
| 3. B | Q6UB98 | Ankyrin repeat domain-containing protein 12 | 9.50e-02 | NA | 4.33e-05 |
| 3. B | Q07E15 | Cortactin-binding protein 2 | 6.57e-08 | NA | 2.50e-04 |
| 3. B | Q9XZC0 | Alpha-latrocrustotoxin-Lt1a (Fragment) | 5.28e-05 | NA | 3.92e-11 |
| 3. B | Q94A76 | Potassium channel GORK | 9.84e-06 | NA | 1.32e-09 |
| 3. B | Q93650 | Putative glutaminase 3 | 8.00e-03 | NA | 2.53e-04 |
| 3. B | Q8N961 | Ankyrin repeat and BTB/POZ domain-containing protein 2 | 1.10e-04 | NA | 4.26e-04 |
| 3. B | O35516 | Neurogenic locus notch homolog protein 2 | 1.27e-03 | NA | 1.84e-06 |
| 3. B | Q755Y0 | Palmitoyltransferase AKR1 | 7.89e-09 | NA | 2.75e-09 |
| 3. B | Q03017 | NF-kappa-B inhibitor cactus | 8.84e-13 | NA | 4.11e-06 |
| 3. B | B8N0E6 | Ankyrin-repeat domain containing transcription coregulator asaA | 2.35e-05 | NA | 0.047 |
| 3. B | O75762 | Transient receptor potential cation channel subfamily A member 1 | 3.89e-05 | NA | 4.99e-09 |
| 3. B | Q5M9H0 | Ankyrin repeat and SAM domain-containing protein 3 | 2.93e-06 | NA | 1.02e-14 |
| 3. B | Q8VD46 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.32e-08 | NA | 2.64e-05 |
| 3. B | Q5UPA0 | Putative ankyrin repeat protein L25 | NA | NA | 0.005 |
| 3. B | Q6NY19 | KN motif and ankyrin repeat domain-containing protein 3 | 1.07e-05 | NA | 1.72e-05 |
| 3. B | P19838 | Nuclear factor NF-kappa-B p105 subunit | 4.11e-08 | NA | 1.32e-05 |
| 3. B | A0M8S4 | Cortactin-binding protein 2 | 9.74e-08 | NA | 1.04e-04 |
| 3. B | Q24145 | Tyrosine-protein kinase Shark | 8.58e-05 | NA | 2.61e-06 |
| 3. B | Q18297 | Transient receptor potential cation channel subfamily A member 1 homolog | 8.47e-06 | NA | 6.26e-11 |
| 3. B | E9Q4F7 | Ankyrin repeat domain-containing protein 11 | 2.68e-01 | NA | 8.62e-06 |
| 3. B | Q8WWH4 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 6.17e-12 | NA | 1.75e-04 |
| 3. B | Q1RJN6 | Putative ankyrin repeat protein RBE_0347 | 1.41e-05 | NA | 2.30e-04 |
| 3. B | A6QR20 | SMC5-SMC6 complex localization factor protein 1 | 2.31e-02 | NA | 0.002 |
| 3. B | P98150 | Nuclear factor NF-kappa-B p100 subunit | 2.28e-07 | NA | 5.15e-10 |
| 3. B | Q5RF15 | Serine/threonine-protein kinase TNNI3K | 1.16e-11 | NA | 2.21e-09 |
| 3. B | Q9VFD5 | Protein fem-1 homolog CG6966 | 3.49e-08 | NA | 5.38e-05 |
| 3. B | Q6P9K8 | Caskin-1 | 1.60e-05 | NA | 1.76e-09 |
| 3. B | Q7ZUV0 | Ankyrin repeat domain-containing protein 13C | 4.49e-05 | NA | 0.006 |
| 3. B | Q9BZL4 | Protein phosphatase 1 regulatory subunit 12C | 2.56e-08 | NA | 0.007 |
| 3. B | Q2IBA2 | Cortactin-binding protein 2 | 8.75e-08 | NA | 1.02e-04 |
| 3. B | Q3SWY2 | Integrin-linked protein kinase | 1.31e-06 | NA | 1.49e-09 |
| 3. B | A5PMU4 | Ankyrin repeat and sterile alpha motif domain-containing protein 1B | 2.03e-06 | NA | 2.00e-08 |
| 3. B | Q876A6 | Palmitoyltransferase AKR1 | 4.96e-08 | NA | 1.36e-09 |
| 3. B | Q96KQ7 | Histone-lysine N-methyltransferase EHMT2 | 1.28e-07 | NA | 2.52e-11 |
| 3. B | P25799 | Nuclear factor NF-kappa-B p105 subunit | 5.63e-08 | NA | 5.54e-05 |
| 3. B | Q99LW0 | Ankyrin repeat domain-containing protein 10 | 6.04e-10 | NA | 0.008 |
| 3. B | Q6GNY1 | E3 ubiquitin-protein ligase mib1 | 6.17e-08 | NA | 1.14e-16 |
| 3. B | Q5UPV1 | Putative ankyrin repeat protein L271 | NA | NA | 4.63e-07 |
| 3. B | Q9JLU4 | SH3 and multiple ankyrin repeat domains protein 3 | 2.14e-04 | NA | 3.60e-06 |
| 3. B | A2A2Z9 | Ankyrin repeat domain-containing protein 18B | 0.00e+00 | NA | 1.48e-169 |
| 3. B | Q9J5H7 | Putative ankyrin repeat protein FPV024 | NA | NA | 1.76e-09 |
| 3. B | Q09701 | Palmitoyltransferase akr1 | 5.00e-15 | NA | 1.08e-08 |
| 3. B | Q01705 | Neurogenic locus notch homolog protein 1 | 1.33e-03 | NA | 2.90e-09 |
| 3. B | Q9Z2G1 | Protein fem-1 homolog A-A | 3.90e-12 | NA | 8.04e-07 |
| 3. B | P0C550 | Potassium channel AKT1 | 9.72e-05 | NA | 3.19e-06 |
| 3. B | X1WE18 | KN motif and ankyrin repeat domain-containing protein 2 | 8.02e-04 | NA | 0.001 |
