Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
Q6AYQ0
(PDZ domain-containing protein MAGIX) with a FATCAT P-Value: 3.06e-06 and RMSD of 4.33 angstrom. The sequence alignment identity is 62.9%.
Structural alignment shown in left. Query protein Q9H6Y5 colored as red in alignment, homolog Q6AYQ0 colored as blue.
Query protein Q9H6Y5 is also shown in right top, homolog Q6AYQ0 showed in right bottom. They are colored based on secondary structures.
Q9H6Y5 MEPRTGDAADPRGSRGGRGPSPLAG---PSARQLLARLDARPLAARAAVDVAALVRRAGATLRLRRKEAVSVLDSADIEVTDSRLPHATIVDHRPQHRWL 97 Q6AYQ0 MDSHAGNTADPRGSRRGVG---LQGSGSPRARQLLERLDARPLAARAAADLSALVRKAGATLRLRHKEAISGLDSADIEVADSRLPHATLVEHRPQHQRS 97 Q9H6Y5 ETCNAP---P-QLIQGKARSAPK-PSQASGHFSVELVRGYAGFGLTLGGGRDVAGDTPLAVRGLLKDGPAQRCGRLEVGDLVLHINGESTQGLTHAQAVE 192 Q6AYQ0 DT-QGPRMEPLPVIQNKASYASRLP-QATGRFSVELVRGPAGFGLTLSGGRNVSGNVPLAVCGLLKDGPAQRCGHLQAGDLVLYINGQSTRGLTHAQAVE 195 Q9H6Y5 RIRAGGPQLHLVIRRPLETHPG---KPRGVGEPRKGVVPSWPDRSPDP-GGPEVTGSRSSSTSLVQHPPSRTTLKKTR-GSPEPSPEAAADGPTVSPPER 287 Q6AYQ0 WIRTGGPRLCLVLQRPQEMN-GSRSKEVGGGH-QK------TDRIPDPRGG-RMMESR-GTISPVHHRP------KTRTG-PGPSPESVATGHVVRAAEH 278 Q9H6Y5 RAEDPNDQIPGSPGPWLVPSEERLSRALGVR-GAAQLAQEMAAGRRRH 334 Q6AYQ0 PAEDLEDRIPGSPGPWLVPSEDRLSRALGIRGGGVQLAQEMAAGRRRH 326
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0005902 | microvillus |
| 1. PB | GO:0016055 | Wnt signaling pathway |
| 1. PB | GO:0043198 | dendritic shaft |
| 1. PB | GO:0098797 | plasma membrane protein complex |
| 1. PB | GO:0070851 | growth factor receptor binding |
| 1. PB | GO:0035089 | establishment of apical/basal cell polarity |
| 1. PB | GO:0045177 | apical part of cell |
| 1. PB | GO:0051898 | negative regulation of protein kinase B signaling |
| 1. PB | GO:0005080 | protein kinase C binding |
| 1. PB | GO:0034635 | glutathione transport |
| 1. PB | GO:0045121 | membrane raft |
| 1. PB | GO:2000146 | negative regulation of cell motility |
| 1. PB | GO:0090090 | negative regulation of canonical Wnt signaling pathway |
| 1. PB | GO:0060158 | phospholipase C-activating dopamine receptor signaling pathway |
| 1. PB | GO:0007605 | sensory perception of sound |
| 1. PB | GO:0032421 | stereocilium bundle |
| 1. PB | GO:0012505 | endomembrane system |
| 1. PB | GO:0032782 | bile acid secretion |
| 1. PB | GO:0007191 | adenylate cyclase-activating dopamine receptor signaling pathway |
| 1. PB | GO:0032420 | stereocilium |
| 1. PB | GO:0022612 | gland morphogenesis |
| 1. PB | GO:0007268 | chemical synaptic transmission |
| 1. PB | GO:0007163 | establishment or maintenance of cell polarity |
| 1. PB | GO:0001726 | ruffle |
| 1. PB | GO:0007097 | nuclear migration |
| 1. PB | GO:0098978 | glutamatergic synapse |
| 1. PB | GO:2001244 | positive regulation of intrinsic apoptotic signaling pathway |
| 1. PB | GO:0030336 | negative regulation of cell migration |
| 1. PB | GO:0016020 | membrane |
| 1. PB | GO:0030175 | filopodium |
| 1. PB | GO:0016324 | apical plasma membrane |
| 1. PB | GO:0097120 | receptor localization to synapse |
| 1. PB | GO:0031528 | microvillus membrane |
| 1. PB | GO:0031526 | brush border membrane |
| 1. PB | GO:0030036 | actin cytoskeleton organization |
| 1. PB | GO:0065003 | protein-containing complex assembly |
| 1. PB | GO:0030033 | microvillus assembly |
| 1. PB | GO:0045930 | negative regulation of mitotic cell cycle |
| 1. PB | GO:0071944 | cell periphery |
| 1. PB | GO:0098887 | neurotransmitter receptor transport, endosome to postsynaptic membrane |
| 1. PB | GO:0003096 | renal sodium ion transport |
| 1. PB | GO:0098793 | presynapse |
| 1. PB | GO:0072659 | protein localization to plasma membrane |
| 1. PB | GO:0045296 | cadherin binding |
| 1. PB | GO:0005903 | brush border |
| 1. PB | GO:0030165 | PDZ domain binding |
| 1. PB | GO:0017081 | chloride channel regulator activity |
| 1. PB | GO:0098739 | import across plasma membrane |
| 1. PB | GO:0045198 | establishment of epithelial cell apical/basal polarity |
| 1. PB | GO:0045159 | myosin II binding |
| 1. PB | GO:0043495 | protein-membrane adaptor activity |
| 1. PB | GO:0007009 | plasma membrane organization |
| 1. PB | GO:0031698 | beta-2 adrenergic receptor binding |
| 1. PB | GO:0030643 | cellular phosphate ion homeostasis |
| 1. PB | GO:0045199 | maintenance of epithelial cell apical/basal polarity |
| 1. PB | GO:0031800 | type 3 metabotropic glutamate receptor binding |
| 1. PB | GO:0032426 | stereocilium tip |
| 1. PB | GO:0045859 | regulation of protein kinase activity |
| 1. PB | GO:0010766 | negative regulation of sodium ion transport |
| 1. PB | GO:0043197 | dendritic spine |
| 1. PB | GO:0044295 | axonal growth cone |
| 1. PB | GO:0005102 | signaling receptor binding |
| 1. PB | GO:0007043 | cell-cell junction assembly |
| 1. PB | GO:0008022 | protein C-terminus binding |
| 1. PB | GO:0090660 | cerebrospinal fluid circulation |
| 1. PB | GO:0008285 | negative regulation of cell population proliferation |
| 1. PB | GO:0034767 | positive regulation of ion transmembrane transport |
| 1. PB | GO:0014067 | negative regulation of phosphatidylinositol 3-kinase signaling |
| 1. PB | GO:0044062 | regulation of excretion |
| 1. PB | GO:0098968 | neurotransmitter receptor transport postsynaptic membrane to endosome |
| 1. PB | GO:0043621 | protein self-association |
| 1. PB | GO:0015185 | gamma-aminobutyric acid transmembrane transporter activity |
| 1. PB | GO:0008361 | regulation of cell size |
| 1. PB | GO:0060561 | apoptotic process involved in morphogenesis |
| 1. PB | GO:0097225 | sperm midpiece |
| 1. PB | GO:0070293 | renal absorption |
| 1. PB | GO:0060341 | regulation of cellular localization |
| 1. PB | GO:0048471 | perinuclear region of cytoplasm |
| 1. PB | GO:0070373 | negative regulation of ERK1 and ERK2 cascade |
| 1. PB | GO:0032415 | regulation of sodium:proton antiporter activity |
| 1. PB | GO:0060090 | molecular adaptor activity |
| 1. PB | GO:0051939 | gamma-aminobutyric acid import |
| 1. PB | GO:0031799 | type 2 metabotropic glutamate receptor binding |
| 1. PB | GO:0060088 | auditory receptor cell stereocilium organization |
| 1. PB | GO:0019933 | cAMP-mediated signaling |
| 1. PB | GO:0051683 | establishment of Golgi localization |
| 1. PB | GO:0019902 | phosphatase binding |
| 1. PB | GO:0050780 | dopamine receptor binding |
| 1. PB | GO:0032991 | protein-containing complex |
