Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
A1XQY3
(Neurexin-3b-beta) with a FATCAT P-Value: 2.96e-11 and RMSD of 2.96 angstrom. The sequence alignment identity is 67.1%.
Structural alignment shown in left. Query protein Q9HDB5 colored as red in alignment, homolog A1XQY3 colored as blue.
Query protein Q9HDB5 is also shown in right top, homolog A1XQY3 showed in right bottom. They are colored based on secondary structures.
Q9HDB5 MHLRIHARRSPPRRPAWTLG-IWFLFWGCIVSSVWSSSNVASSSSTSSSPGSHS--QHEHHFHGSKHHSVP-ISIYRSPVSLRGGHAGATYIFGKSGGLI 96 A1XQY3 --MRPHFK---TRYPQW-LSCMLPLVTGCVFGAVW-GSNLDSTVVLSSSTFSHSETQHHHHLAGAQHHP-PSIAIYRSPASLRGGHAGATYIFGKGGGLI 92 Q9HDB5 LYTWPANDRPSTRSDRLAVGFSTTVKDGILVRIDSAPGLGDFLQLHIEQGKIGVVFNIGTVDISIKEERTPVNDGKYHVVRFTRNGGNATLQVDNWPVNE 196 A1XQY3 MYTWPNNERPSTRTDRLAVGFSTTIKDGILVRIDSAPRLGDYIMLHIEEGKVCVTFNIGTVDISVKEMTTEVNDGKYHVVRFTRNGGNATLQVDNWPINE 192 Q9HDB5 HYP--------------------T----------GRQLTIFNTQAQIAIGGKDKGRLFQGQLSGLYYDGLKVLNMAAENNPNIKINGSVRLVGEVPSILG 266 A1XQY3 HFPSGNSDIERFQMANKKIPFKYTRPVEDWLHEKGRQLTIFNTQATISIGGNDRKRPYQGQLSGLYYNGLKVLNMAAEGHANIKINGSVRLVGDVPTSRS 292 Q9HDB5 TTQ-TTSMPPEMSTTVMETTTTMATTTTRKNRSTASIQPTSDDLVSSAECSSDDEDFVECEPS-TGGELVIPLLVEDPLATPPIATRAPSITLPPTFRPL 364 A1XQY3 PSRTTTSMPPEMSTTFIETTTTLSTTTTRKQRSPPTIQ-TTDDIVSSAECSSDDEDLEECDGGHTGGELVIPVLVEDPIDIPPISTRVPFIPLPPTLHPV 391 Q9HDB5 LTIIETTKDSLSMTSEAGLPCLSDQGSDGCDD--------DGLVISGYGSGETFDSNLPPTDDEDFYTTFSLVTDKSLSTSIFEGGYKAHAPKWESKDFR 456 A1XQY3 LTIIETTKESLSIATEAGVPCFSDQGRDDCDDDDGDDDDGDGLVISGFGSGEVFDSSLPPTDDEDFYTTFSLVTDKILTTSTYEGGYKALAPKWEEKDFK 491 Q9HDB5 PNKVSETSR-TTTTSLSPELIRFTASS--SSGMVPKLPAGKMNNRDLKPQPDIVLLPLPTAYELDSTKLKSPLITSPMFRNVPTANPTEPGIRRV-PGAS 552 A1XQY3 PKKPSEVGRITAIPPL-PDL-RSSAASPVRPEPAPKIPAGKMNNREVKPQPDIVLLPLPTSFDMDGTKPKGPYITQPMLRTIPSALPTVPGIRRVPPGAS 589 Q9HDB5 EVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYQVDETRNYISNSAQSNGTLMKEKQQSSKSG--HKKQKNKDREYYV 637 A1XQY3 EVIRESSSTTGMVVGIVSAAALCILILLYAMYKYRNRDEGSYQVDETRNYISNSAQNNGTVVKDKQPSTK-GASNKRPKDKDKEYYV 675
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:1905520 | positive regulation of presynaptic active zone assembly |
| 1. PB | GO:0071625 | vocalization behavior |
| 1. PB | GO:0097118 | neuroligin clustering involved in postsynaptic membrane assembly |
| 1. PB | GO:0010739 | positive regulation of protein kinase A signaling |
| 1. PB | GO:0097109 | neuroligin family protein binding |
| 1. PB | GO:0097104 | postsynaptic membrane assembly |
| 1. PB | GO:0031965 | nuclear membrane |
| 1. PB | GO:0097091 | synaptic vesicle clustering |
| 1. PB | GO:0099054 | presynapse assembly |
| 1. PB | GO:0030139 | endocytic vesicle |
| 1. PB | GO:0005246 | calcium channel regulator activity |
| 1. PB | GO:0009986 | cell surface |
| 1. PB | GO:0007268 | chemical synaptic transmission |
| 1. PB | GO:0007165 | signal transduction |
| 1. PB | GO:0060134 | prepulse inhibition |
| 1. PB | GO:0098978 | glutamatergic synapse |
| 1. PB | GO:1900020 | positive regulation of protein kinase C activity |
| 1. PB | GO:0007416 | synapse assembly |
| 1. PB | GO:0007157 | heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules |
| 1. PB | GO:0045184 | establishment of protein localization |