| 3. B | D3Z7P3 | Glutaminase kidney isoform, mitochondrial | 2.28e-02 | NA | 1.07e-05 |
| 3. B | Q8WXK1 | Ankyrin repeat and SOCS box protein 15 | 1.02e-09 | NA | 8.98e-07 |
| 3. B | Q2IBF8 | Cortactin-binding protein 2 | 9.26e-08 | NA | 0.003 |
| 3. B | Q2T9K6 | Protein fem-1 homolog C | 4.14e-08 | NA | 4.23e-08 |
| 3. B | Q9ULJ7 | Ankyrin repeat domain-containing protein 50 | 9.20e-06 | NA | 3.82e-14 |
| 3. B | Q07DX6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 7.75e-09 | NA | 1.14e-04 |
| 3. B | Q8VHK1 | Caskin-2 | 1.49e-06 | NA | 1.53e-08 |
| 3. B | Q9Y6X6 | Unconventional myosin-XVI | 2.26e-04 | NA | 1.87e-07 |
| 3. B | Q8K2H4 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 | 7.71e-04 | NA | 6.93e-04 |
| 3. B | P46531 | Neurogenic locus notch homolog protein 1 | 2.59e-03 | NA | 5.62e-09 |
| 3. B | Q2IBE6 | Cortactin-binding protein 2 | 1.44e-07 | NA | 1.62e-04 |
| 3. B | Q4V869 | Acyl-CoA-binding domain-containing protein 6 | 1.80e-05 | NA | 1.89e-08 |
| 3. B | Q09YG9 | Cortactin-binding protein 2 | 8.38e-06 | NA | 6.75e-04 |
| 3. B | Q8HXA6 | Ankyrin repeat and SOCS box protein 15 | 6.70e-10 | NA | 3.27e-06 |
| 3. B | Q0P5G1 | Tonsoku-like protein | 1.08e-02 | NA | 0.026 |
| 3. B | Q91ZU1 | Ankyrin repeat and SOCS box protein 6 | 8.87e-10 | NA | 0.001 |
| 3. B | Q52T38 | Protein S-acyltransferase 24 | 1.89e-13 | NA | 0.007 |
| 3. B | P0C6S7 | Ankyrin repeat and sterile alpha motif domain-containing protein 1B | 2.23e-06 | NA | 2.19e-06 |
| 3. B | Q96JP0 | Protein fem-1 homolog C | 6.62e-13 | NA | 6.81e-04 |
| 3. B | Q9C6C3 | ADP-ribosylation factor GTPase-activating protein AGD2 | 1.65e-02 | NA | 0.002 |
| 3. B | Q1RJ94 | Putative ankyrin repeat protein RBE_0489 | 1.04e-06 | NA | 0.022 |
| 3. B | F1N6G5 | E3 ubiquitin-protein ligase HACE1 | 1.49e-08 | NA | 3.51e-14 |
| 3. B | Q8NFD2 | Ankyrin repeat and protein kinase domain-containing protein 1 | 1.58e-08 | NA | 1.79e-14 |
| 3. B | Q9DF58 | Integrin-linked protein kinase | 1.23e-06 | NA | 3.65e-09 |
| 3. B | O60237 | Protein phosphatase 1 regulatory subunit 12B | 2.84e-06 | NA | 0.001 |
| 3. B | Q6NZL6 | Tonsoku-like protein | 9.89e-03 | NA | 0.015 |
| 3. B | Q9SMX5 | ADP-ribosylation factor GTPase-activating protein AGD4 | 1.23e-02 | NA | 0.014 |
| 3. B | Q1LZH7 | KN motif and ankyrin repeat domain-containing protein 2 | 5.52e-05 | NA | 3.05e-07 |
| 3. B | P17442 | Phosphate system positive regulatory protein PHO81 | 1.52e-05 | NA | 0.011 |
| 3. B | Q3UX43 | Ankyrin repeat domain-containing protein 13C | 1.80e-04 | NA | 0.037 |
| 3. B | A2VDR2 | Acyl-CoA-binding domain-containing protein 6 | 3.21e-05 | NA | 0.033 |
| 3. B | Q00PJ1 | Cortactin-binding protein 2 | 9.41e-08 | NA | 3.87e-04 |
| 3. B | Q54BA2 | Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 | 8.99e-08 | NA | 8.55e-10 |
| 3. B | Q9VCA8 | Ankyrin repeat and KH domain-containing protein mask | NA | NA | 7.19e-18 |
| 3. B | Q04861 | Nuclear factor NF-kappa-B p105 subunit | 7.94e-08 | NA | 3.67e-05 |
| 3. B | A2ARS0 | Ankyrin repeat domain-containing protein 63 | 3.01e-06 | NA | 3.69e-05 |
| 3. B | F1MJR8 | Inactive serine/threonine-protein kinase TEX14 | 1.36e-01 | NA | 8.58e-04 |
| 3. B | Q25338 | Delta-latroinsectotoxin-Lt1a | 2.46e-08 | NA | 7.26e-11 |
| 3. B | O94925 | Glutaminase kidney isoform, mitochondrial | 2.14e-02 | NA | 7.92e-06 |
| 3. B | Q9BXX3 | Ankyrin repeat domain-containing protein 30A | 5.46e-09 | NA | 5.45e-65 |
| 3. B | Q86YT6 | E3 ubiquitin-protein ligase MIB1 | 5.90e-08 | NA | 1.84e-16 |
| 3. B | Q94CT7 | Probable E3 ubiquitin-protein ligase XBOS31 | 2.99e-11 | NA | 8.42e-10 |
| 3. B | Q9TZC4 | Integrin-linked protein kinase homolog pat-4 | 1.08e-05 | NA | 6.55e-07 |
| 3. B | O89019 | Inversin | 1.27e-07 | NA | 6.18e-12 |
| 3. B | Q66JD7 | Acyl-CoA-binding domain-containing protein 6 | 2.48e-05 | NA | 4.21e-08 |
| 3. B | Q9J4Z8 | Putative ankyrin repeat protein FPV242 | NA | NA | 0.007 |
| 3. B | Q69ZU8 | Ankyrin repeat domain-containing protein 6 | 1.14e-09 | NA | 5.98e-13 |