| 1. PB | GO:0010642 | negative regulation of platelet-derived growth factor receptor signaling pathway |
| 1. PB | GO:0005923 | bicellular tight junction |
| 1. PB | GO:0047485 | protein N-terminus binding |
| 1. PB | GO:0097291 | renal phosphate ion absorption |
| 1. PB | GO:0032416 | negative regulation of sodium:proton antiporter activity |
| 1. PB | GO:0044782 | cilium organization |
| 1. PB | GO:0005938 | cell cortex |
| 1. PB | GO:0008013 | beta-catenin binding |
| 2. P | GO:2000300 | regulation of synaptic vesicle exocytosis |
| 2. P | GO:0034613 | cellular protein localization |
| 2. P | GO:0045217 | cell-cell junction maintenance |
| 2. P | GO:0030511 | positive regulation of transforming growth factor beta receptor signaling pathway |
| 2. P | GO:0006605 | protein targeting |
| 2. P | GO:0098794 | postsynapse |
| 2. P | GO:0048884 | neuromast development |
| 2. P | GO:0098761 | cellular response to interleukin-7 |
| 2. P | GO:0043542 | endothelial cell migration |
| 2. P | GO:0070062 | extracellular exosome |
| 2. P | GO:0060027 | convergent extension involved in gastrulation |
| 2. P | GO:0007098 | centrosome cycle |
| 2. P | GO:0050714 | positive regulation of protein secretion |
| 2. P | GO:0048023 | positive regulation of melanin biosynthetic process |
| 2. P | GO:0097475 | motor neuron migration |
| 2. P | GO:0034451 | centriolar satellite |
| 2. P | GO:0031267 | small GTPase binding |
| 2. P | GO:0014047 | glutamate secretion |
| 2. P | GO:0048167 | regulation of synaptic plasticity |
| 2. P | GO:0050750 | low-density lipoprotein particle receptor binding |
| 2. P | GO:0032467 | positive regulation of cytokinesis |
| 2. P | GO:0030742 | GTP-dependent protein binding |
| 2. P | GO:0017022 | myosin binding |
| 2. P | GO:0032435 | negative regulation of proteasomal ubiquitin-dependent protein catabolic process |
| 2. P | GO:0001933 | negative regulation of protein phosphorylation |
| 2. P | GO:0031647 | regulation of protein stability |
| 2. P | GO:0001841 | neural tube formation |
| 2. P | GO:0098685 | Schaffer collateral - CA1 synapse |
| 2. P | GO:0008021 | synaptic vesicle |
| 2. P | GO:0030139 | endocytic vesicle |
| 2. P | GO:0071679 | commissural neuron axon guidance |
| 2. P | GO:0042802 | identical protein binding |
| 2. P | GO:1904781 | positive regulation of protein localization to centrosome |
| 2. P | GO:0012506 | vesicle membrane |
| 2. P | GO:0033564 | anterior/posterior axon guidance |
| 3. B | GO:1903753 | negative regulation of p38MAPK cascade |
| 3. B | GO:0016080 | synaptic vesicle targeting |
| 3. B | GO:0044300 | cerebellar mossy fiber |
| 3. B | GO:0046007 | negative regulation of activated T cell proliferation |
| 3. B | GO:0019904 | protein domain specific binding |
| 3. B | GO:0071625 | vocalization behavior |
| 3. B | GO:0045571 | negative regulation of imaginal disc growth |
| 3. B | GO:0043296 | apical junction complex |
| 3. B | GO:0097118 | neuroligin clustering involved in postsynaptic membrane assembly |
| 3. B | GO:0035254 | glutamate receptor binding |
| 3. B | GO:1903764 | regulation of potassium ion export across plasma membrane |
| 3. B | GO:0030100 | regulation of endocytosis |
| 3. B | GO:1903361 | protein localization to basolateral plasma membrane |
| 3. B | GO:0031579 | membrane raft organization |
| 3. B | GO:0099147 | extrinsic component of postsynaptic density membrane |
| 3. B | GO:0032456 | endocytic recycling |
| 3. B | GO:0097109 | neuroligin family protein binding |
| 3. B | GO:0048515 | spermatid differentiation |
| 3. B | GO:0097061 | dendritic spine organization |
| 3. B | GO:0045186 | zonula adherens assembly |
| 3. B | GO:0043615 | astrocyte cell migration |
| 3. B | GO:0016188 | synaptic vesicle maturation |
| 3. B | GO:0007507 | heart development |
| 3. B | GO:0030010 | establishment of cell polarity |
| 3. B | GO:0003006 | developmental process involved in reproduction |
| 3. B | GO:2000298 | regulation of Rho-dependent protein serine/threonine kinase activity |
| 3. B | GO:0001937 | negative regulation of endothelial cell proliferation |
| 3. B | GO:0030046 | parallel actin filament bundle assembly |
| 3. B | GO:0070699 | type II activin receptor binding |
| 3. B | GO:0044326 | dendritic spine neck |
| 3. B | GO:0097018 | renal albumin absorption |
| 3. B | GO:0038032 | termination of G protein-coupled receptor signaling pathway |
| 3. B | GO:0099031 | anchored component of postsynaptic density membrane |
| 3. B | GO:0048729 | tissue morphogenesis |
| 3. B | GO:0060307 | regulation of ventricular cardiac muscle cell membrane repolarization |
| 3. B | GO:0019894 | kinesin binding |
| 3. B | GO:0001935 | endothelial cell proliferation |
| 3. B | GO:0001770 | establishment of natural killer cell polarity |
| 3. B | GO:0044877 | protein-containing complex binding |
| 3. B | GO:0030426 | growth cone |
| 3. B | GO:0043149 | stress fiber assembly |
| 3. B | GO:0018105 | peptidyl-serine phosphorylation |
| 3. B | GO:0019903 | protein phosphatase binding |
| 3. B | GO:0005576 | extracellular region |
| 3. B | GO:0099179 | regulation of synaptic membrane adhesion |
| 3. B | GO:1904373 | response to kainic acid |
| 3. B | GO:0003383 | apical constriction |
| 3. B | GO:1905605 | positive regulation of blood-brain barrier permeability |
| 3. B | GO:1904372 | positive regulation of protein localization to actin cortical patch |
| 3. B | GO:0030018 | Z disc |
| 3. B | GO:0042805 | actinin binding |
| 3. B | GO:0035259 | glucocorticoid receptor binding |
| 3. B | GO:0098879 | structural constituent of postsynaptic specialization |
| 3. B | GO:0042609 | CD4 receptor binding |
| 3. B | GO:0042110 | T cell activation |
| 3. B | GO:0043116 | negative regulation of vascular permeability |
| 3. B | GO:0050885 | neuromuscular process controlling balance |
| 3. B | GO:0043482 | cellular pigment accumulation |
| 3. B | GO:1904313 | response to methamphetamine hydrochloride |
| 3. B | GO:0098696 | regulation of neurotransmitter receptor localization to postsynaptic specialization membrane |
| 3. B | GO:0060581 | cell fate commitment involved in pattern specification |
| 3. B | GO:0048704 | embryonic skeletal system morphogenesis |
| 3. B | GO:0050808 | synapse organization |
| 3. B | GO:0010360 | negative regulation of anion channel activity |
| 3. B | GO:0005524 | ATP binding |
| 3. B | GO:0032839 | dendrite cytoplasm |
| 3. B | GO:0051496 | positive regulation of stress fiber assembly |
