Summary

Q9NQR7

Homolog: Q3UHB8.
Function: Coiled-coil domain-containing protein 177.

Statistics

Total GO Annotation: 136
Unique PROST Go: 113
Unique BLAST Go: 22

Total Homologs: 85
Unique PROST Homologs: 76
Unique BLAST Homologs: 5

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q3UHB8 (Coiled-coil domain-containing protein 177) with a FATCAT P-Value: 6.24e-11 and RMSD of 5.47 angstrom. The sequence alignment identity is 90.6%.
Structural alignment shown in left. Query protein Q9NQR7 colored as red in alignment, homolog Q3UHB8 colored as blue. Query protein Q9NQR7 is also shown in right top, homolog Q3UHB8 showed in right bottom. They are colored based on secondary structures. 

  Q9NQR7 MVDPVPEEEKAGAEPGDSGGDEAVASVPPDSQGAQEPAASSASASASAAVPRKAEVPCAAAEGGRREQSPLLHLDLFNFDCPEAEGSRYVLTSPRSLEAC 100
  Q3UHB8 MVDPVPEEEKEGAEPGGSEGDEATASEPPDAQGAQQPAASSASASAAA--PRKAEVPC-GAEGGRREQSPLLHLDLFNFACPEAEGSRYVLTSPRSLEAC 97

  Q9NQR7 ARCAVKPVELLPRALADLVREAPGRSMRVATGLYEAYEAERRAKLQQCRAERERIMREEKRRLFTPLSPAA--AAAAAAAAASAPSAGSSSSC-SSASLP 197
  Q3UHB8 ARCAVKPVELLPRALADLVREAPGRSMRVATGLYEAYEAERLAKLQQCRAERERIMREEKRRLFTPKGPAAAPASASASASASALSGGSSSSCSSSSSLP 197

  Q9NQR7 ASPAPRAARKASPSPSSARTQPPPAGSRTGRKSHSLDSLSRRREGALSSESGASSSSYSGESLRELRWPPRASARNSCPAGSASSTTNAP-GRPSALTLV 296
  Q3UHB8 ASPASRVARRTSPSP-PARSRPPPAGSRTGRKSHSLDSLSRRRDGALSSESGASSSSYSGESLRELRWPPRASARNSCPAGSASSAPN-PLGRPSALALV 295

  Q9NQR7 PITGRSFSLGDLSHSPQTAQHVERIVRQVRAERGLRGVPERDRKIAALMLARHQEELLLLEQRAAAHGQWELQRVHAKQRREREEREKQRALEQGRRAWA 396
  Q3UHB8 PLTARSFSLGDLSHSPQTAQHVERIVRQVRAERGLRGVPERDRKIAALMLARHQEERLLLEQRAAAHGQWEQQRVRAEQRREREEREKQRALERGRRAWA 395

  Q9NQR7 AQVEERRGRRGREEREAARRRQRQYERSEERRRELAERQGLLRRERAERAAREDRLRKLQQEQNLKQREEGLQEGRERAEQIRRERAQRAARAKQRQEGQ 496
  Q3UHB8 AQVEERRGRRGREEREAARRRQQQCERSEERRRELAERQGLLRRERVERAARDDRLRKLQQEQNLKQREEGRQEGRERAELVRRERAQRAARARERQEGQ 495

  Q9NQR7 LQREKRELSRAERARHEALLQGRTRQQRQEREGLRSSLEASLGRAQENYEHLVEQRTRELRERARREELQGRRAKEAAERKEREHQAHLEALARAGERRL 596
  Q3UHB8 LQREKRELSRAERARHEALLRGRVRQQQEEREGLRSSLEASLGRAQENYEQLQEQRARELRERARREELQGRRAKEAAERKEREHQAHLEALARAGERRL 595