| 3. B | Q8WMX8 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 6.05e-09 | NA | 1.29e-05 |
| 3. B | Q07DZ7 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.77e-07 | NA | 1.52e-05 |
| 3. B | Q0JKV1 | Potassium channel AKT1 | 6.63e-06 | NA | 3.10e-06 |
| 3. B | Q09YH1 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 5.07e-09 | NA | 2.85e-04 |
| 3. B | Q5UPG7 | Putative ankyrin repeat protein L91 | NA | NA | 1.28e-05 |
| 3. B | Q2IBB2 | Cortactin-binding protein 2 | 1.02e-05 | NA | 0.004 |
| 3. B | Q9EQG6 | Kinase D-interacting substrate of 220 kDa | 3.09e-04 | NA | 9.28e-15 |
| 3. B | Q5ZLC6 | Ankyrin repeat domain-containing protein 10 | 2.05e-11 | NA | 1.57e-04 |
| 3. B | P14368 | Putative ankyrin repeat protein FPV234 | NA | NA | 0.022 |
| 3. B | Q2QLG9 | Cortactin-binding protein 2 | 1.79e-07 | NA | 0.004 |
| 3. B | Q9J4Z6 | Putative ankyrin repeat protein FPV244 | NA | NA | 2.91e-12 |
| 3. B | Q9J5A7 | Putative ankyrin repeat protein FPV115 | NA | NA | 1.43e-08 |
| 3. B | Q5I1X5 | RelA-associated inhibitor | 6.07e-03 | NA | 0.008 |
| 3. B | B2RU33 | POTE ankyrin domain family member C | 0.00e+00 | NA | 9.80e-69 |
| 3. B | Q9UVH3 | Palmitoyltransferase AKR1 (Fragment) | 2.05e-05 | NA | 6.23e-07 |
| 3. B | Q07E17 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 4.20e-09 | NA | 1.24e-05 |
| 3. B | P0CG38 | POTE ankyrin domain family member I | 3.28e-10 | NA | 1.04e-68 |
| 3. B | A0JP26 | POTE ankyrin domain family member B3 | 1.11e-16 | NA | 1.06e-69 |
| 3. B | Q5UQF0 | Putative ankyrin repeat protein L484 | NA | NA | 0.050 |
| 3. B | O74205 | Transcription factor TOXE | 3.47e-04 | NA | 2.71e-04 |
| 3. B | Q09YJ5 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.60e-09 | NA | 8.71e-05 |
| 3. B | Q8WMX6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.81e-09 | NA | 1.85e-04 |
| 3. B | Q6S5H5 | POTE ankyrin domain family member G | 1.11e-16 | NA | 3.53e-72 |
| 3. B | Q5F478 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B | 2.27e-08 | NA | 3.08e-16 |
| 3. B | Q8K3X6 | Ankyrin repeat and SAM domain-containing protein 4B | 4.26e-09 | NA | 3.22e-06 |
| 3. B | Q9J507 | Putative ankyrin repeat protein FPV228 | NA | NA | 5.62e-10 |
| 3. B | Q7TQP6 | Serine/threonine-protein kinase TNNI3K | 5.28e-09 | NA | 2.31e-09 |
| 3. B | P0CS67 | Palmitoyltransferase AKR1 | 1.25e-08 | NA | 2.48e-10 |
| 3. B | Q9Z2G0 | Protein fem-1 homolog B | 1.59e-11 | NA | 6.60e-08 |
| 3. B | Q9XXH8 | Arf-GAP with ANK repeat and PH domain-containing protein cnt-1 | 5.04e-03 | NA | 0.019 |
| 3. B | G5E8K5 | Ankyrin-3 | 1.37e-04 | NA | 1.88e-14 |
| 3. B | Q4UJC0 | Putative ankyrin repeat protein RF_p42/RF_pd42 | 8.92e-11 | NA | 0.026 |
| 3. B | Q6DD51 | Caskin-2 | 4.83e-06 | NA | 1.16e-05 |
| 3. B | Q3TYA6 | M-phase phosphoprotein 8 | 7.38e-05 | NA | 0.003 |
| 3. B | P21783 | Neurogenic locus notch homolog protein 1 | 5.55e-05 | NA | 2.74e-08 |
| 3. B | Q8TF21 | Ankyrin repeat domain-containing protein 24 | 3.05e-07 | NA | 6.74e-07 |
| 3. B | A0A0A6YYL3 | POTE ankyrin domain family member B | 2.55e-15 | NA | 1.22e-69 |
| 3. B | A0A0R4IQZ2 | Putative palmitoyltransferase ZDHHC13 | 1.83e-11 | NA | 3.94e-12 |
| 3. B | Q96HA7 | Tonsoku-like protein | 2.17e-02 | NA | 0.050 |
| 3. B | Q5CZ79 | Ankyrin repeat domain-containing protein 20B | 0.00e+00 | NA | 2.20e-121 |
| 3. B | Q3KP44 | Ankyrin repeat domain-containing protein 55 | 1.02e-12 | NA | 3.61e-10 |
| 3. B | Q99549 | M-phase phosphoprotein 8 | 3.85e-04 | NA | 7.54e-04 |
| 3. B | Q54HC6 | Ankyrin repeat-containing protein kinase A | 9.59e-04 | NA | 0.002 |
| 3. B | Q10728 | Protein phosphatase 1 regulatory subunit 12A | 5.55e-06 | NA | 0.005 |
| 3. B | P07207 | Neurogenic locus Notch protein | NA | NA | 2.86e-10 |
| 3. B | Q07DV1 | Cortactin-binding protein 2 | 9.79e-06 | NA | 4.12e-04 |
| 3. B | Q9W0T5 | Transient receptor potential channel pyrexia | 3.84e-10 | NA | 3.44e-13 |
| 3. B | Q9CWU2 | Palmitoyltransferase ZDHHC13 | 5.25e-12 | NA | 1.19e-11 |