| 3. B | GO:0019991 | septate junction assembly |
| 3. B | GO:0032291 | axon ensheathment in central nervous system |
| 3. B | GO:0007612 | learning |
| 3. B | GO:0031748 | D1 dopamine receptor binding |
| 3. B | GO:0030054 | cell junction |
| 3. B | GO:0035641 | locomotory exploration behavior |
| 3. B | GO:0030011 | maintenance of cell polarity |
| 3. B | GO:0031473 | myosin III binding |
| 3. B | GO:0048489 | synaptic vesicle transport |
| 3. B | GO:0044224 | juxtaparanode region of axon |
| 3. B | GO:0061176 | type Ib terminal bouton |
| 3. B | GO:0001975 | response to amphetamine |
| 3. B | GO:0016013 | syntrophin complex |
| 3. B | GO:0035902 | response to immobilization stress |
| 3. B | GO:0032516 | positive regulation of phosphoprotein phosphatase activity |
| 3. B | GO:0035091 | phosphatidylinositol binding |
| 3. B | GO:0005547 | phosphatidylinositol-3,4,5-trisphosphate binding |
| 3. B | GO:0043025 | neuronal cell body |
| 3. B | GO:0097060 | synaptic membrane |
| 3. B | GO:0097016 | L27 domain binding |
| 3. B | GO:1990090 | cellular response to nerve growth factor stimulus |
| 3. B | GO:0042130 | negative regulation of T cell proliferation |
| 3. B | GO:0035418 | protein localization to synapse |
| 3. B | GO:2000809 | positive regulation of synaptic vesicle clustering |
| 3. B | GO:0150012 | positive regulation of neuron projection arborization |
| 3. B | GO:0035003 | subapical complex |
| 3. B | GO:0001768 | establishment of T cell polarity |
| 3. B | GO:0061098 | positive regulation of protein tyrosine kinase activity |
| 3. B | GO:0016328 | lateral plasma membrane |
| 3. B | GO:0061802 | anterior cell cortex |
| 3. B | GO:0031905 | early endosome lumen |
| 3. B | GO:0030950 | establishment or maintenance of actin cytoskeleton polarity |
| 3. B | GO:0022409 | positive regulation of cell-cell adhesion |
| 3. B | GO:0055038 | recycling endosome membrane |
| 3. B | GO:0008104 | protein localization |
| 3. B | GO:0015031 | protein transport |
| 3. B | GO:0030714 | anterior/posterior axis specification, follicular epithelium |
| 3. B | GO:0045161 | neuronal ion channel clustering |
| 3. B | GO:0050930 | induction of positive chemotaxis |
| 3. B | GO:0035865 | cellular response to potassium ion |
| 3. B | GO:0030864 | cortical actin cytoskeleton |
| 3. B | GO:0001965 | G-protein alpha-subunit binding |
| 3. B | GO:0061049 | cell growth involved in cardiac muscle cell development |
| 3. B | GO:0010596 | negative regulation of endothelial cell migration |
| 3. B | GO:0016336 | establishment or maintenance of polarity of larval imaginal disc epithelium |
| 3. B | GO:1901888 | regulation of cell junction assembly |
| 3. B | GO:0050953 | sensory perception of light stimulus |
| 3. B | GO:0042982 | amyloid precursor protein metabolic process |
| 3. B | GO:0016332 | establishment or maintenance of polarity of embryonic epithelium |
| 3. B | GO:0032970 | regulation of actin filament-based process |
| 3. B | GO:0048839 | inner ear development |
| 3. B | GO:0005125 | cytokine activity |
| 3. B | GO:0007015 | actin filament organization |
| 3. B | GO:0098970 | postsynaptic neurotransmitter receptor diffusion trapping |
| 3. B | GO:0034750 | Scrib-APC-beta-catenin complex |
| 3. B | GO:0061684 | chaperone-mediated autophagy |
| 3. B | GO:0071315 | cellular response to morphine |
| 3. B | GO:0060122 | inner ear receptor cell stereocilium organization |
| 3. B | GO:0050804 | modulation of chemical synaptic transmission |
| 3. B | GO:0061061 | muscle structure development |
| 3. B | GO:0016358 | dendrite development |
| 3. B | GO:0048745 | smooth muscle tissue development |
| 3. B | GO:0060022 | hard palate development |
| 3. B | GO:1902083 | negative regulation of peptidyl-cysteine S-nitrosylation |
| 3. B | GO:0032655 | regulation of interleukin-12 production |
| 3. B | GO:0022011 | myelination in peripheral nervous system |
| 3. B | GO:0032036 | myosin heavy chain binding |
| 3. B | GO:0032281 | AMPA glutamate receptor complex |
| 3. B | GO:0070160 | tight junction |
| 3. B | GO:0045175 | basal protein localization |
| 3. B | GO:0016197 | endosomal transport |
| 3. B | GO:0002027 | regulation of heart rate |
| 3. B | GO:1903760 | regulation of voltage-gated potassium channel activity involved in ventricular cardiac muscle cell action potential repolarization |
| 3. B | GO:1904970 | brush border assembly |
| 3. B | GO:0044325 | transmembrane transporter binding |
| 3. B | GO:0008593 | regulation of Notch signaling pathway |
| 3. B | GO:0030425 | dendrite |
| 3. B | GO:0034777 | recycling endosome lumen |
| 3. B | GO:1904719 | positive regulation of AMPA glutamate receptor clustering |
| 3. B | GO:0006887 | exocytosis |
| 3. B | GO:0014066 | regulation of phosphatidylinositol 3-kinase signaling |
| 3. B | GO:0034695 | response to prostaglandin E |
| 3. B | GO:0045494 | photoreceptor cell maintenance |
| 3. B | GO:0003723 | RNA binding |
| 3. B | GO:0044291 | cell-cell contact zone |
| 3. B | GO:0015879 | carnitine transport |
| 3. B | GO:0007010 | cytoskeleton organization |
| 3. B | GO:0051660 | establishment of centrosome localization |
| 3. B | GO:0044070 | regulation of anion transport |
| 3. B | GO:0008157 | protein phosphatase 1 binding |
| 3. B | GO:0071364 | cellular response to epidermal growth factor stimulus |
| 3. B | GO:0030140 | trans-Golgi network transport vesicle |
| 3. B | GO:0005516 | calmodulin binding |
| 3. B | GO:1904049 | negative regulation of spontaneous neurotransmitter secretion |
| 3. B | GO:0035088 | establishment or maintenance of apical/basal cell polarity |
| 3. B | GO:0031594 | neuromuscular junction |
| 3. B | GO:0051015 | actin filament binding |
| 3. B | GO:0007269 | neurotransmitter secretion |
| 3. B | GO:2000009 | negative regulation of protein localization to cell surface |
| 3. B | GO:0050806 | positive regulation of synaptic transmission |
| 3. B | GO:0008270 | zinc ion binding |
| 3. B | GO:0098976 | excitatory chemical synaptic transmission |
| 3. B | GO:0043219 | lateral loop |
| 3. B | GO:0030042 | actin filament depolymerization |
| 3. B | GO:1903119 | protein localization to actin cytoskeleton |
| 3. B | GO:0043220 | Schmidt-Lanterman incisure |
| 3. B | GO:0050839 | cell adhesion molecule binding |
| 3. B | GO:0090557 | establishment of endothelial intestinal barrier |