| 1. PB | GO:0099542 | trans-synaptic signaling by endocannabinoid |
| 1. PB | GO:0007612 | learning |
| 1. PB | GO:0005105 | type 1 fibroblast growth factor receptor binding |
| 1. PB | GO:0008037 | cell recognition |
| 1. PB | GO:0097120 | receptor localization to synapse |
| 1. PB | GO:0035176 | social behavior |
| 1. PB | GO:0099059 | integral component of presynaptic active zone membrane |
| 1. PB | GO:1903078 | positive regulation of protein localization to plasma membrane |
| 1. PB | GO:0098793 | presynapse |
| 1. PB | GO:0030534 | adult behavior |
| 1. PB | GO:0033138 | positive regulation of peptidyl-serine phosphorylation |
| 1. PB | GO:0043025 | neuronal cell body |
| 1. PB | GO:0038023 | signaling receptor activity |
| 1. PB | GO:0097105 | presynaptic membrane assembly |
| 1. PB | GO:0035418 | protein localization to synapse |
| 1. PB | GO:1905606 | regulation of presynapse assembly |
| 1. PB | GO:0042297 | vocal learning |
| 1. PB | GO:0090129 | positive regulation of synapse maturation |
| 1. PB | GO:2000310 | regulation of NMDA receptor activity |
| 1. PB | GO:0016339 | calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules |
| 1. PB | GO:0051897 | positive regulation of protein kinase B signaling |
| 1. PB | GO:0099150 | regulation of postsynaptic specialization assembly |
| 1. PB | GO:0042734 | presynaptic membrane |
| 1. PB | GO:0042551 | neuron maturation |
| 1. PB | GO:0097119 | postsynaptic density protein 95 clustering |
| 1. PB | GO:0097112 | gamma-aminobutyric acid receptor clustering |
| 1. PB | GO:0099560 | synaptic membrane adhesion |
| 1. PB | GO:0007158 | neuron cell-cell adhesion |
| 1. PB | GO:0044295 | axonal growth cone |
| 1. PB | GO:0005102 | signaling receptor binding |
| 1. PB | GO:0033130 | acetylcholine receptor binding |
| 1. PB | GO:0048306 | calcium-dependent protein binding |
| 1. PB | GO:0046847 | filopodium assembly |
| 1. PB | GO:0070374 | positive regulation of ERK1 and ERK2 cascade |
| 1. PB | GO:0045743 | positive regulation of fibroblast growth factor receptor signaling pathway |
| 1. PB | GO:0097117 | guanylate kinase-associated protein clustering |
| 1. PB | GO:0098685 | Schaffer collateral - CA1 synapse |
| 1. PB | GO:0099056 | integral component of presynaptic membrane |
| 1. PB | GO:0007155 | cell adhesion |
| 1. PB | GO:2000463 | positive regulation of excitatory postsynaptic potential |
| 1. PB | GO:0023041 | neuronal signal transduction |
| 1. PB | GO:0051968 | positive regulation of synaptic transmission, glutamatergic |
| 1. PB | GO:0007269 | neurotransmitter secretion |
| 1. PB | GO:0090126 | protein-containing complex assembly involved in synapse maturation |
| 1. PB | GO:0001525 | angiogenesis |
| 1. PB | GO:0071277 | cellular response to calcium ion |
| 1. PB | GO:0050839 | cell adhesion molecule binding |
| 1. PB | GO:2000311 | regulation of AMPA receptor activity |
| 1. PB | GO:0098982 | GABA-ergic synapse |
| 1. PB | GO:0098693 | regulation of synaptic vesicle cycle |
| 1. PB | GO:0016021 | integral component of membrane |
| 1. PB | GO:0031175 | neuron projection development |
| 1. PB | GO:0051965 | positive regulation of synapse assembly |