| 3. B | Q9NWX5 | Ankyrin repeat and SOCS box protein 6 | 3.45e-09 | NA | 5.20e-05 |
| 3. B | Q5W7F2 | ADP-ribosylation factor GTPase-activating protein AGD3 | 3.99e-02 | NA | 0.003 |
| 3. B | Q9STP8 | Acyl-CoA-binding domain-containing protein 2 | 2.08e-05 | NA | 2.28e-07 |
| 3. B | Q63ZY3 | KN motif and ankyrin repeat domain-containing protein 2 | 4.81e-05 | NA | 7.93e-07 |
| 3. B | Q07DX4 | Cortactin-binding protein 2 | 7.89e-06 | NA | 5.43e-05 |
| 3. B | Q8BLA8 | Transient receptor potential cation channel subfamily A member 1 | 2.35e-06 | NA | 3.21e-09 |
| 3. B | Q8H569 | Potassium channel AKT3 | 9.92e-05 | NA | 2.71e-05 |
| 3. B | O73630 | Nuclear factor NF-kappa-B p100 subunit | 1.53e-06 | NA | 1.32e-07 |
| 3. B | A6NI47 | Putative POTE ankyrin domain family member M | 0.00e+00 | NA | 2.18e-72 |
| 3. B | Q5UQV3 | Putative ankyrin repeat protein L371 | NA | NA | 1.06e-11 |
| 3. B | Q6C520 | Palmitoyltransferase AKR1 | 6.97e-09 | NA | 9.22e-05 |
| 3. B | Q2QLA2 | Cortactin-binding protein 2 | 6.29e-08 | NA | 7.86e-04 |
| 3. B | O75179 | Ankyrin repeat domain-containing protein 17 | 8.04e-04 | NA | 1.40e-18 |
| 3. B | Q86AT8 | Stress-activated protein kinase alpha | 6.90e-12 | NA | 1.54e-07 |
| 3. B | Q5ZMD2 | Ankyrin repeat and MYND domain-containing protein 2 | 8.65e-07 | NA | 0.041 |
| 3. B | Q09YM8 | Cortactin-binding protein 2 | 8.77e-08 | NA | 0.005 |
| 3. B | Q9WTK5 | Nuclear factor NF-kappa-B p100 subunit | 6.11e-08 | NA | 1.22e-07 |
| 3. B | Q6GPE5 | Protein fem-1 homolog B | 1.78e-15 | NA | 2.16e-08 |
| 3. B | Q8WXE0 | Caskin-2 | 1.55e-06 | NA | 4.12e-08 |
| 3. B | Q4R690 | Palmitoyltransferase ZDHHC13 | 2.38e-12 | NA | 1.82e-11 |
| 3. B | Q07E30 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 3.15e-09 | NA | 2.62e-06 |
| 3. B | Q5DW34 | Histone-lysine N-methyltransferase EHMT1 | 5.19e-07 | NA | 3.77e-11 |
| 3. B | Q80YE7 | Death-associated protein kinase 1 | 3.28e-06 | NA | 3.39e-16 |
| 3. B | Q5URB8 | Putative ankyrin repeat protein R841 | NA | NA | 0.004 |
| 3. B | Q5UPG0 | Putative ankyrin repeat protein L86 | NA | NA | 2.01e-06 |
| 3. B | E9PTT0 | Palmitoyltransferase ZDHHC17 | 7.86e-13 | NA | 8.23e-15 |
| 3. B | P0DJE3 | Alpha-latrotoxin-Lhe1a | 3.93e-07 | NA | 1.13e-09 |
| 3. B | O00221 | NF-kappa-B inhibitor epsilon | 9.36e-13 | NA | 3.54e-05 |
| 3. B | Q2IBF5 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.74e-09 | NA | 1.83e-04 |
| 3. B | Q9VSA4 | Tonsoku-like protein | 4.38e-02 | NA | 0.032 |
| 3. B | Q3UYR4 | Espin-like protein | 3.00e-09 | NA | 0.031 |
| 3. B | Q8IWZ3 | Ankyrin repeat and KH domain-containing protein 1 | 3.72e-04 | NA | 9.54e-18 |
| 3. B | Q4V890 | Protein fem-1 homolog A | 7.87e-13 | NA | 7.41e-07 |
| 3. B | Q8IVF6 | Ankyrin repeat domain-containing protein 18A | 0.00e+00 | NA | 1.27e-165 |
| 3. B | Q9J5H5 | Putative ankyrin repeat protein FPV026 | NA | NA | 2.32e-09 |
| 3. B | Q9J4Z4 | Putative ankyrin repeat protein FPV246 | NA | NA | 1.47e-13 |
| 3. B | A6NC57 | Ankyrin repeat domain-containing protein 62 | 2.66e-15 | NA | 7.49e-80 |
| 3. B | Q4ACU6 | SH3 and multiple ankyrin repeat domains protein 3 | 3.94e-04 | NA | 3.60e-06 |
| 3. B | Q6TNJ1 | Krev interaction trapped protein 1 | 5.06e-03 | NA | 0.026 |
| 3. B | Q8C6Y6 | Ankyrin repeat and SOCS box protein 14 | 5.17e-12 | NA | 6.32e-09 |
| 3. B | Q54F46 | Homeobox protein Wariai | 8.19e-08 | NA | 7.03e-09 |
| 3. B | Q108T9 | Cortactin-binding protein 2 | 9.06e-08 | NA | 2.76e-04 |
| 3. B | Q9ET47 | Espin | 4.30e-08 | NA | 0.003 |
| 3. B | Q9GKW8 | Ankyrin repeat and death domain-containing protein 1A (Fragment) | 2.23e-13 | NA | 1.64e-11 |
| 3. B | Q05921 | 2-5A-dependent ribonuclease | 1.96e-08 | NA | 2.66e-09 |
| 3. B | Q5ZIJ9 | E3 ubiquitin-protein ligase MIB2 | 1.97e-07 | NA | 4.62e-09 |
| 3. B | Q07DV3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.54e-08 | NA | 3.54e-04 |
| 3. B | Q80VM7 | Ankyrin repeat domain-containing protein 24 | 1.50e-08 | NA | 1.61e-09 |
| 3. B | Q1RHT6 | Putative ankyrin repeat protein RBE_0997 | 2.44e-11 | NA | 1.72e-08 |