| 3. B | GO:0071253 | connexin binding |
| 3. B | GO:0051117 | ATPase binding |
| 3. B | GO:0001725 | stress fiber |
| 3. B | GO:0046332 | SMAD binding |
| 3. B | GO:0051393 | alpha-actinin binding |
| 3. B | GO:0019900 | kinase binding |
| 3. B | GO:0030866 | cortical actin cytoskeleton organization |
| 3. B | GO:0051493 | regulation of cytoskeleton organization |
| 3. B | GO:0098609 | cell-cell adhesion |
| 3. B | GO:0014069 | postsynaptic density |
| 3. B | GO:0099003 | vesicle-mediated transport in synapse |
| 3. B | GO:2000474 | regulation of opioid receptor signaling pathway |
| 3. B | GO:0032414 | positive regulation of ion transmembrane transporter activity |
| 3. B | GO:1903829 | positive regulation of protein localization |
| 3. B | GO:0099092 | postsynaptic density, intracellular component |
| 3. B | GO:0032266 | phosphatidylinositol-3-phosphate binding |
| 3. B | GO:0045211 | postsynaptic membrane |
| 3. B | GO:0031434 | mitogen-activated protein kinase kinase binding |
| 3. B | GO:0031941 | filamentous actin |
| 3. B | GO:1903672 | positive regulation of sprouting angiogenesis |
| 3. B | GO:0007318 | pole plasm protein localization |
| 3. B | GO:0007391 | dorsal closure |
| 3. B | GO:0050680 | negative regulation of epithelial cell proliferation |
| 3. B | GO:0044319 | wound healing, spreading of cells |
| 3. B | GO:1904106 | protein localization to microvillus |
| 3. B | GO:0036312 | phosphatidylinositol 3-kinase regulatory subunit binding |
| 3. B | GO:0003094 | glomerular filtration |
| 3. B | GO:0050957 | equilibrioception |
| 3. B | GO:0097440 | apical dendrite |
| 3. B | GO:0002011 | morphogenesis of an epithelial sheet |
| 3. B | GO:0071212 | subsynaptic reticulum |
| 3. B | GO:0001738 | morphogenesis of a polarized epithelium |
| 3. B | GO:0072015 | glomerular visceral epithelial cell development |
| 3. B | GO:0019865 | immunoglobulin binding |
| 3. B | GO:0016333 | morphogenesis of follicular epithelium |
| 3. B | GO:0150105 | protein localization to cell-cell junction |
| 3. B | GO:0001825 | blastocyst formation |
| 3. B | GO:0060603 | mammary gland duct morphogenesis |
| 3. B | GO:0051371 | muscle alpha-actinin binding |
| 3. B | GO:0032587 | ruffle membrane |
| 3. B | GO:0035255 | ionotropic glutamate receptor binding |
| 3. B | GO:0031032 | actomyosin structure organization |
| 3. B | GO:0048545 | response to steroid hormone |
| 3. B | GO:0070830 | bicellular tight junction assembly |
| 3. B | GO:0015459 | potassium channel regulator activity |
| 3. B | GO:0005911 | cell-cell junction |
| 3. B | GO:0002091 | negative regulation of receptor internalization |
| 3. B | GO:0120039 | plasma membrane bounded cell projection morphogenesis |
| 3. B | GO:0031005 | filamin binding |
| 3. B | GO:0031253 | cell projection membrane |
| 3. B | GO:0010761 | fibroblast migration |
| 3. B | GO:1904064 | positive regulation of cation transmembrane transport |
| 3. B | GO:0045179 | apical cortex |
| 3. B | GO:0031901 | early endosome membrane |
| 3. B | GO:0098902 | regulation of membrane depolarization during action potential |
| 3. B | GO:0045214 | sarcomere organization |
| 3. B | GO:1990780 | cytoplasmic side of dendritic spine plasma membrane |
| 3. B | GO:0030838 | positive regulation of actin filament polymerization |
| 3. B | GO:0099638 | endosome to plasma membrane protein transport |
| 3. B | GO:0035633 | maintenance of blood-brain barrier |
| 3. B | GO:0071896 | protein localization to adherens junction |
| 3. B | GO:0060076 | excitatory synapse |
| 3. B | GO:0030695 | GTPase regulator activity |
| 3. B | GO:0035094 | response to nicotine |
| 3. B | GO:0031697 | beta-1 adrenergic receptor binding |
| 3. B | GO:0007266 | Rho protein signal transduction |
| 3. B | GO:0030859 | polarized epithelial cell differentiation |
| 3. B | GO:0032515 | negative regulation of phosphoprotein phosphatase activity |
| 3. B | GO:0099642 | retrograde axonal protein transport |
| 3. B | GO:0007165 | signal transduction |
| 3. B | GO:1905477 | positive regulation of protein localization to membrane |
| 3. B | GO:0044309 | neuron spine |
| 3. B | GO:0098890 | extrinsic component of postsynaptic membrane |
| 3. B | GO:0033270 | paranode region of axon |
| 3. B | GO:0005737 | cytoplasm |
| 3. B | GO:0031812 | P2Y1 nucleotide receptor binding |
| 3. B | GO:0043622 | cortical microtubule organization |
| 3. B | GO:0009898 | cytoplasmic side of plasma membrane |
| 3. B | GO:0045184 | establishment of protein localization |
| 3. B | GO:0032730 | positive regulation of interleukin-1 alpha production |
| 3. B | GO:0005921 | gap junction |
| 3. B | GO:0005109 | frizzled binding |
| 3. B | GO:0099641 | anterograde axonal protein transport |
| 3. B | GO:0043005 | neuron projection |
| 3. B | GO:0016323 | basolateral plasma membrane |
| 3. B | GO:0032019 | mitochondrial cloud |
| 3. B | GO:0030595 | leukocyte chemotaxis |
| 3. B | GO:1990778 | protein localization to cell periphery |
| 3. B | GO:0097113 | AMPA glutamate receptor clustering |
| 3. B | GO:0042995 | cell projection |
| 3. B | GO:0014704 | intercalated disc |
| 3. B | GO:0030863 | cortical cytoskeleton |
| 3. B | GO:0090559 | regulation of membrane permeability |
| 3. B | GO:0050962 | detection of light stimulus involved in sensory perception |
| 3. B | GO:0034109 | homotypic cell-cell adhesion |
| 3. B | GO:0046549 | retinal cone cell development |
| 3. B | GO:0004385 | guanylate kinase activity |
| 3. B | GO:0098911 | regulation of ventricular cardiac muscle cell action potential |
| 3. B | GO:0001658 | branching involved in ureteric bud morphogenesis |
| 3. B | GO:1903078 | positive regulation of protein localization to plasma membrane |
| 3. B | GO:0005124 | scavenger receptor binding |
| 3. B | GO:0030658 | transport vesicle membrane |
| 3. B | GO:0042491 | inner ear auditory receptor cell differentiation |
| 3. B | GO:0042383 | sarcolemma |
| 3. B | GO:0044327 | dendritic spine head |
| 3. B | GO:0032029 | myosin tail binding |
| 3. B | GO:1903609 | negative regulation of inward rectifier potassium channel activity |
| 3. B | GO:0014824 | artery smooth muscle contraction |
| 3. B | GO:0002142 | stereocilia ankle link complex |
| 3. B | GO:0097025 | MPP7-DLG1-LIN7 complex |
| 3. B | GO:0043004 | cytoplasmic sequestering of CFTR protein |
| 3. B | GO:0021747 | cochlear nucleus development |