  Q9NQR7 QHATQVAEEAVQQKARRVGQSRLEKERAQRANKEKVERDEDCRRRELLQAIGRKLERSEQLTRERRSALESARSTARASFHVREKVREETNTRSFDRMVR 696
  Q3UHB8 QHAAQVAEEAVQQKARRVVQTRLEKERAQRANKEKVERDEDCRRRELLQAIGRKLERSEQLSRERRSALESARSTARASFHVREKVREETNTRSFDRMVR 695

  Q9NQR7 EAQLHASLDRK 707
  Q3UHB8 EAQLHASLDRK 706

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0016020 membrane
2. P GO:0036126 sperm flagellum
2. P GO:0010555 response to mannitol
2. P GO:0051257 meiotic spindle midzone assembly
2. P GO:0010369 chromocenter
2. P GO:0019904 protein domain specific binding
2. P GO:0046621 negative regulation of organ growth
2. P GO:0005874 microtubule
2. P GO:0031110 regulation of microtubule polymerization or depolymerization
2. P GO:0071593 lymphocyte aggregation
2. P GO:0000349 generation of catalytic spliceosome for first transesterification step
2. P GO:0005819 spindle
2. P GO:0006281 DNA repair
2. P GO:0031115 negative regulation of microtubule polymerization
2. P GO:0008022 protein C-terminus binding
2. P GO:0048306 calcium-dependent protein binding
2. P GO:0046330 positive regulation of JNK cascade
2. P GO:0031122 cytoplasmic microtubule organization
2. P GO:0007026 negative regulation of microtubule depolymerization
2. P GO:0030027 lamellipodium
2. P GO:0032126 eisosome
2. P GO:0043515 kinetochore binding
2. P GO:0043539 protein serine/threonine kinase activator activity
2. P GO:0051310 metaphase plate congression
2. P GO:0046602 regulation of mitotic centrosome separation
2. P GO:0000793 condensed chromosome
2. P GO:0030426 growth cone
2. P GO:0006468 protein phosphorylation
2. P GO:1901985 positive regulation of protein acetylation
2. P GO:0030496 midbody
2. P GO:0048036 central complex development
2. P GO:0031489 myosin V binding
2. P GO:1990385 meiotic spindle midzone
2. P GO:0031117 positive regulation of microtubule depolymerization
2. P GO:0106310 protein serine kinase activity
2. P GO:0006974 cellular response to DNA damage stimulus
2. P GO:0001835 blastocyst hatching
2. P GO:0000226 microtubule cytoskeleton organization
2. P GO:0043408 regulation of MAPK cascade
2. P GO:0046329 negative regulation of JNK cascade
2. P GO:0008017 microtubule binding
2. P GO:0005930 axoneme
2. P GO:0061966 establishment of left/right asymmetry
2. P GO:0060631 regulation of meiosis I
2. P GO:0071902 positive regulation of protein serine/threonine kinase activity
2. P GO:0016319 mushroom body development
2. P GO:0090307 mitotic spindle assembly
2. P GO:1990023 mitotic spindle midzone
2. P GO:0046777 protein autophosphorylation
2. P GO:0016740 transferase activity
2. P GO:0048487 beta-tubulin binding
2. P GO:0032956 regulation of actin cytoskeleton organization
2. P GO:0000070 mitotic sister chromatid segregation
2. P GO:0007059 chromosome segregation
2. P GO:0007019 microtubule depolymerization
2. P GO:0016572 histone phosphorylation
2. P GO:0042803 protein homodimerization activity
2. P GO:0010032 meiotic chromosome condensation
2. P GO:0043014 alpha-tubulin binding
2. P GO:0048471 perinuclear region of cytoplasm
2. P GO:0070050 neuron cellular homeostasis
2. P GO:0000775 chromosome, centromeric region
2. P GO:0048032 galacturonate binding