| 3. B | Q02979 | Glycerophosphocholine phosphodiesterase GDE1 | 8.38e-04 | NA | 1.68e-05 |
| 3. B | Q505D1 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A | 1.08e-07 | NA | 4.76e-17 |
| 3. B | O90760 | Putative ankyrin repeat protein FPV031 | NA | NA | 2.10e-08 |
| 3. B | Q8IUH4 | Palmitoyltransferase ZDHHC13 | 1.06e-11 | NA | 3.48e-11 |
| 3. B | P81069 | GA-binding protein subunit beta-2 | 6.05e-14 | NA | 4.97e-06 |
| 3. B | Q54GC8 | Acyl-CoA-binding domain-containing protein 6 homolog | 7.31e-07 | NA | 7.12e-04 |
| 3. B | Q9UPS8 | Ankyrin repeat domain-containing protein 26 | 2.19e-05 | NA | 5.26e-63 |
| 3. B | Q9VUW9 | Palmitoyltransferase Hip14 | 6.03e-09 | NA | 1.56e-06 |
| 3. B | Q9NXR5 | Ankyrin repeat domain-containing protein 10 | 5.76e-10 | NA | 0.005 |
| 3. B | Q00420 | GA-binding protein subunit beta-1 | 9.24e-14 | NA | 1.58e-08 |
| 3. B | Q6NLQ8 | E3 ubiquitin-protein ligase XBAT32 | 1.60e-09 | NA | 8.93e-04 |
| 3. B | Q9J508 | Putative ankyrin repeat protein FPV227 | NA | NA | 2.76e-07 |
| 3. B | Q1RI12 | Putative ankyrin repeat protein RBE_0921 | 6.29e-08 | NA | 4.32e-06 |
| 3. B | A4D7T3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.29e-07 | NA | 4.51e-08 |
| 3. B | Q8R516 | E3 ubiquitin-protein ligase MIB2 | 6.62e-08 | NA | 4.51e-09 |
| 3. B | Q5ZXN6 | Phosphocholine transferase AnkX | 4.11e-06 | NA | 0.030 |
| 3. B | Q8BG95 | Protein phosphatase 1 regulatory subunit 12B | 2.76e-06 | NA | 7.85e-04 |
| 3. B | Q13418 | Integrin-linked protein kinase | 9.57e-07 | NA | 2.18e-09 |
| 3. B | P83757 | NF-kappa-B inhibitor cactus | NA | NA | 0.004 |
| 3. B | Q9C0D5 | Protein TANC1 | 4.28e-04 | NA | 2.01e-08 |
| 3. B | Q9Z1P7 | KN motif and ankyrin repeat domain-containing protein 3 | 4.35e-06 | NA | 0.005 |
| 3. B | Q9J516 | Putative ankyrin repeat protein FPV219 | NA | NA | 5.02e-04 |
| 3. B | Q6ZQK5 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 | 2.91e-03 | NA | 4.63e-04 |
| 3. B | Q07DZ5 | Cortactin-binding protein 2 | 4.39e-08 | NA | 7.57e-04 |
| 3. B | Q09YN0 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 9.90e-09 | NA | 5.53e-06 |
| 3. B | Q2TXF6 | Ankyrin repeat domain-containing protein oryK | 4.50e-06 | NA | 0.013 |
| 3. B | D3YZU1 | SH3 and multiple ankyrin repeat domains protein 1 | 7.23e-04 | NA | 9.65e-06 |
| 3. B | Q02989 | Alpha-latroinsectotoxin-Lt1a (Fragment) | 8.00e-08 | NA | 8.48e-12 |
| 3. B | Q1LVW0 | Ankyrin repeat and BTB/POZ domain-containing protein BTBD11-A | 7.02e-04 | NA | 0.006 |
| 3. B | Q60J38 | Ankyrin repeat and KH domain-containing protein CBG24701 | 6.60e-03 | NA | 1.85e-09 |
| 3. B | D3ZD05 | KN motif and ankyrin repeat domain-containing protein 2 | 4.59e-05 | NA | 1.79e-07 |
| 3. B | Q8T2Q0 | Putative ZDHHC-type palmitoyltransferase 6 | 1.36e-08 | NA | 5.59e-07 |
| 3. B | B2RXR6 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B | 2.60e-07 | NA | 2.32e-17 |
| 3. B | Q502K3 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 3.42e-08 | NA | 2.34e-17 |
| 3. B | Q66H07 | Fibronectin type 3 and ankyrin repeat domains 1 protein | 0.00e+00 | NA | 5.49e-11 |
| 3. B | Q9C104 | Glycerophosphocholine phosphodiesterase gde1 | 3.18e-04 | NA | 7.52e-05 |
| 3. B | Q571F8 | Glutaminase liver isoform, mitochondrial | 2.72e-02 | NA | 0.001 |
| 3. B | Q7M6U3 | Inactive serine/threonine-protein kinase TEX14 | 7.84e-02 | NA | 0.006 |
| 3. B | Q9EP71 | Ankycorbin | 2.89e-09 | NA | 9.02e-15 |
| 3. B | Q9FIT8 | ADP-ribosylation factor GTPase-activating protein AGD1 | 3.44e-02 | NA | 1.63e-05 |
| 3. B | Q5PQ89 | Ankyrin repeat domain-containing protein 34B | 2.18e-07 | NA | 3.76e-05 |
| 3. B | Q8HYY4 | Uveal autoantigen with coiled-coil domains and ankyrin repeats protein | 2.87e-07 | NA | 1.19e-13 |
| 3. B | Q05753 | Ankyrin repeat domain-containing protein, chloroplastic | 6.12e-07 | NA | 3.87e-11 |
| 3. B | Q2QLB3 | Cortactin-binding protein 2 | 1.20e-07 | NA | 0.002 |
| 3. B | Q6UB99 | Ankyrin repeat domain-containing protein 11 | 2.68e-01 | NA | 5.54e-06 |