| 1. PB | GO:0021707 | cerebellar granule cell differentiation |
| 1. PB | GO:0032991 | protein-containing complex |
| 1. PB | GO:0097114 | NMDA glutamate receptor clustering |
| 1. PB | GO:0099151 | regulation of postsynaptic density assembly |
| 1. PB | GO:2000821 | regulation of grooming behavior |
| 1. PB | GO:0004888 | transmembrane signaling receptor activity |
| 1. PB | GO:0031982 | vesicle |
| 1. PB | GO:0051490 | negative regulation of filopodium assembly |
| 1. PB | GO:0097116 | gephyrin clustering involved in postsynaptic density assembly |
| 2. P | GO:0005125 | cytokine activity |
| 2. P | GO:0033005 | positive regulation of mast cell activation |
| 2. P | GO:0016338 | calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules |
| 2. P | GO:0030175 | filopodium |
| 2. P | GO:0032496 | response to lipopolysaccharide |
| 2. P | GO:0033026 | negative regulation of mast cell apoptotic process |
| 2. P | GO:0001786 | phosphatidylserine binding |
| 2. P | GO:0001541 | ovarian follicle development |
| 2. P | GO:0005173 | stem cell factor receptor binding |
| 2. P | GO:0043277 | apoptotic cell clearance |
| 2. P | GO:0002687 | positive regulation of leukocyte migration |
| 2. P | GO:0035234 | ectopic germ cell programmed cell death |
| 2. P | GO:0008083 | growth factor activity |
| 2. P | GO:0001618 | virus receptor activity |
| 2. P | GO:0019862 | IgA binding |
| 2. P | GO:0002763 | positive regulation of myeloid leukocyte differentiation |
| 2. P | GO:0045954 | positive regulation of natural killer cell mediated cytotoxicity |
| 2. P | GO:0098880 | maintenance of postsynaptic specialization structure |
| 2. P | GO:1901534 | positive regulation of hematopoietic progenitor cell differentiation |
| 2. P | GO:0009611 | response to wounding |
| 2. P | GO:0010046 | response to mycotoxin |
| 2. P | GO:0051606 | detection of stimulus |
| 2. P | GO:0046579 | positive regulation of Ras protein signal transduction |
| 2. P | GO:0008284 | positive regulation of cell population proliferation |
| 2. P | GO:0030027 | lamellipodium |
| 2. P | GO:0097021 | lymphocyte migration into lymphoid organs |
| 2. P | GO:0005886 | plasma membrane |
| 2. P | GO:0042010 | interleukin-15 receptor activity |
| 2. P | GO:0006911 | phagocytosis, engulfment |
| 2. P | GO:0005903 | brush border |
| 2. P | GO:0032825 | positive regulation of natural killer cell differentiation |
| 2. P | GO:0098942 | retrograde trans-synaptic signaling by trans-synaptic protein complex |
| 2. P | GO:0035162 | embryonic hemopoiesis |
| 2. P | GO:0001755 | neural crest cell migration |
| 2. P | GO:0035723 | interleukin-15-mediated signaling pathway |
| 2. P | GO:0044156 | host cell junction |
| 2. P | GO:0043406 | positive regulation of MAP kinase activity |
| 2. P | GO:0097192 | extrinsic apoptotic signaling pathway in absence of ligand |
| 2. P | GO:0045636 | positive regulation of melanocyte differentiation |
| 2. P | GO:0042271 | susceptibility to natural killer cell mediated cytotoxicity |
| 2. P | GO:0005856 | cytoskeleton |
| 2. P | GO:0070668 | positive regulation of mast cell proliferation |
| 2. P | GO:0060077 | inhibitory synapse |
| 2. P | GO:0050731 | positive regulation of peptidyl-tyrosine phosphorylation |