2. P GO:0010977 negative regulation of neuron projection development
2. P GO:0004672 protein kinase activity
2. P GO:0043005 neuron projection
2. P GO:0048812 neuron projection morphogenesis
2. P GO:0000235 astral microtubule
2. P GO:0019901 protein kinase binding
2. P GO:0005818 aster
2. P GO:0043087 regulation of GTPase activity
2. P GO:0004674 protein serine/threonine kinase activity
2. P GO:0090160 Golgi to lysosome transport
2. P GO:0005794 Golgi apparatus
2. P GO:0000800 lateral element
2. P GO:2000401 regulation of lymphocyte migration
2. P GO:0043025 neuronal cell body
2. P GO:0035332 positive regulation of hippo signaling
2. P GO:0050942 positive regulation of pigment cell differentiation
2. P GO:1990090 cellular response to nerve growth factor stimulus
2. P GO:0031175 neuron projection development
2. P GO:0005813 centrosome
2. P GO:0002177 manchette
2. P GO:0015630 microtubule cytoskeleton
2. P GO:0106311
2. P GO:0030295 protein kinase activator activity
2. P GO:0051493 regulation of cytoskeleton organization
2. P GO:0070507 regulation of microtubule cytoskeleton organization
2. P GO:0043507 positive regulation of JUN kinase activity
2. P GO:0043051 regulation of pharyngeal pumping
2. P GO:0016310 phosphorylation
2. P GO:0035646 endosome to melanosome transport
2. P GO:0000281 mitotic cytokinesis
2. P GO:0035021 negative regulation of Rac protein signal transduction
2. P GO:0005721 pericentric heterochromatin
2. P GO:0000165 MAPK cascade
2. P GO:0060236 regulation of mitotic spindle organization
2. P GO:0007095 mitotic G2 DNA damage checkpoint signaling
2. P GO:0051665 membrane raft localization
2. P GO:0015631 tubulin binding
2. P GO:0035556 intracellular signal transduction
2. P GO:0097194 execution phase of apoptosis
2. P GO:0032874 positive regulation of stress-activated MAPK cascade
2. P GO:0032147 activation of protein kinase activity
2. P GO:0000776 kinetochore
2. P GO:0000801 central element
2. P GO:0044782 cilium organization
2. P GO:0051233 spindle midzone
2. P GO:0036335 intestinal stem cell homeostasis
2. P GO:0097729 9+2 motile cilium
2. P GO:0032133 chromosome passenger complex
2. P GO:1902412 regulation of mitotic cytokinesis
2. P GO:0010976 positive regulation of neuron projection development
2. P GO:0051225 spindle assembly
3. B GO:0044650 adhesion of symbiont to host cell
3. B GO:0002224 toll-like receptor signaling pathway
3. B GO:0002064 epithelial cell development
3. B GO:0007420 brain development
3. B GO:0098609 cell-cell adhesion
3. B GO:0008201 heparin binding
3. B GO:0016324 apical plasma membrane
3. B GO:0060438 trachea development
3. B GO:0044647 host-symbiont bicellular tight junction
3. B GO:0003341 cilium movement
3. B GO:0020008 rhoptry
3. B GO:0004888 transmembrane signaling receptor activity
3. B GO:0044409 entry into host
3. B GO:0006955 immune response
3. B GO:1904158 axonemal central apparatus assembly
3. B GO:1990225 rhoptry neck
3. B GO:0046789 host cell surface receptor binding
3. B GO:0005615 extracellular space
3. B GO:0021591 ventricular system development
3. B GO:0070160 tight junction
3. B GO:1990718 axonemal central pair projection
3. B GO:1990716 axonemal central apparatus