| 3. B | O55222 | Integrin-linked protein kinase | 1.14e-06 | NA | 2.18e-09 |
| 3. B | Q9J569 | Putative ankyrin repeat protein FPV162 | NA | NA | 1.43e-07 |
| 3. B | Q969K4 | Ankyrin repeat and BTB/POZ domain-containing protein 1 | 2.14e-02 | NA | 0.047 |
| 3. B | Q08DV6 | Ankyrin repeat and SOCS box protein 3 | 1.27e-12 | NA | 6.42e-07 |
| 3. B | Q9SAR5 | Ankyrin repeat domain-containing protein 2A | 1.09e-05 | NA | 9.29e-07 |
| 3. B | Q4V8X4 | Acyl-CoA-binding domain-containing protein 6 | 4.43e-05 | NA | 2.70e-07 |
| 3. B | Q04721 | Neurogenic locus notch homolog protein 2 | 3.01e-04 | NA | 1.84e-06 |
| 3. B | Q09YI1 | Cortactin-binding protein 2 | 4.14e-08 | NA | 4.55e-04 |
| 3. B | Q9C7A2 | Ankyrin repeat-containing protein ITN1 | 1.79e-09 | NA | 5.95e-05 |
| 3. B | Q3UMT1 | Protein phosphatase 1 regulatory subunit 12C | 3.82e-08 | NA | 0.004 |
| 3. B | O15084 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A | 1.03e-07 | NA | 8.22e-17 |
| 3. B | Q5NVB9 | Palmitoyltransferase ZDHHC13 | 1.49e-12 | NA | 3.39e-11 |
| 3. B | P0DST0 | Ankyrin repeat protein B4 | NA | NA | 0.016 |
| 3. B | Q9J4Z5 | Putative ankyrin repeat protein FPV245 | NA | NA | 3.84e-11 |
| 3. B | Q8BTI7 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 1.27e-07 | NA | 1.10e-14 |
| 3. B | Q6P9Z4 | Protein fem-1 homolog A | 1.11e-12 | NA | 1.43e-06 |
| 3. B | Q9QW30 | Neurogenic locus notch homolog protein 2 | 2.62e-05 | NA | 1.84e-06 |
| 3. B | Q6GQX6 | Ankyrin repeat and SAM domain-containing protein 6 | 7.10e-10 | NA | 2.25e-06 |
| 3. B | Q108U1 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 5.13e-09 | NA | 6.13e-05 |
| 3. B | Q86U10 | 60 kDa lysophospholipase | 6.82e-05 | NA | 0.019 |
| 3. B | Q60649 | Caseinolytic peptidase B protein homolog | 1.48e-03 | NA | 5.92e-05 |
| 3. B | Q2IBB1 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.62e-09 | NA | 6.18e-05 |
| 3. B | Q6IVG4 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 | 2.77e-03 | NA | 5.35e-04 |
| 3. B | Q59H18 | Serine/threonine-protein kinase TNNI3K | 1.07e-09 | NA | 5.54e-09 |
| 3. B | Q9SM23 | Acyl-CoA-binding domain-containing protein 1 | 4.39e-06 | NA | 2.84e-06 |
| 3. B | Q8VHQ3 | Protein phosphatase 1 regulatory inhibitor subunit 16B | 1.27e-10 | NA | 0.002 |
| 3. B | Q99PE2 | Ankyrin repeat family A protein 2 | 3.69e-09 | NA | 2.42e-07 |
| 3. B | Q9BSK4 | Protein fem-1 homolog A | 8.11e-12 | NA | 3.06e-06 |
| 3. B | Q9H9B1 | Histone-lysine N-methyltransferase EHMT1 | 3.27e-07 | NA | 2.37e-11 |
| 3. B | A0JNU3 | 60 kDa lysophospholipase | 3.31e-05 | NA | 1.06e-04 |
| 3. B | Q28BK1 | E3 ubiquitin-protein ligase HACE1 | 4.92e-08 | NA | 9.82e-14 |
| 3. B | Q9J5I7 | Putative ankyrin repeat protein FPV014 | NA | NA | 5.32e-07 |
| 3. B | H3BUK9 | POTE ankyrin domain family member B2 | 2.22e-16 | NA | 1.22e-69 |
| 3. B | Q9BZF9 | Uveal autoantigen with coiled-coil domains and ankyrin repeats | 1.36e-10 | NA | 1.05e-13 |
| 3. B | Q9DAM9 | Fibronectin type 3 and ankyrin repeat domains 1 protein | 0.00e+00 | NA | 6.38e-11 |
| 3. B | Q8N283 | Ankyrin repeat domain-containing protein 35 | 4.00e-12 | NA | 2.39e-17 |
| 3. B | Q1RJR4 | Putative ankyrin repeat protein RBE_0319 | 9.48e-07 | NA | 5.38e-08 |
| 3. B | O60733 | 85/88 kDa calcium-independent phospholipase A2 | 4.68e-09 | NA | 5.43e-11 |
| 3. B | Q810B6 | Rabankyrin-5 | 2.00e-05 | NA | 2.76e-10 |
| 3. B | Q9ERK0 | Receptor-interacting serine/threonine-protein kinase 4 | 2.49e-08 | NA | 5.41e-09 |
| 3. B | Q9J517 | Putative ankyrin repeat protein FPV218 | NA | NA | 8.70e-11 |
| 3. B | Q12955 | Ankyrin-3 | NA | NA | 7.56e-15 |
| 3. B | Q09YJ3 | Cortactin-binding protein 2 | 7.35e-08 | NA | 1.91e-04 |
| 3. B | Q6TNT2 | Ankyrin repeat domain-containing protein 46 | 1.31e-06 | NA | 0.027 |
| 3. B | Q8C0T1 | Protein fem-1 homolog A-B | 1.94e-11 | NA | 6.00e-06 |
| 3. B | A2RUV0 | Neurogenic locus notch homolog protein 1 | 4.61e-04 | NA | 6.15e-07 |
| 3. B | Q38998 | Potassium channel AKT1 | 5.58e-05 | NA | 5.27e-07 |