| 3. B | GO:1902305 | regulation of sodium ion transmembrane transport |
| 3. B | GO:0016334 | establishment or maintenance of polarity of follicular epithelium |
| 3. B | GO:2000310 | regulation of NMDA receptor activity |
| 3. B | GO:0005856 | cytoskeleton |
| 3. B | GO:0061001 | regulation of dendritic spine morphogenesis |
| 3. B | GO:0050998 | nitric-oxide synthase binding |
| 3. B | GO:0005912 | adherens junction |
| 3. B | GO:0099072 | regulation of postsynaptic membrane neurotransmitter receptor levels |
| 3. B | GO:0060179 | male mating behavior |
| 3. B | GO:0003294 | atrial ventricular junction remodeling |
| 3. B | GO:1903671 | negative regulation of sprouting angiogenesis |
| 3. B | GO:0051497 | negative regulation of stress fiber assembly |
| 3. B | GO:0032233 | positive regulation of actin filament bundle assembly |
| 3. B | GO:0016010 | dystrophin-associated glycoprotein complex |
| 3. B | GO:0048608 | reproductive structure development |
| 3. B | GO:0030159 | signaling receptor complex adaptor activity |
| 3. B | GO:0035748 | myelin sheath abaxonal region |
| 3. B | GO:0050918 | positive chemotaxis |
| 3. B | GO:0051020 | GTPase binding |
| 3. B | GO:0044306 | neuron projection terminus |
| 3. B | GO:0034334 | adherens junction maintenance |
| 3. B | GO:0090314 | positive regulation of protein targeting to membrane |
| 3. B | GO:0015629 | actin cytoskeleton |
| 3. B | GO:0030953 | astral microtubule organization |
| 3. B | GO:2000134 | negative regulation of G1/S transition of mitotic cell cycle |
| 3. B | GO:0099645 | neurotransmitter receptor localization to postsynaptic specialization membrane |
| 3. B | GO:0032926 | negative regulation of activin receptor signaling pathway |
| 3. B | GO:2000049 | positive regulation of cell-cell adhesion mediated by cadherin |
| 3. B | GO:0033130 | acetylcholine receptor binding |
| 3. B | GO:1902396 | protein localization to bicellular tight junction |
| 3. B | GO:1903286 | regulation of potassium ion import |
| 3. B | GO:0120192 | tight junction assembly |
| 3. B | GO:0090162 | establishment of epithelial cell polarity |
| 3. B | GO:0045197 | establishment or maintenance of epithelial cell apical/basal polarity |
| 3. B | GO:0016335 | morphogenesis of larval imaginal disc epithelium |
| 3. B | GO:0031641 | regulation of myelination |
| 3. B | GO:0071392 | cellular response to estradiol stimulus |
| 3. B | GO:0030027 | lamellipodium |
| 3. B | GO:0001736 | establishment of planar polarity |
| 3. B | GO:2000649 | regulation of sodium ion transmembrane transporter activity |
| 3. B | GO:0033268 | node of Ranvier |
| 3. B | GO:0098641 | cadherin binding involved in cell-cell adhesion |
| 3. B | GO:1904386 | response to L-phenylalanine derivative |
| 3. B | GO:0046847 | filopodium assembly |
| 3. B | GO:0000287 | magnesium ion binding |
| 3. B | GO:0030432 | peristalsis |
| 3. B | GO:0032927 | positive regulation of activin receptor signaling pathway |
| 3. B | GO:0001755 | neural crest cell migration |
| 3. B | GO:0036342 | post-anal tail morphogenesis |
| 3. B | GO:0086005 | ventricular cardiac muscle cell action potential |
| 3. B | GO:0000226 | microtubule cytoskeleton organization |
| 3. B | GO:0008092 | cytoskeletal protein binding |
| 3. B | GO:0098919 | structural constituent of postsynaptic density |
| 3. B | GO:0032033 | myosin II light chain binding |
| 3. B | GO:0034446 | substrate adhesion-dependent cell spreading |
| 3. B | GO:0043204 | perikaryon |
| 3. B | GO:0045216 | cell-cell junction organization |
| 3. B | GO:0007155 | cell adhesion |
| 3. B | GO:0001772 | immunological synapse |
| 3. B | GO:0070697 | activin receptor binding |
| 3. B | GO:2000463 | positive regulation of excitatory postsynaptic potential |
| 3. B | GO:0002088 | lens development in camera-type eye |
| 3. B | GO:0001921 | positive regulation of receptor recycling |
| 3. B | GO:0046328 | regulation of JNK cascade |
| 3. B | GO:0003117 | regulation of vasoconstriction by circulating norepinephrine |
| 3. B | GO:0099149 | regulation of postsynaptic neurotransmitter receptor internalization |
| 3. B | GO:1902473 | regulation of protein localization to synapse |
| 3. B | GO:0051963 | regulation of synapse assembly |
| 3. B | GO:0048169 | regulation of long-term neuronal synaptic plasticity |
| 3. B | GO:0043113 | receptor clustering |
| 3. B | GO:0016327 | apicolateral plasma membrane |
| 3. B | GO:0031532 | actin cytoskeleton reorganization |
| 3. B | GO:0060997 | dendritic spine morphogenesis |
| 3. B | GO:0031749 | D2 dopamine receptor binding |
| 3. B | GO:0032591 | dendritic spine membrane |
| 3. B | GO:0002093 | auditory receptor cell morphogenesis |
| 3. B | GO:0061458 | reproductive system development |
| 3. B | GO:0038180 | nerve growth factor signaling pathway |
| 3. B | GO:0071000 | response to magnetism |
| 3. B | GO:0043268 | positive regulation of potassium ion transport |
| 3. B | GO:0030672 | synaptic vesicle membrane |
| 3. B | GO:0016331 | morphogenesis of embryonic epithelium |
| 3. B | GO:0016021 | integral component of membrane |
| 3. B | GO:1902565 | positive regulation of neutrophil activation |
| 3. B | GO:0005925 | focal adhesion |
| 3. B | GO:0036057 | slit diaphragm |
| 3. B | GO:0001503 | ossification |
| 3. B | GO:0034629 | |
| 3. B | GO:0005920 | smooth septate junction |
| 3. B | GO:2000810 | regulation of bicellular tight junction assembly |
| 3. B | GO:0061951 | establishment of protein localization to plasma membrane |
| 3. B | GO:0016525 | negative regulation of angiogenesis |
| 3. B | GO:0001771 | immunological synapse formation |
| 3. B | GO:0010801 | negative regulation of peptidyl-threonine phosphorylation |
| 3. B | GO:0046872 | metal ion binding |
| 3. B | GO:0045202 | synapse |
| 3. B | GO:0003779 | actin binding |
| 3. B | GO:2000250 | negative regulation of actin cytoskeleton reorganization |
| 3. B | GO:0007528 | neuromuscular junction development |
| 3. B | GO:0098839 | postsynaptic density membrane |
| 3. B | GO:0046581 | intercellular canaliculus |
| 3. B | GO:1990435 | upper tip-link density |
| 3. B | GO:0035209 | pupal development |
| 3. B | GO:2000821 | regulation of grooming behavior |
| 3. B | GO:0031643 | positive regulation of myelination |
| 3. B | GO:0032532 | regulation of microvillus length |
| 3. B | GO:0097338 | response to clozapine |
| 3. B | GO:0035556 | intracellular signal transduction |