| 2. P | GO:0070287 | ferritin receptor activity |
| 2. P | GO:0042110 | T cell activation |
| 2. P | GO:0001791 | IgM binding |
| 2. P | GO:1902035 | positive regulation of hematopoietic stem cell proliferation |
| 2. P | GO:0008584 | male gonad development |
| 3. B | GO:0030198 | extracellular matrix organization |
| 3. B | GO:0033010 | paranodal junction |
| 3. B | GO:0021682 | nerve maturation |
| 3. B | GO:0007156 | homophilic cell adhesion via plasma membrane adhesion molecules |
| 3. B | GO:0009888 | tissue development |
| 3. B | GO:0030913 | paranodal junction assembly |
| 3. B | GO:0005608 | laminin-3 complex |
| 3. B | GO:0005201 | extracellular matrix structural constituent |
| 3. B | GO:0002011 | morphogenesis of an epithelial sheet |
| 3. B | GO:0005796 | Golgi lumen |
| 3. B | GO:1905907 | negative regulation of amyloid fibril formation |
| 3. B | GO:0001738 | morphogenesis of a polarized epithelium |
| 3. B | GO:0048786 | presynaptic active zone |
| 3. B | GO:0043083 | synaptic cleft |
| 3. B | GO:0030424 | axon |
| 3. B | GO:0008366 | axon ensheathment |
| 3. B | GO:1902669 | positive regulation of axon guidance |
| 3. B | GO:0030334 | regulation of cell migration |
| 3. B | GO:1905962 | glutamatergic neuron differentiation |
| 3. B | GO:0030021 | extracellular matrix structural constituent conferring compression resistance |
| 3. B | GO:0001737 | establishment of imaginal disc-derived wing hair orientation |
| 3. B | GO:0005911 | cell-cell junction |
| 3. B | GO:0035159 | regulation of tube length, open tracheal system |
| 3. B | GO:0045995 | regulation of embryonic development |
| 3. B | GO:0007517 | muscle organ development |
| 3. B | GO:0032225 | regulation of synaptic transmission, dopaminergic |
| 3. B | GO:0008038 | neuron recognition |
| 3. B | GO:0060076 | excitatory synapse |
| 3. B | GO:0032228 | regulation of synaptic transmission, GABAergic |
| 3. B | GO:0048846 | axon extension involved in axon guidance |
| 3. B | GO:0050885 | neuromuscular process controlling balance |
| 3. B | GO:0009887 | animal organ morphogenesis |
| 3. B | GO:0044309 | neuron spine |
| 3. B | GO:0033270 | paranode region of axon |
| 3. B | GO:0048787 | presynaptic active zone membrane |
| 3. B | GO:0060351 | cartilage development involved in endochondral bone morphogenesis |
| 3. B | GO:0019991 | septate junction assembly |
| 3. B | GO:0007420 | brain development |
| 3. B | GO:0017124 | SH3 domain binding |
| 3. B | GO:0098595 | perivitelline space |
| 3. B | GO:0008076 | voltage-gated potassium channel complex |
| 3. B | GO:0044224 | juxtaparanode region of axon |
| 3. B | GO:0042995 | cell projection |
| 3. B | GO:0005919 | pleated septate junction |
| 3. B | GO:0031581 | hemidesmosome assembly |
| 3. B | GO:0016318 | ommatidial rotation |
| 3. B | GO:0048057 | R3/R4 development |
| 3. B | GO:0061304 | retinal blood vessel morphogenesis |
| 3. B | GO:0035151 | regulation of tube size, open tracheal system |
| 3. B | GO:0071205 | protein localization to juxtaparanode region of axon |
| 3. B | GO:0002040 | sprouting angiogenesis |
| 3. B | GO:0061343 | cell adhesion involved in heart morphogenesis |