| 3. B | Q80TN5 | Palmitoyltransferase ZDHHC17 | 1.78e-15 | NA | 6.31e-15 |
| 3. B | Q54LF0 | NAD-dependent deacetylase sir2B | 4.53e-11 | NA | 3.45e-04 |
| 3. B | C9JTQ0 | Ankyrin repeat domain-containing protein 63 | 2.61e-06 | NA | 4.09e-05 |
| 3. B | Q7S3M5 | Palmitoyltransferase akr1 | 4.09e-09 | NA | 4.92e-09 |
| 3. B | Q9BQI6 | SMC5-SMC6 complex localization factor protein 1 | 1.97e-02 | NA | 0.004 |
| 3. B | Q7Z6G8 | Ankyrin repeat and sterile alpha motif domain-containing protein 1B | 1.71e-06 | NA | 1.37e-06 |
| 3. B | Q99LJ2 | Ankyrin repeat and BTB/POZ domain-containing protein 1 | 5.11e-03 | NA | 0.050 |
| 3. B | A5PLL1 | Ankyrin repeat domain-containing protein 34B | 7.90e-07 | NA | 0.004 |
| 3. B | Q5R5V4 | Integrin-linked protein kinase | 1.29e-06 | NA | 2.02e-09 |
| 3. B | Q4UKX2 | Putative ankyrin repeat protein RF_0950 | 5.22e-15 | NA | 4.93e-05 |
| 3. B | F1M5M3 | Inactive serine/threonine-protein kinase TEX14 | NA | NA | 0.012 |
| 3. B | Q6ZW76 | Ankyrin repeat and SAM domain-containing protein 3 | 2.31e-06 | NA | 2.25e-14 |
| 3. B | Q2IBB4 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.87e-09 | NA | 1.62e-05 |
| 3. B | Q9BYB0 | SH3 and multiple ankyrin repeat domains protein 3 | 3.87e-04 | NA | 1.22e-05 |
| 3. B | Q9TZM3 | Leucine-rich repeat serine/threonine-protein kinase 1 | 2.62e-03 | NA | 0.012 |
| 3. B | P31695 | Neurogenic locus notch homolog protein 4 | 5.30e-05 | NA | 8.40e-09 |
| 3. B | Q8GXE6 | Potassium channel AKT6 | 5.27e-05 | NA | 7.97e-09 |
| 3. B | A0A140LI88 | Ankyrin repeat domain-containing protein 31 | 5.45e-02 | NA | 2.91e-06 |
| 3. B | Q9N3Q8 | Dauer abnormal formation protein 25 | 2.70e-05 | NA | 0.016 |
| 3. B | Q5E9N5 | Caseinolytic peptidase B protein homolog | 3.17e-03 | NA | 1.69e-04 |
| 3. B | Q09YK4 | Cortactin-binding protein 2 | 9.35e-08 | NA | 0.005 |
| 3. B | Q8C8R3 | Ankyrin-2 | NA | NA | 3.98e-15 |
| 3. B | E1C656 | E3 ubiquitin-protein ligase HACE1 | 1.22e-07 | NA | 5.09e-15 |
| 3. B | Q6F6B3 | Protein TANC1 | 3.48e-04 | NA | 2.77e-08 |
| 3. B | Q8N8V4 | Ankyrin repeat and SAM domain-containing protein 4B | 3.52e-09 | NA | 3.00e-05 |
| 3. B | Q07DY6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.63e-09 | NA | 7.68e-04 |
| 3. B | P40480 | Protein HOS4 | 3.72e-05 | NA | 0.025 |
| 3. B | Q9H9E1 | Ankyrin repeat family A protein 2 | 3.54e-11 | NA | 3.00e-07 |
| 3. B | Q6NXT1 | Ankyrin repeat domain-containing protein 54 | 4.69e-06 | NA | 5.39e-08 |
| 3. B | Q8BIZ1 | Ankyrin repeat and sterile alpha motif domain-containing protein 1B | 3.15e-06 | NA | 1.52e-06 |
| 3. B | Q6AWW5 | Ankyrin repeat-containing protein At5g02620 | 1.40e-10 | NA | 3.22e-06 |
| 3. B | Q9QZH2 | BRCA1-associated RING domain protein 1 | 5.30e-03 | NA | 2.76e-07 |
| 3. B | Q5T7N3 | KN motif and ankyrin repeat domain-containing protein 4 | 5.24e-04 | NA | 1.79e-04 |
| 3. B | Q92HB1 | Putative ankyrin repeat protein RC0860 | 9.75e-05 | NA | 0.002 |
| 3. B | Q07E43 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 4.61e-10 | NA | 6.48e-05 |
| 3. B | Q54HT1 | Protein tirA | 5.05e-03 | NA | 1.86e-05 |
| 3. B | Q96P50 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 3 | 6.05e-03 | NA | 0.012 |
| 3. B | Q9J503 | Putative ankyrin repeat protein FPV232 | NA | NA | 2.59e-07 |
| 3. B | Q99728 | BRCA1-associated RING domain protein 1 | 4.76e-03 | NA | 1.96e-06 |
| 3. B | P97570 | 85/88 kDa calcium-independent phospholipase A2 | 4.78e-09 | NA | 6.18e-07 |
| 3. B | Q6S8J7 | POTE ankyrin domain family member A | 0.00e+00 | NA | 1.10e-80 |
| 3. B | Q3UMR0 | Ankyrin repeat domain-containing protein 27 | 2.56e-05 | NA | 1.44e-09 |
| 3. B | Q07008 | Neurogenic locus notch homolog protein 1 | 6.05e-04 | NA | 2.82e-09 |
| 3. B | A3AYR1 | Acyl-CoA-binding domain-containing protein 4 | 2.08e-06 | NA | 2.54e-08 |
| 3. B | Q9H078 | Caseinolytic peptidase B protein homolog | 5.90e-03 | NA | 0.013 |
| 3. B | Q811D2 | Ankyrin repeat domain-containing protein 26 | 1.41e-03 | NA | 1.03e-57 |