| 3. B | GO:0005918 | septate junction |
| 3. B | GO:1901653 | cellular response to peptide |
| 3. B | GO:0017080 | sodium channel regulator activity |
| 3. B | GO:0051045 | negative regulation of membrane protein ectodomain proteolysis |
| 3. B | GO:0002092 | positive regulation of receptor internalization |
| 3. B | GO:0033269 | internode region of axon |
| 3. B | GO:0045176 | apical protein localization |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q9JHL1 | Na(+)/H(+) exchange regulatory cofactor NHE-RF2 | 2.73e-03 | 6.21e-04 | 0.004 |
| 1. PB | Q920G2 | Na(+)/H(+) exchange regulatory cofactor NHE-RF2 | 7.52e-03 | 1.05e-03 | 0.009 |
| 1. PB | Q4H4B6 | Protein scribble homolog | 4.86e-01 | 1.13e-03 | 1.47e-04 |
| 1. PB | Q9H6Y5 | PDZ domain-containing protein MAGIX | 0 | 1.20e-142 | 0.0 |
| 1. PB | Q4KL35 | PDZ domain-containing protein MAGIX | 6.32e-06 | 2.50e-50 | 7.53e-107 |
| 1. PB | O14745 | Na(+)/H(+) exchange regulatory cofactor NHE-RF1 | 1.80e-01 | 1.02e-06 | 0.005 |
| 1. PB | P70441 | Na(+)/H(+) exchange regulatory cofactor NHE-RF1 | 4.85e-02 | 1.52e-06 | 0.003 |
| 1. PB | Q6IN97 | Putative protein FRMPD2-like | 8.32e-04 | 2.33e-03 | 0.013 |
| 1. PB | Q3SZK8 | Na(+)/H(+) exchange regulatory cofactor NHE-RF1 | 1.14e-02 | 1.72e-04 | 0.001 |
| 1. PB | Q6AYQ0 | PDZ domain-containing protein MAGIX | 3.06e-06 | 1.04e-48 | 2.53e-110 |
| 1. PB | Q5ZM14 | Na(+)/H(+) exchange regulatory cofactor NHE-RF1 | 2.24e-02 | 5.74e-09 | 0.003 |
| 1. PB | Q28619 | Na(+)/H(+) exchange regulatory cofactor NHE-RF1 | 2.00e-02 | 3.02e-06 | 0.003 |
| 1. PB | Q15599 | Na(+)/H(+) exchange regulatory cofactor NHE-RF2 | 2.63e-03 | 1.66e-03 | 0.004 |
| 1. PB | Q4R6G4 | Na(+)/H(+) exchange regulatory cofactor NHE-RF1 | 8.57e-03 | 1.91e-06 | 0.005 |
| 1. PB | Q9JJ19 | Na(+)/H(+) exchange regulatory cofactor NHE-RF1 | 2.19e-01 | 7.04e-06 | 0.002 |
| 2. P | Q8TF65 | PDZ domain-containing protein GIPC2 | 1.71e-01 | 4.50e-04 | NA |
| 2. P | Q9Z254 | PDZ domain-containing protein GIPC1 | 5.29e-02 | 2.52e-04 | NA |
| 2. P | Q9JK84 | Partitioning defective 6 homolog gamma | 5.21e-03 | 5.39e-08 | NA |
| 2. P | O14908 | PDZ domain-containing protein GIPC1 | 3.80e-02 | 9.61e-05 | NA |
| 2. P | Q9Z2H7 | PDZ domain-containing protein GIPC2 | 1.77e-01 | 2.87e-03 | NA |
| 2. P | Q9BYG5 | Partitioning defective 6 homolog beta | 3.64e-03 | 3.05e-06 | NA |
| 2. P | Q9Z101 | Partitioning defective 6 homolog alpha | 3.22e-03 | 3.98e-02 | NA |
| 2. P | Q6B4M5 | Partitioning defective 6 homolog alpha | 7.28e-03 | 2.96e-02 | NA |
| 2. P | Q9NPB6 | Partitioning defective 6 homolog alpha | 2.26e-03 | 1.91e-02 | NA |
| 2. P | Q498D9 | PDZ domain-containing protein GIPC2 | 1.84e-01 | 7.03e-04 | NA |
| 2. P | Q9BYG4 | Partitioning defective 6 homolog gamma | 2.69e-02 | 3.43e-07 | NA |
| 2. P | Q9Z0G0 | PDZ domain-containing protein GIPC1 | 6.55e-02 | 4.36e-04 | NA |
| 2. P | Q8TF64 | PDZ domain-containing protein GIPC3 | 3.06e-02 | 2.30e-02 | NA |
| 2. P | Q1JQD4 | PDZ domain-containing protein GIPC2 | 1.77e-01 | 2.32e-04 | NA |
| 2. P | Q8R5M0 | PDZ domain-containing protein GIPC3 | 1.85e-01 | 2.53e-02 | NA |
| 2. P | Q9JK83 | Partitioning defective 6 homolog beta | 4.09e-03 | 2.86e-08 | NA |
| 3. B | Q9WTW1 | Glutamate receptor-interacting protein 2 | 2.12e-01 | NA | 1.47e-06 |
| 3. B | Q6R891 | Neurabin-2 | 1.32e-01 | NA | 0.003 |
| 3. B | Q810W7 | Microtubule-associated serine/threonine-protein kinase 1 | 2.99e-01 | NA | 4.78e-04 |
| 3. B | Q925E1 | Gamma-1-syntrophin | 1.32e-01 | NA | 7.69e-04 |
| 3. B | O60759 | Cytohesin-interacting protein | 9.37e-03 | NA | 0.002 |
| 3. B | Q80U72 | Protein scribble homolog | 4.73e-01 | NA | 6.05e-06 |
| 3. B | Q9Y2H9 | Microtubule-associated serine/threonine-protein kinase 1 | 3.83e-01 | NA | 1.50e-04 |
| 3. B | A8E0R9 | Glutamate receptor-interacting protein 2 | 2.64e-01 | NA | 2.69e-04 |
| 3. B | O35867 | Neurabin-1 | 3.18e-01 | NA | 0.019 |
| 3. B | E2QYC9 | InaD-like protein | 7.59e-01 | NA | 4.20e-06 |
| 3. B | Q5RCF7 | Na(+)/H(+) exchange regulatory cofactor NHE-RF3 | 1.01e-02 | NA | 1.07e-05 |
| 3. B | Q6QGC0 | PDZ and LIM domain protein 3 | 4.88e-03 | NA | 0.003 |
| 3. B | Q14005 | Pro-interleukin-16 | 1.94e-01 | NA | 2.10e-06 |
| 3. B | Q61085 | Rhophilin-1 | 5.69e-02 | NA | 0.007 |
| 3. B | Q9Y6N9 | Harmonin | 1.24e-02 | NA | 0.045 |
| 3. B | O15021 | Microtubule-associated serine/threonine-protein kinase 4 | 7.68e-01 | NA | 0.002 |
| 3. B | Q53GG5 | PDZ and LIM domain protein 3 | 5.46e-03 | NA | 0.002 |
| 3. B | Q9R1L5 | Microtubule-associated serine/threonine-protein kinase 1 | 8.06e-01 | NA | 4.70e-04 |
| 3. B | Q9NR12 | PDZ and LIM domain protein 7 | 4.48e-03 | NA | 1.01e-06 |
| 3. B | A2ALK8 | Tyrosine-protein phosphatase non-receptor type 3 | 1.13e-01 | NA | 0.008 |
| 3. B | Q8R4H2 | Rho guanine nucleotide exchange factor 12 | 8.48e-01 | NA | 4.56e-04 |
| 3. B | Q62936 | Disks large homolog 3 | 4.52e-02 | NA | 2.82e-07 |
| 3. B | Q12923 | Tyrosine-protein phosphatase non-receptor type 13 | 6.37e-01 | NA | 2.92e-07 |
| 3. B | O97758 | Tight junction protein ZO-1 | 8.93e-01 | NA | 4.95e-08 |
| 3. B | Q865P3 | Na(+)/H(+) exchange regulatory cofactor NHE-RF3 | 2.81e-02 | NA | 3.33e-04 |
| 3. B | Q9JJ40 | Na(+)/H(+) exchange regulatory cofactor NHE-RF3 | 1.52e-02 | NA | 0.002 |
| 3. B | E9Q9W7 | PDZ domain-containing protein 7 | 2.24e-01 | NA | 0.035 |
| 3. B | Q28626 | Alpha-1-syntrophin | 1.78e-02 | NA | 7.21e-06 |
| 3. B | Q5TCQ9 | Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 | 3.50e-01 | NA | 3.62e-15 |
| 3. B | Q63622 | Disks large homolog 2 | 8.49e-02 | NA | 5.58e-08 |
| 3. B | O88382 | Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 | 2.28e-01 | NA | 3.02e-17 |
| 3. B | Q63ZW7 | InaD-like protein | 3.63e-01 | NA | 6.08e-06 |
| 3. B | O62666 | Pro-interleukin-16 | 2.98e-02 | NA | 3.45e-05 |
| 3. B | Q3U214 | Microtubule-associated serine/threonine-protein kinase 3 | 7.02e-01 | NA | 6.19e-04 |
| 3. B | Q6AX33 | Microtubule-associated serine/threonine-protein kinase 3 | 3.26e-01 | NA | 0.005 |
| 3. B | Q91VY6 | Cytohesin-interacting protein | 1.46e-03 | NA | 1.91e-04 |
| 3. B | Q9VCX1 | Regulator of G-protein signaling loco | 3.75e-01 | NA | 6.88e-04 |
| 3. B | Q9Y3R0 | Glutamate receptor-interacting protein 1 | 2.96e-01 | NA | 7.03e-04 |
| 3. B | P78352 | Disks large homolog 4 | 7.88e-02 | NA | 1.03e-06 |