| 3. B | GO:0120163 | negative regulation of cold-induced thermogenesis |
| 3. B | GO:0060298 | positive regulation of sarcomere organization |
| 3. B | GO:0072553 | terminal button organization |
| 3. B | GO:0060857 | establishment of glial blood-brain barrier |
| 3. B | GO:0005614 | interstitial matrix |
| 3. B | GO:0022010 | central nervous system myelination |
| 3. B | GO:0021756 | striatum development |
| 3. B | GO:2000300 | regulation of synaptic vesicle exocytosis |
| 3. B | GO:0005509 | calcium ion binding |
| 3. B | GO:0007411 | axon guidance |
| 3. B | GO:0060548 | negative regulation of cell death |
| 3. B | GO:0005606 | laminin-1 complex |
| 3. B | GO:0048841 | regulation of axon extension involved in axon guidance |
| 3. B | GO:0022011 | myelination in peripheral nervous system |
| 3. B | GO:0008022 | protein C-terminus binding |
| 3. B | GO:0021794 | thalamus development |
| 3. B | GO:0006898 | receptor-mediated endocytosis |
| 3. B | GO:0045163 | clustering of voltage-gated potassium channels |
| 3. B | GO:0050774 | negative regulation of dendrite morphogenesis |
| 3. B | GO:0071109 | superior temporal gyrus development |
| 3. B | GO:0031012 | extracellular matrix |
| 3. B | GO:0045463 | R8 cell development |
| 3. B | GO:1905905 | pharyngeal gland morphogenesis |
| 3. B | GO:0007427 | epithelial cell migration, open tracheal system |
| 3. B | GO:0060465 | pharynx development |
| 3. B | GO:0007010 | cytoskeleton organization |
| 3. B | GO:0005539 | glycosaminoglycan binding |
| 3. B | GO:0021761 | limbic system development |
| 3. B | GO:0043208 | glycosphingolipid binding |
| 3. B | GO:0030673 | axolemma |
| 3. B | GO:0048644 | muscle organ morphogenesis |
| 3. B | GO:0030155 | regulation of cell adhesion |
| 3. B | GO:1903746 | positive regulation of pharyngeal pumping |
| 3. B | GO:0003015 | heart process |
| 3. B | GO:0060445 | branching involved in salivary gland morphogenesis |
| 3. B | GO:0051963 | regulation of synapse assembly |
| 3. B | GO:0019800 | peptide cross-linking via chondroitin 4-sulfate glycosaminoglycan |
| 3. B | GO:0048812 | neuron projection morphogenesis |
| 3. B | GO:0002175 | protein localization to paranode region of axon |
| 3. B | GO:0005604 | basement membrane |
| 3. B | GO:0042067 | establishment of ommatidial planar polarity |
| 3. B | GO:0044331 | cell-cell adhesion mediated by cadherin |
| 3. B | GO:0008039 | synaptic target recognition |
| 3. B | GO:0050884 | neuromuscular process controlling posture |
| 3. B | GO:0062023 | collagen-containing extracellular matrix |
| 3. B | GO:0010811 | positive regulation of cell-substrate adhesion |
| 3. B | GO:0019227 | neuronal action potential propagation |
| 3. B | GO:1903598 | positive regulation of gap junction assembly |
| 3. B | GO:0045467 | R7 cell development |
| 3. B | GO:0007412 | axon target recognition |
| 3. B | GO:0060279 | positive regulation of ovulation |
| 3. B | GO:0005918 | septate junction |
| 3. B | GO:0021782 | glial cell development |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | A1XQX3 | Neurexin-1b-beta | 1.06e-04 | 6.64e-16 | 1.34e-85 |
| 1. PB | A1XQY0 | Neurexin-3a-beta | 1.67e-07 | 2.08e-66 | 0.0 |