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q8N715 Coiled-coil domain-containing protein 185 9.65e-06 2.85e-20 1.17e-05
1. PB Q9NQR7 Coiled-coil domain-containing protein 177 0 2.16e-155 0.0
1. PB Q5R694 Coiled-coil domain-containing protein 177 6.44e-11 5.68e-124 0.0
1. PB Q3UHB8 Coiled-coil domain-containing protein 177 6.24e-11 1.04e-91 0.0
2. P P38282 Pre-mRNA-splicing factor SPP381 3.75e-02 3.22e-02 NA
2. P Q80ZU5 Coiled-coil domain-containing protein 181 3.81e-02 2.68e-03 NA
2. P P46549 Serine/threonine-protein kinase SULU 4.11e-04 6.94e-03 NA
2. P Q93045 Stathmin-2 5.48e-03 1.34e-02 NA
2. P Q5TID7 Coiled-coil domain-containing protein 181 3.30e-02 1.14e-02 NA
2. P P63042 Stathmin-4 1.64e-02 3.28e-03 NA
2. P O13024 Inner centromere protein A 2.45e-03 5.83e-04 NA
2. P F1NBT0 Serine/threonine-protein kinase 10 4.69e-04 1.21e-03 NA
2. P Q66MI6 Testis-specific protein 10-interacting protein 7.10e-02 2.85e-04 NA
2. P Q5XI03 Centrosomal protein of 95 kDa 6.12e-03 1.84e-02 NA
2. P Q90987 Stathmin-2 1.11e-02 9.89e-03 NA
2. P O70166 Stathmin-3 1.23e-02 1.41e-04 NA
2. P Q9M2D8 Uncharacterized protein At3g61260 3.37e-03 5.31e-03 NA
2. P Q9H2K8 Serine/threonine-protein kinase TAO3 2.72e-06 1.76e-05 NA
2. P Q9H169 Stathmin-4 1.39e-02 8.79e-03 NA
2. P Q0KHQ5 Serine/threonine-protein kinase Tao 8.71e-04 9.56e-04 NA
2. P Q0IHQ8 Serine/threonine-protein kinase 10 2.59e-04 1.08e-03 NA
2. P A4IFK9 Stathmin-3 1.31e-01 4.92e-04 NA
2. P Q2KJH5 Cilia- and flagella-associated protein 97 5.03e-01 4.52e-04 NA
2. P P21818 Stathmin-2 7.96e-03 5.95e-04 NA
2. P Q7L7X3 Serine/threonine-protein kinase TAO1 4.71e-07 1.46e-03 NA
2. P Q18452 Protein maph-9 1.46e-03 3.86e-05 NA
2. P Q09002 Stathmin-2-B 1.10e-02 5.01e-05 NA
2. P E1BK52 Serine/threonine-protein kinase 10 1.01e-03 8.98e-04 NA
2. P Q9JHU6 Stathmin-3 5.01e-03 2.99e-03 NA
2. P O88664 Serine/threonine-protein kinase TAO1 5.35e-06 7.28e-04 NA
2. P Q5R4F3 Serine/threonine-protein kinase TAO3 1.34e-05 2.57e-05 NA
2. P Q6AYN9 Coiled-coil domain-containing protein 181 1.50e-02 1.23e-03 NA
2. P A5A777 Biogenesis of lysosome-related organelles complex 1 subunit 5 3.64e-04 4.04e-02 NA
2. P Q09001 Stathmin-2-A 1.24e-02 8.98e-06 NA
2. P Q5F2E8 Serine/threonine-protein kinase TAO1 1.13e-04 9.66e-04 NA
2. P Q09004 Stathmin-4 3.77e-02 6.35e-03 NA
2. P Q7SY52 Serine/threonine-protein kinase 10 2.56e-04 1.58e-02 NA
2. P E9PTG8 Serine/threonine-protein kinase 10 2.26e-03 2.93e-03 NA
2. P Q9UL16 Cilia- and flagella-associated protein 45 1.28e-06 1.24e-03 NA
2. P Q49MG5 Microtubule-associated protein 9 5.69e-02 2.75e-05 NA
2. P P53352 Inner centromere protein 4.23e-03 1.66e-03 NA
2. P Q9NQS7 Inner centromere protein 3.40e-01 1.30e-02 NA