| 3. B | Q07DY4 | Cortactin-binding protein 2 | 6.42e-08 | NA | 9.82e-05 |
| 3. B | Q9HCD6 | Protein TANC2 | 2.13e-03 | NA | 6.75e-09 |
| 3. B | A1X157 | Cortactin-binding protein 2 | 2.32e-07 | NA | 0.002 |
| 3. B | Q6S545 | POTE ankyrin domain family member H | 1.11e-16 | NA | 1.61e-72 |
| 3. B | Q9GL21 | Uveal autoantigen with coiled-coil domains and ankyrin repeats | 1.54e-07 | NA | 2.78e-14 |
| 3. B | Q9Z148 | Histone-lysine N-methyltransferase EHMT2 | 2.21e-07 | NA | 1.01e-10 |
| 3. B | Q1RK13 | Putative ankyrin repeat protein RBE_0220 | 7.06e-08 | NA | 1.98e-13 |
| 3. B | Q54XX5 | Probable serine/threonine-protein kinase DDB_G0278535 | 1.14e-09 | NA | 2.32e-09 |
| 3. B | Q9CZK6 | Ankyrin repeat and SAM domain-containing protein 3 | 1.68e-06 | NA | 2.44e-14 |
| 3. B | Q5UPF8 | Putative ankyrin repeat protein L88 | NA | NA | 1.05e-10 |
| 3. B | Q8TAK5 | GA-binding protein subunit beta-2 | 2.42e-12 | NA | 3.35e-06 |
| 3. B | Q99J82 | Integrin-linked protein kinase | 8.77e-07 | NA | 2.18e-09 |
| 3. B | Q2IBF7 | Cortactin-binding protein 2 | 3.77e-06 | NA | 1.15e-04 |
| 3. B | Q2QLF8 | Cortactin-binding protein 2 | 1.01e-05 | NA | 5.85e-04 |
| 3. B | Q71S22 | Inversin-A | 2.53e-08 | NA | 6.40e-11 |
| 3. B | Q5XIU1 | Ankyrin repeat and BTB/POZ domain-containing protein 1 | 5.49e-03 | NA | 0.049 |
| 3. B | A0M8T3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.33e-08 | NA | 3.11e-05 |
| 3. B | Q4UMH6 | Putative ankyrin repeat protein RF_0381 | 1.52e-07 | NA | 1.46e-13 |
| 3. B | P53355 | Death-associated protein kinase 1 | 3.80e-06 | NA | 6.95e-18 |
| 3. B | Q804S5 | E3 ubiquitin-protein ligase mib1 | 1.65e-07 | NA | 2.53e-16 |
| 3. B | Q8IYU2 | E3 ubiquitin-protein ligase HACE1 | 7.60e-08 | NA | 9.90e-14 |
| 3. B | Q875S9 | Palmitoyltransferase AKR1 | 8.66e-08 | NA | 6.62e-11 |
| 3. B | P0CS66 | Palmitoyltransferase AKR1 | 4.35e-08 | NA | 2.48e-10 |
| 3. B | Q8NB46 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 8.22e-07 | NA | 6.44e-15 |
| 3. B | P21001 | Ankyrin repeat protein B4 | NA | NA | 1.01e-04 |
| 3. B | Q5REW9 | Ankyrin repeat domain-containing protein 27 | 2.57e-05 | NA | 1.18e-09 |
| 3. B | Q6JAN1 | Inversin | 7.38e-08 | NA | 4.96e-12 |
| 3. B | G3V8T1 | M-phase phosphoprotein 8 | 9.14e-04 | NA | 0.003 |
| 3. B | F4IS56 | Integrin-linked protein kinase 1 | 7.63e-03 | NA | 0.015 |
| 3. B | Q5RJK8 | Acyl-CoA-binding domain-containing protein 6 | 4.25e-06 | NA | 0.006 |
| 3. B | D3ZBM7 | E3 ubiquitin-protein ligase HACE1 | 7.57e-08 | NA | 1.47e-13 |
| 3. B | Q9J5G9 | Putative ankyrin repeat protein FPV034 | NA | NA | 2.75e-07 |
| 3. B | Q2QLA4 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.04e-07 | NA | 1.37e-05 |
| 3. B | P23631 | Alpha-latrotoxin-Lt1a | 6.19e-06 | NA | 1.38e-09 |
| 3. B | P39010 | Palmitoyltransferase AKR1 | 4.61e-08 | NA | 1.56e-06 |
| 3. B | Q8WXD9 | Caskin-1 | 8.54e-06 | NA | 3.55e-10 |
| 3. B | Q8R560 | Ankyrin repeat domain-containing protein 1 | 1.02e-11 | NA | 1.18e-09 |
| 3. B | Q9FY48 | E3 ubiquitin-protein ligase KEG | 7.27e-04 | NA | 1.80e-05 |
| 3. B | A0A084B9Z8 | Ankyrin repeat domain-containing protein SAT10 | 4.64e-03 | NA | 8.85e-05 |
| 3. B | Q8WZ74 | Cortactin-binding protein 2 | 8.58e-08 | NA | 1.15e-04 |
| 3. B | Q3EC11 | Probable protein S-acyltransferase 23 | 2.01e-14 | NA | 1.95e-04 |
| 3. B | Q8BLD6 | Ankyrin repeat domain-containing protein 55 | 1.24e-12 | NA | 4.71e-10 |
| 3. B | Q5B0V6 | Palmitoyltransferase akr1 | 6.04e-11 | NA | 5.61e-09 |
| 3. B | Q6DRG7 | Protein phosphatase 1 regulatory subunit 12A | 6.10e-06 | NA | 6.34e-04 |
| 3. B | Q9VBP3 | Poly [ADP-ribose] polymerase tankyrase | 6.74e-06 | NA | 6.14e-15 |
| 3. B | Q6DCL5 | E3 ubiquitin-protein ligase HACE1 | 7.45e-08 | NA | 9.81e-14 |
| 3. B | Q9BR61 | Acyl-CoA-binding domain-containing protein 6 | 1.85e-06 | NA | 0.049 |
| 3. B | Q2QL82 | Cortactin-binding protein 2 | 1.07e-07 | NA | 2.39e-04 |
| 3. B | Q96NW4 | Ankyrin repeat domain-containing protein 27 | 2.15e-05 | NA | 2.20e-11 |