| 1. PB | Q9HDB5 | Neurexin-3-beta | 0 | 3.09e-134 | 0.0 |
| 1. PB | A1XQY3 | Neurexin-3b-beta | 2.96e-11 | 5.02e-63 | 0.0 |
| 1. PB | Q63376 | Neurexin-2-beta | 7.24e-05 | 5.82e-49 | 0.0 |
| 1. PB | D0PRN2 | Neurexin-1-beta | 1.21e-04 | 5.47e-16 | 3.13e-119 |
| 1. PB | D0PRN4 | Neurexin-3-beta | 8.48e-10 | 5.81e-75 | 0.0 |
| 1. PB | P0DI97 | Neurexin-1-beta | 6.73e-06 | 9.27e-19 | 1.43e-122 |
| 1. PB | Q8C985 | Neurexin-3-beta | 9.15e-06 | 3.29e-57 | 0.0 |
| 1. PB | Q28142 | Neurexin-1-beta | 2.02e-05 | 2.92e-20 | 1.53e-122 |
| 1. PB | Q63373 | Neurexin-1-beta | 6.61e-04 | 2.56e-19 | 1.42e-122 |
| 1. PB | P58400 | Neurexin-1-beta | 2.88e-05 | 3.39e-17 | 1.97e-122 |
| 1. PB | Q28143 | Neurexin-3-beta | 1.68e-06 | 1.60e-19 | 0.0 |
| 1. PB | P58401 | Neurexin-2-beta | 3.11e-06 | 4.73e-48 | 0.0 |
| 1. PB | A1XQX1 | Neurexin-1a-beta | 1.28e-04 | 5.42e-19 | 2.37e-99 |
| 2. P | Q6U7R4 | T-cell immunoglobulin and mucin domain-containing protein 4 | 1.80e-01 | 4.62e-03 | NA |
| 2. P | Q6UDF5 | Envelope glycoprotein I | NA | 1.05e-03 | NA |
| 2. P | B6KAM0 | Apical membrane antigen 1 | 8.89e-01 | 6.35e-05 | NA |
| 2. P | Q29030 | Kit ligand | 6.80e-01 | 7.58e-03 | NA |
| 2. P | Q2TB54 | High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor | 1.44e-01 | 1.29e-03 | NA |
| 2. P | B6K9M7 | Apical membrane antigen 1-like protein | 7.08e-01 | 7.02e-03 | NA |
| 2. P | P16445 | Apical membrane antigen 1 | 8.81e-01 | 2.04e-04 | NA |
| 2. P | P79169 | Kit ligand | 6.89e-01 | 2.00e-02 | NA |
| 2. P | Q5QNS5 | Hepatitis A virus cellular receptor 1 homolog | 5.67e-01 | 1.05e-02 | NA |
| 2. P | P50490 | Apical membrane antigen 1 | 6.94e-01 | 2.44e-02 | NA |
| 2. P | Q2LA85 | Trem-like transcript 2 protein | 1.84e-01 | 6.75e-03 | NA |
| 2. P | Q6AYP5 | Cell adhesion molecule 1 | 4.50e-01 | 3.79e-03 | NA |
| 2. P | Q5T2D2 | Trem-like transcript 2 protein | 8.12e-02 | 2.01e-03 | NA |
| 2. P | Q8R183 | T-cell immunoglobulin and mucin domain-containing protein 2 | 2.18e-01 | 3.30e-03 | NA |
| 2. P | Q60819 | Interleukin-15 receptor subunit alpha | 3.63e-01 | 4.65e-02 | NA |
| 2. P | P21583 | Kit ligand | 6.44e-01 | 3.53e-02 | NA |
| 2. P | P21581 | Kit ligand | 4.91e-01 | 8.85e-03 | NA |
| 2. P | O54947 | Hepatitis A virus cellular receptor 1 homolog | 2.92e-01 | 5.95e-03 | NA |
| 2. P | P21303 | Merozoite receptor PK66 | 9.02e-01 | 1.52e-02 | NA |
| 2. P | Q95M19 | Kit ligand | 6.88e-01 | 2.20e-02 | NA |
| 2. P | P16893 | Thrombospondin-related anonymous protein | 3.05e-01 | 2.73e-02 | NA |
| 2. P | Q96H15 | T-cell immunoglobulin and mucin domain-containing protein 4 | 3.36e-01 | 4.59e-06 | NA |
| 2. P | P79368 | Kit ligand (Fragment) | 7.50e-01 | 6.89e-04 | NA |
| 3. B | P97927 | Laminin subunit alpha-4 | 5.01e-01 | NA | 0.003 |
| 3. B | E9Q7X7 | Neurexin-2 | 1.89e-02 | NA | 0.0 |
| 3. B | Q9V5N8 | Protocadherin-like wing polarity protein stan | NA | NA | 0.018 |
| 3. B | O15943 | Neural-cadherin | NA | NA | 0.043 |
| 3. B | Q94887 | Neurexin-4 | 2.03e-02 | NA | 5.69e-05 |
| 3. B | Q96NU0 | Contactin-associated protein-like 3B | 6.25e-02 | NA | 0.002 |
| 3. B | Q5RD64 | Contactin-associated protein-like 2 | 8.42e-02 | NA | 0.015 |