| 3. B | Q6R005 | Disks large homolog 4 | 4.94e-02 | NA | 2.55e-06 |
| 3. B | Q6AYD6 | PDZ and LIM domain protein 2 | 3.93e-04 | NA | 8.48e-06 |
| 3. B | D4A702 | Synaptopodin-2 | 2.29e-01 | NA | 0.001 |
| 3. B | Q64512 | Tyrosine-protein phosphatase non-receptor type 13 | 7.65e-01 | NA | 3.40e-08 |
| 3. B | Q62696 | Disks large homolog 1 | 9.39e-02 | NA | 2.91e-08 |
| 3. B | P70271 | PDZ and LIM domain protein 4 | 8.49e-03 | NA | 4.37e-04 |
| 3. B | Q9Z0U1 | Tight junction protein ZO-2 | 5.31e-01 | NA | 3.90e-05 |
| 3. B | O88951 | Protein lin-7 homolog B | 1.06e-03 | NA | 5.54e-05 |
| 3. B | Q6RHR9 | Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 | 2.61e-01 | NA | 1.18e-21 |
| 3. B | Q9Z340 | Partitioning defective 3 homolog | 2.75e-01 | NA | 7.86e-04 |
| 3. B | Q9CSB4 | Partitioning defective 3 homolog B | 4.98e-01 | NA | 8.38e-04 |
| 3. B | Q3SYZ8 | PDZ and LIM domain protein 3 | 1.16e-02 | NA | 8.16e-04 |
| 3. B | Q60592 | Microtubule-associated serine/threonine-protein kinase 2 | 3.92e-01 | NA | 2.98e-04 |
| 3. B | Q13884 | Beta-1-syntrophin | 4.05e-02 | NA | 4.33e-04 |
| 3. B | Q9JIL4 | Na(+)/H(+) exchange regulatory cofactor NHE-RF3 | 2.11e-02 | NA | 0.006 |
| 3. B | Q91YE8 | Synaptopodin-2 | 1.84e-01 | NA | 0.021 |
| 3. B | Q96HC4 | PDZ and LIM domain protein 5 | 1.17e-02 | NA | 3.34e-07 |
| 3. B | Q95168 | Tight junction protein ZO-2 | 3.00e-01 | NA | 9.81e-06 |
| 3. B | O70209 | PDZ and LIM domain protein 3 | 4.81e-02 | NA | 0.003 |
| 3. B | Q9H987 | Synaptopodin 2-like protein | 1.06e-01 | NA | 0.031 |
| 3. B | Q9WVQ1 | Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 | 3.35e-01 | NA | 2.91e-17 |
| 3. B | A7UA95 | Ras-associating and dilute domain-containing protein | 1.46e-01 | NA | 1.32e-07 |
| 3. B | Q9ES64 | Harmonin | 4.16e-01 | NA | 0.029 |
| 3. B | Q5F488 | Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 | 1.86e-01 | NA | 6.36e-16 |
| 3. B | Q4L1J4 | Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 | 4.11e-01 | NA | 7.43e-21 |
| 3. B | Q6P0Q8 | Microtubule-associated serine/threonine-protein kinase 2 | 4.16e-01 | NA | 6.08e-04 |
| 3. B | Q66HS7 | PDZ and LIM domain protein 3 | 1.44e-02 | NA | 0.003 |
| 3. B | F1MAD2 | InaD-like protein | 5.91e-01 | NA | 2.90e-06 |
| 3. B | A8MUH7 | Putative PDZ domain-containing protein PDZK1P1 | 2.23e-02 | NA | 6.16e-05 |
| 3. B | Q9HD26 | Golgi-associated PDZ and coiled-coil motif-containing protein | 8.85e-03 | NA | 0.035 |
| 3. B | P39447 | Tight junction protein ZO-1 | 6.99e-01 | NA | 4.77e-08 |
| 3. B | Q8TBB1 | E3 ubiquitin-protein ligase LNX | 1.17e-01 | NA | 1.81e-05 |
| 3. B | Q96SB3 | Neurabin-2 | 6.24e-01 | NA | 0.004 |
| 3. B | Q3SX40 | PDZ and LIM domain protein 7 | 4.20e-02 | NA | 3.65e-07 |
| 3. B | P28191 | Tyrosine-protein phosphatase 1 | 2.10e-01 | NA | 0.004 |
| 3. B | Q8NI35 | InaD-like protein | 3.69e-01 | NA | 1.76e-05 |
| 3. B | Q6P7E4 | PDZ and LIM domain protein 7 | 9.50e-03 | NA | 8.16e-04 |
| 3. B | O60307 | Microtubule-associated serine/threonine-protein kinase 3 | 2.00e-01 | NA | 3.86e-04 |
| 3. B | Q8TEW0 | Partitioning defective 3 homolog | 4.25e-01 | NA | 2.80e-04 |
| 3. B | Q5PYH5 | Discs large homolog 1-like protein | 6.16e-02 | NA | 5.99e-08 |
| 3. B | O75112 | LIM domain-binding protein 3 | 2.61e-02 | NA | 0.002 |
| 3. B | Q9HAP6 | Protein lin-7 homolog B | 9.22e-04 | NA | 3.89e-05 |
| 3. B | Q99L88 | Beta-1-syntrophin | 2.79e-02 | NA | 0.001 |
| 3. B | Q69Z89 | Ras-associating and dilute domain-containing protein | 3.12e-01 | NA | 5.29e-08 |
| 3. B | O95049 | Tight junction protein ZO-3 | 3.77e-01 | NA | 2.87e-05 |
| 3. B | O15018 | PDZ domain-containing protein 2 | NA | NA | 9.70e-09 |
| 3. B | Q28C55 | Disks large homolog 1 | 1.98e-01 | NA | 6.52e-08 |
| 3. B | Q8R1G6 | PDZ and LIM domain protein 2 | 3.65e-04 | NA | 1.02e-05 |
| 3. B | Q9Z252 | Protein lin-7 homolog B | 1.66e-03 | NA | 5.29e-05 |
| 3. B | P26045 | Tyrosine-protein phosphatase non-receptor type 3 | 1.94e-01 | NA | 0.011 |
| 3. B | A1A5G4 | Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 | 2.30e-01 | NA | 1.09e-13 |
| 3. B | Q9PU47 | PDZ and LIM domain protein 3 | 6.69e-03 | NA | 2.98e-04 |
| 3. B | Q8CGE9 | Regulator of G-protein signaling 12 | 2.54e-01 | NA | 6.98e-04 |
| 3. B | Q9Z250 | Protein lin-7 homolog A | 1.32e-03 | NA | 1.29e-05 |
| 3. B | Q2KIB6 | Protein lin-7 homolog B | 7.02e-04 | NA | 3.76e-05 |
| 3. B | Q92796 | Disks large homolog 3 | 4.73e-02 | NA | 3.07e-07 |
| 3. B | Q3T0X8 | Na(+)/H(+) exchange regulatory cofactor NHE-RF3 | 1.57e-02 | NA | 3.77e-04 |
| 3. B | Q86UL8 | Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 | 7.48e-01 | NA | 1.14e-16 |
| 3. B | Q62920 | PDZ and LIM domain protein 5 | 8.00e-03 | NA | 7.09e-09 |
| 3. B | O08774 | Regulator of G-protein signaling 12 | 4.16e-01 | NA | 0.003 |
| 3. B | A5PKA5 | Sorting nexin-27 | 4.81e-02 | NA | 0.005 |
| 3. B | Q3MHQ0 | Harmonin | 2.28e-02 | NA | 0.004 |
| 3. B | Q8SQG9 | Na(+)/H(+) exchange regulatory cofactor NHE-RF2 | 2.32e-02 | NA | 0.011 |
| 3. B | Q5PYH6 | Disks large homolog 1 | 4.15e-02 | NA | 1.01e-06 |
| 3. B | Q0P5F3 | Protein lin-7 homolog C | 1.42e-03 | NA | 1.10e-05 |
| 3. B | O70263 | E3 ubiquitin-protein ligase LNX | 1.31e-01 | NA | 3.52e-05 |
| 3. B | Q792I0 | Protein lin-7 homolog C | 1.18e-03 | NA | 1.10e-05 |
| 3. B | O62674 | Pro-interleukin-16 | 4.28e-02 | NA | 5.28e-06 |
| 3. B | Q925E0 | Gamma-2-syntrophin | 1.01e-01 | NA | 0.002 |
| 3. B | Q5T2W1 | Na(+)/H(+) exchange regulatory cofactor NHE-RF3 | 5.27e-03 | NA | 1.26e-05 |
| 3. B | Q9UDY2 | Tight junction protein ZO-2 | 3.36e-01 | NA | 2.96e-05 |
| 3. B | O62678 | Pro-interleukin-16 | 3.99e-02 | NA | 1.98e-05 |
| 3. B | Q9JKS4 | LIM domain-binding protein 3 | 3.00e-02 | NA | 0.002 |
| 3. B | P50479 | PDZ and LIM domain protein 4 | 1.15e-02 | NA | 4.65e-04 |
| 3. B | Q3T0C8 | PDZ and LIM domain protein 2 | 2.47e-03 | NA | 4.80e-06 |
| 3. B | P70175 | Disks large homolog 3 | 7.90e-02 | NA | 2.16e-07 |
| 3. B | P52944 | PDZ and LIM domain protein 1 | 1.05e-02 | NA | 0.002 |
| 3. B | Q9EQJ9 | Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 | 2.20e-01 | NA | 2.63e-15 |
| 3. B | Q3UHD6 | Sorting nexin-27 | 5.04e-02 | NA | 0.005 |
| 3. B | Q9GKU1 | PDZ and LIM domain protein 2 | 5.79e-03 | NA | 1.77e-05 |
| 3. B | Q96JH8 | Ras-associating and dilute domain-containing protein | 3.11e-01 | NA | 9.30e-08 |
| 3. B | Q32LM6 | Protein lin-7 homolog A | 1.36e-03 | NA | 1.30e-05 |