2. P Q9H095 Dynein regulatory complex protein 9 5.31e-06 4.39e-02 NA
2. P B7ZR30 Serine/threonine-protein kinase 10-A 9.89e-04 2.53e-04 NA
2. P Q4R6Q9 Coiled-coil domain-containing protein 181 4.39e-02 8.88e-04 NA
2. P Q5RCA7 Coiled-coil domain-containing protein 91 3.09e-08 4.15e-02 NA
2. P Q9I9E0 Serine/threonine-protein kinase TAO3 4.53e-05 1.57e-05 NA
2. P P0CU51 Cytosolic-abundant heat soluble protein 107838 1.16e-02 4.22e-03 NA
2. P O93388 Stathmin-3 8.17e-03 4.47e-04 NA
2. P Q5R8C6 Stathmin-3 1.14e-02 1.09e-03 NA
2. P O94804 Serine/threonine-protein kinase 10 3.87e-04 1.87e-03 NA
2. P A8IUG5 Cilia- and flagella-associated protein 99 3.50e-05 3.75e-10 NA
2. P O55098 Serine/threonine-protein kinase 10 2.06e-03 2.79e-03 NA
2. P Q5R4C5 Stathmin-4 2.06e-02 8.79e-03 NA
2. P Q9WU62 Inner centromere protein 1.07e-02 9.05e-03 NA
2. P Q9FFA5 Remorin 1.4 1.95e-02 3.17e-04 NA
2. P Q8BYC6 Serine/threonine-protein kinase TAO3 1.49e-04 5.54e-05 NA
2. P P93788 Remorin 1.15e-03 3.75e-02 NA
2. P Q90ZF9 Centromere protein H 1.46e-04 2.18e-03 NA
2. P A4IJ15 Cilia- and flagella-associated protein 97 2.40e-01 6.48e-03 NA
2. P Q6FJP1 rRNA biogenesis protein RRP36 8.17e-02 2.62e-02 NA
2. P Q6DD27 Serine/threonine-protein kinase TAO3 2.06e-04 2.28e-06 NA
2. P Q3TRR0 Microtubule-associated protein 9 5.26e-02 1.29e-03 NA
2. P Q4R4N5 Stathmin-3 1.50e-01 6.98e-04 NA
2. P P55821 Stathmin-2 2.58e-02 1.34e-02 NA
2. P Q9D5W4 Coiled-coil domain-containing protein 81 6.39e-04 1.16e-07 NA
2. P Q8BVV7 Centrosomal protein of 95 kDa 2.10e-03 1.79e-02 NA
2. P Q0IHP2 Inner centromere protein 1.59e-02 4.44e-06 NA
2. P Q569E7 Zinc finger protein 697 9.24e-01 1.17e-02 NA
2. P Q9P2B7 Cilia- and flagella-associated protein 97 3.85e-01 2.52e-02 NA
2. P Q32N93 Inner centromere protein B 2.08e-03 8.18e-05 NA
2. P P53278 Uncharacterized protein YGR130C 1.84e-04 4.39e-02 NA
2. P Q5NVK0 Coiled-coil domain-containing protein 181 5.09e-03 2.14e-02 NA
2. P Q6ZN84 Coiled-coil domain-containing protein 81 5.50e-04 2.60e-07 NA
2. P Q53UA7 Serine/threonine-protein kinase TAO3 2.14e-04 1.44e-04 NA
2. P P63043 Stathmin-4 2.16e-02 3.28e-03 NA
2. P Q7ZYJ0 Serine/threonine-protein kinase TAO1-B 2.19e-05 5.59e-04 NA
2. P Q5XIN9 Coiled-coil domain-containing protein 81 2.63e-04 4.02e-07 NA
2. P Q6NU21 Serine/threonine-protein kinase TAO1-A 2.54e-04 1.36e-03 NA
2. P Q9NZ72 Stathmin-3 1.18e-02 1.09e-03 NA
3. B Q80W93 Hydrocephalus-inducing protein NA NA 0.001
3. B Q8ILR9 Protein PF14_0175 NA NA 0.013
3. B Q4G0P3 Hydrocephalus-inducing protein homolog NA NA 4.83e-05
3. B Q8IDX6 Reticulocyte-binding protein homolog 2a NA NA 1.96e-11
3. B C0H5F4 Reticulocyte-binding protein homolog 2b NA NA 8.77e-05