| 3. B | Q0V8T4 | Contactin-associated protein like 5-3 | 5.90e-02 | NA | 8.16e-05 |
| 3. B | Q9DDD0 | Neurexin-1 (Fragment) | 4.72e-02 | NA | 3.09e-90 |
| 3. B | Q0V8T7 | Contactin-associated protein like 5-3 | 3.78e-02 | NA | 2.10e-05 |
| 3. B | Q0V8T0 | Contactin-associated protein-like 5 | 4.08e-01 | NA | 0.008 |
| 3. B | Q9VJB6 | Putative neural-cadherin 2 | 5.34e-01 | NA | 0.036 |
| 3. B | Q0V8T3 | Contactin-associated protein like 5-4 | 1.09e-01 | NA | 0.003 |
| 3. B | Q9Y4C0 | Neurexin-3 | 1.65e-02 | NA | 0.0 |
| 3. B | Q9BZ76 | Contactin-associated protein-like 3 | 2.66e-02 | NA | 0.002 |
| 3. B | P98160 | Basement membrane-specific heparan sulfate proteoglycan core protein | NA | NA | 0.030 |
| 3. B | Q9CS84 | Neurexin-1 | 2.35e-02 | NA | 1.97e-92 |
| 3. B | D0PRN3 | Neurexin-3 | 2.76e-02 | NA | 0.0 |
| 3. B | P04921 | Glycophorin-C | 5.01e-01 | NA | 0.035 |
| 3. B | A1XQX0 | Neurexin-1a | 5.32e-02 | NA | 1.33e-85 |
| 3. B | Q8WYK1 | Contactin-associated protein-like 5 | 3.46e-01 | NA | 0.002 |
| 3. B | Q0V8T8 | Contactin-associated protein like 5-2 | 2.94e-02 | NA | 0.002 |
| 3. B | Q63374 | Neurexin-2 | 1.07e-02 | NA | 0.0 |
| 3. B | P49415 | Syndecan | 5.81e-02 | NA | 0.005 |
| 3. B | Q16363 | Laminin subunit alpha-4 | 3.58e-01 | NA | 0.041 |
| 3. B | Q63HQ2 | Pikachurin | 6.32e-02 | NA | 0.003 |
| 3. B | Q6P9K9 | Neurexin-3 | 1.42e-03 | NA | 1.58e-142 |
| 3. B | Q0V8S9 | Contactin-associated protein-like 5 | 1.87e-01 | NA | 3.81e-06 |
| 3. B | Q07310 | Neurexin-3 | 1.58e-02 | NA | 2.10e-141 |
| 3. B | P25391 | Laminin subunit alpha-1 | NA | NA | 0.030 |
| 3. B | Q9P2S2 | Neurexin-2 | 7.07e-02 | NA | 0.0 |
| 3. B | Q9ULB1 | Neurexin-1 | 1.38e-01 | NA | 4.59e-98 |
| 3. B | B4F785 | Pikachurin | 2.65e-02 | NA | 0.008 |
| 3. B | O54991 | Contactin-associated protein 1 | 5.81e-01 | NA | 1.58e-05 |
| 3. B | Q0V8T6 | Contactin-associated protein like 5-1 | 8.90e-02 | NA | 0.001 |
| 3. B | Q0V8T9 | Contactin-associated protein like 5-1 | 7.62e-02 | NA | 0.005 |
| 3. B | Q05793 | Basement membrane-specific heparan sulfate proteoglycan core protein | NA | NA | 0.035 |
| 3. B | Q9C0A0 | Contactin-associated protein-like 4 | 3.96e-02 | NA | 1.48e-05 |
| 3. B | A1XQX8 | Neurexin-3a | 1.08e-02 | NA | 0.0 |
| 3. B | Q4VBE4 | Pikachurin | 5.73e-02 | NA | 0.003 |
| 3. B | A1XQY1 | Neurexin-3b | 6.92e-03 | NA | 0.0 |
| 3. B | Q28146 | Neurexin-1 | 1.44e-01 | NA | 3.61e-92 |
| 3. B | Q0V8T5 | Contactin-associated protein like 5-2 | 5.95e-02 | NA | 5.22e-04 |
| 3. B | Q99P47 | Contactin-associated protein-like 4 | 1.53e-02 | NA | 1.06e-05 |
| 3. B | A1XQX2 | Neurexin-1b | 6.90e-02 | NA | 2.96e-71 |
| 3. B | P78357 | Contactin-associated protein 1 | 1.06e-01 | NA | 1.66e-05 |
| 3. B | Q9CPW0 | Contactin-associated protein-like 2 | 1.46e-01 | NA | 0.003 |
| 3. B | P97846 | Contactin-associated protein 1 | 9.08e-02 | NA | 3.39e-05 |
| 3. B | Q19617 | Neurexin like receptor 1 | 3.43e-01 | NA | 0.037 |
| 3. B | Q9UHC6 | Contactin-associated protein-like 2 | 8.51e-02 | NA | 0.004 |
| 3. B | Q63372 | Neurexin-1 | 1.59e-02 | NA | 1.56e-91 |
| 3. B | Q06561 | Basement membrane proteoglycan | NA | NA | 7.84e-06 |
| 3. B | A3KN33 | Pikachurin | 8.28e-02 | NA | 0.002 |