| 3. B | Q0V8R5 | Pro-interleukin-16 | 3.71e-02 | NA | 1.94e-05 |
| 3. B | Q5I0L6 | Cytohesin-interacting protein | 1.70e-03 | NA | 1.45e-04 |
| 3. B | Q811L6 | Microtubule-associated serine/threonine-protein kinase 4 | 8.65e-01 | NA | 0.001 |
| 3. B | O35274 | Neurabin-2 | 2.53e-01 | NA | 0.003 |
| 3. B | Q6INU3 | PDZ and LIM domain protein 7 | 3.03e-02 | NA | 3.34e-04 |
| 3. B | O55164 | Multiple PDZ domain protein | 3.84e-01 | NA | 2.87e-07 |
| 3. B | Q6ZMN7 | PDZ domain-containing RING finger protein 4 | 1.83e-01 | NA | 2.84e-04 |
| 3. B | Q17353 | Partitioning defective protein 3 | 3.51e-01 | NA | 0.001 |
| 3. B | Q8TEW8 | Partitioning defective 3 homolog B | 3.74e-01 | NA | 0.002 |
| 3. B | Q9WVJ4 | Synaptojanin-2-binding protein | 7.52e-04 | NA | 3.31e-10 |
| 3. B | Q61235 | Beta-2-syntrophin | 2.98e-01 | NA | 0.003 |
| 3. B | Q9JK71 | Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 | 2.28e-01 | NA | 1.01e-15 |
| 3. B | Q8VBX6 | Multiple PDZ domain protein | 7.41e-01 | NA | 2.77e-07 |
| 3. B | Q9NZN5 | Rho guanine nucleotide exchange factor 12 | 8.10e-01 | NA | 0.001 |
| 3. B | P68907 | E3 ubiquitin-protein ligase PDZRN3 | 3.60e-01 | NA | 0.048 |
| 3. B | Q9NUP9 | Protein lin-7 homolog C | 2.03e-03 | NA | 1.10e-05 |
| 3. B | Q96L92 | Sorting nexin-27 | 6.24e-02 | NA | 0.035 |
| 3. B | Q6GLJ6 | PDZ and LIM domain protein 3 | 4.81e-03 | NA | 1.35e-04 |
| 3. B | Q13425 | Beta-2-syntrophin | 2.87e-01 | NA | 0.002 |
| 3. B | O88952 | Protein lin-7 homolog C | 4.21e-04 | NA | 1.10e-05 |
| 3. B | Q811D0 | Disks large homolog 1 | 3.89e-01 | NA | 2.73e-08 |
| 3. B | Q9QZR8 | PDZ domain-containing protein 2 | NA | NA | 2.32e-09 |
| 3. B | O19132 | Nitric oxide synthase, brain | 4.14e-01 | NA | 0.044 |
| 3. B | G5ECY0 | Disks large homolog 1 | 3.10e-01 | NA | 3.17e-08 |
| 3. B | Q99NH2 | Partitioning defective 3 homolog | 4.09e-01 | NA | 7.85e-04 |
| 3. B | Q925T6 | Glutamate receptor-interacting protein 1 | 4.07e-01 | NA | 3.74e-04 |
| 3. B | Q679P3 | PDZ and LIM domain protein 7 | 1.89e-02 | NA | 6.02e-09 |
| 3. B | Q8BH60 | Golgi-associated PDZ and coiled-coil motif-containing protein | 3.72e-03 | NA | 0.035 |
| 3. B | Q9NSN8 | Gamma-1-syntrophin | 3.39e-02 | NA | 5.65e-04 |
| 3. B | Q9D6K5 | Synaptojanin-2-binding protein | 1.58e-04 | NA | 1.38e-09 |
| 3. B | Q13424 | Alpha-1-syntrophin | 1.36e-01 | NA | 2.02e-04 |
| 3. B | Q61234 | Alpha-1-syntrophin | 1.15e-01 | NA | 7.04e-05 |
| 3. B | P57105 | Synaptojanin-2-binding protein | 5.60e-05 | NA | 1.32e-07 |
| 3. B | O88888 | Amyloid-beta A4 precursor protein-binding family A member 3 | 1.33e-01 | NA | 0.024 |
| 3. B | Q96JY6 | PDZ and LIM domain protein 2 | 3.75e-04 | NA | 3.98e-06 |
| 3. B | O14910 | Protein lin-7 homolog A | 1.13e-03 | NA | 1.30e-05 |
| 3. B | O14924 | Regulator of G-protein signaling 12 | 5.62e-01 | NA | 0.001 |
| 3. B | O70400 | PDZ and LIM domain protein 1 | 9.81e-03 | NA | 0.001 |
| 3. B | P97879 | Glutamate receptor-interacting protein 1 | 1.69e-01 | NA | 8.55e-05 |
| 3. B | Q07157 | Tight junction protein ZO-1 | 4.66e-01 | NA | 5.26e-08 |
| 3. B | Q91XM9 | Disks large homolog 2 | 2.95e-02 | NA | 5.68e-08 |
| 3. B | O54824 | Pro-interleukin-16 | 2.46e-01 | NA | 2.35e-06 |
| 3. B | Q12959 | Disks large homolog 1 | 6.64e-02 | NA | 3.53e-08 |
| 3. B | Q5E9E1 | PDZ and LIM domain protein 1 | 1.15e-02 | NA | 7.50e-04 |
| 3. B | Q14160 | Protein scribble homolog | 8.82e-01 | NA | 6.11e-06 |
| 3. B | O00151 | PDZ and LIM domain protein 1 | 2.52e-02 | NA | 6.17e-04 |
| 3. B | Q8K4V4 | Sorting nexin-27 | 4.91e-02 | NA | 0.004 |
| 3. B | Q3TJD7 | PDZ and LIM domain protein 7 | 5.83e-03 | NA | 6.70e-07 |
| 3. B | Q7KRY7 | Protein lap4 | 3.95e-01 | NA | 2.69e-05 |
| 3. B | Q8TCX5 | Rhophilin-1 | 1.64e-01 | NA | 0.004 |
| 3. B | O75970 | Multiple PDZ domain protein | 4.93e-01 | NA | 3.71e-07 |
| 3. B | P36202 | PDZ and LIM domain protein 4 | 1.55e-01 | NA | 0.005 |
| 3. B | O70248 | Amyloid-beta A4 precursor protein-binding family A member 3 | 1.43e-01 | NA | 0.026 |
| 3. B | A0A0G2K2P5 | Tight junction protein ZO-1 | 3.65e-01 | NA | 4.82e-08 |
| 3. B | O62675 | Pro-interleukin-16 | 2.72e-02 | NA | 4.38e-06 |
| 3. B | Q91XL2 | Ligand of Numb protein X 2 | 1.85e-01 | NA | 0.001 |
| 3. B | Q9P227 | Rho GTPase-activating protein 23 | 7.44e-01 | NA | 0.004 |
| 3. B | Q69ZS0 | E3 ubiquitin-protein ligase PDZRN3 | 1.98e-01 | NA | 0.049 |
| 3. B | Q8TF72 | Protein Shroom3 | 6.37e-01 | NA | 0.004 |
| 3. B | Q9PW72 | PDZ and LIM domain protein 4 | 1.38e-03 | NA | 8.78e-06 |
| 3. B | Q9C0E4 | Glutamate receptor-interacting protein 2 | 7.30e-02 | NA | 4.11e-05 |
| 3. B | Q24008 | Inactivation-no-after-potential D protein | 1.98e-02 | NA | 3.99e-04 |
| 3. B | E7FDW2 | E3 ubiquitin-protein ligase PDZRN3-B | 1.85e-01 | NA | 0.016 |
| 3. B | Q68DX3 | FERM and PDZ domain-containing protein 2 | 2.31e-01 | NA | 0.003 |
| 3. B | Q96QZ7 | Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 | 6.21e-01 | NA | 6.22e-22 |
| 3. B | P31016 | Disks large homolog 4 | 6.95e-02 | NA | 1.06e-06 |
| 3. B | Q3T0C9 | Synaptojanin-2-binding protein | 7.47e-05 | NA | 1.06e-08 |
| 3. B | Q9Z1Z9 | PDZ and LIM domain protein 7 | 1.23e-02 | NA | 2.77e-06 |
| 3. B | Q8CI51 | PDZ and LIM domain protein 5 | 1.97e-02 | NA | 4.91e-09 |
| 3. B | Q5PYH7 | Disks large homolog 2 | 3.39e-02 | NA | 7.82e-09 |
| 3. B | Q15700 | Disks large homolog 2 | 6.55e-02 | NA | 3.69e-08 |
| 3. B | Q8N448 | Ligand of Numb protein X 2 | 7.10e-02 | NA | 0.001 |
| 3. B | Q5RAA5 | Protein lin-7 homolog C | 1.10e-03 | NA | 1.10e-05 |
| 3. B | Q8JZS0 | Protein lin-7 homolog A | 1.34e-03 | NA | 1.30e-05 |
| 3. B | Q3T005 | PDZ and LIM domain protein 4 | 1.27e-01 | NA | 0.001 |
| 3. B | O62676 | Pro-interleukin-16 | 1.65e-02 | NA | 7.94e-06 |
| 3. B | Q9NB04 | Patj homolog | 8.78e-02 | NA | 9.90e-06 |
| 3. B | O62677 | Pro-interleukin-16 | 4.68e-02 | NA | 2.10e-05 |
| 3. B | Q6ZM86 | Delphilin | 8.32e-02 | NA | 0.003 |
| 3. B | Q62108 | Disks large homolog 4 | 5.16e-01 | NA | 1.10e-06 |
| 3. B | E1JIT7 | PH and SEC7 domain-containing protein | 4.12e-01 | NA | 0.006 |
| 3. B | Q9NY99 | Gamma-2-syntrophin | 5.61e-02 | NA | 1.36e-04 |
| 3. B | P31007 | Disks large 1 tumor suppressor protein | 3.39e-01 | NA | 2.04e-04 |
| 3. B | Q5F425 | Protein lin-7 homolog C | 2.22e-03 | NA | 1.14e-05 |
| 3. B | Q0P5E6 | Alpha-1-syntrophin | 2.61e-01 | NA | 8.20e-05 |