Results | PROST

Summary

Q9NUD7

Homolog: P55925.
Function: SF-assemblin.

Statistics

Total GO Annotation: 199
Unique PROST Go: 195
Unique BLAST Go: 4

Total Homologs: 213
Unique PROST Homologs: 211
Unique BLAST Homologs: 1

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was P55925 (SF-assemblin) with a FATCAT P-Value: 9.95e-12 and RMSD of 2.80 angstrom. The sequence alignment identity is 19.6%.
Structural alignment shown in left. Query protein Q9NUD7 colored as red in alignment, homolog P55925 colored as blue. Query protein Q9NUD7 is also shown in right top, homolog P55925 showed in right bottom. They are colored based on secondary structures.

  Q9NUD7 MAHVLQKPKHSGTHSIVQEFQVPDYVPWQQSKQETKPSTLPPVQQANSLHTSKMKTLTRVQPVFHFKPTTVVTSCQPKNPR-ELHRRRKLD---PGKMHA 96
  P55925 -------------------------------------------------------------------PT-------P-SPEARVASRPFLDSPLPGSPRS 25

  Q9NUD7 KI---WLMKT-SLRSGRAALRELRSR-ENFLSKLNRELIETIQ-EMENSTTLHVRALLQQQDTLATIIDILEYSNKKRLQQLKSELQ-EWE-EKKKCK-M 187
  P55925 GSPTGYITATKAISAGK--LEHVAEKFSNFYNEI--EL-EKQQRRMADAA--RFQML---TDSIAKLEKSLEAEIKRRAESDK-QIQVHFESEVKGLQER 114

  Q9NUD7 SYLEQQAEQLNAKIEKTQEEVNFLS-TYMD-HEYSIKSVQISTLMRQLQQVKDSQQDELDDL-GEMRRKV---LESLS-DKIQK----KK--KKILSSV- 273
  P55925 TAL-QLAD-LQAAF-KTS--VDGLSRTMQDLH----------TI---IKEEREQRRSDIEHLAGSLVNKVNECVAALDEERISRMDAESKILKQIATDVF 196

  Q9NUD7 -VAE---TQRPYEEALLQKMW-ESQDFLKCMQRFREIID-QFEENMPVLRAEVEELQAQT---REPREVIFED--VLLRRPKCTPD-----MD-V-ILNI 355
  P55925 RVQEKIDTEKGTREAELATLRSEIHEVLG--N--RNLSDEKF-QTL-VL-DEINNLKSAVQMEREER--ISEDDEIV----QAVNDYTRALQDGLRIVNN 283

  Q9NUD7 PVEEPLPF 363
  P55925 S------- 284

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
2. P	GO:0045616	regulation of keratinocyte differentiation
2. P	GO:0099184	structural constituent of postsynaptic intermediate filament cytoskeleton
2. P	GO:0050680	negative regulation of epithelial cell proliferation
2. P	GO:0071346	cellular response to interferon-gamma
2. P	GO:0019904	protein domain specific binding
2. P	GO:0007094	mitotic spindle assembly checkpoint signaling
2. P	GO:0072497	mesenchymal stem cell differentiation
2. P	GO:0000346	transcription export complex
2. P	GO:0045111	intermediate filament cytoskeleton
2. P	GO:0043034	costamere
2. P	GO:0010375	stomatal complex patterning
2. P	GO:0045095	keratin filament
2. P	GO:0033693	neurofilament bundle assembly
2. P	GO:0006406	mRNA export from nucleus
2. P	GO:0030992	intraciliary transport particle B
2. P	GO:0030424	axon
2. P	GO:0045109	intermediate filament organization
2. P	GO:0034451	centriolar satellite
2. P	GO:0098527	neuromuscular junction of somatic muscle
2. P	GO:0090404	pollen tube tip
2. P	GO:1900147	regulation of Schwann cell migration
2. P	GO:0045963	negative regulation of dopamine metabolic process
2. P	GO:0010497	plasmodesmata-mediated intercellular transport
2. P	GO:0043162	ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
2. P	GO:0051224	negative regulation of protein transport
2. P	GO:0097449	astrocyte projection
2. P	GO:0005911	cell-cell junction
2. P	GO:0097749	membrane tubulation
2. P	GO:0051321	meiotic cell cycle
2. P	GO:0044877	protein-containing complex binding
2. P	GO:0060020	Bergmann glial cell differentiation
2. P	GO:0051707	response to other organism
2. P	GO:0007030	Golgi organization
2. P	GO:0008017	microtubule binding
2. P	GO:0045214	sarcomere organization
2. P	GO:0097191	extrinsic apoptotic signaling pathway
2. P	GO:1900073	regulation of neuromuscular synaptic transmission
2. P	GO:0030018	Z disc
2. P	GO:0048487	beta-tubulin binding
2. P	GO:0002244	hematopoietic progenitor cell differentiation
2. P	GO:0005844	polysome
2. P	GO:0003725	double-stranded RNA binding
2. P	GO:0043000	Golgi to plasma membrane CFTR protein transport
2. P	GO:0043622	cortical microtubule organization
2. P	GO:0005815	microtubule organizing center
2. P	GO:0005212	structural constituent of eye lens
2. P	GO:0099160	postsynaptic intermediate filament cytoskeleton
2. P	GO:0006397	mRNA processing
2. P	GO:0005921	gap junction
2. P	GO:0005628	prospore membrane
2. P	GO:0010977	negative regulation of neuron projection development
2. P	GO:0005861	troponin complex
2. P	GO:0043005	neuron projection
2. P	GO:0030054	cell junction
2. P	GO:0050708	regulation of protein secretion
2. P	GO:0070062	extracellular exosome
2. P	GO:0014704	intercalated disc
2. P	GO:0060706	cell differentiation involved in embryonic placenta development
2. P	GO:0007098	centrosome cycle
2. P	GO:0002230	positive regulation of defense response to virus by host
2. P	GO:0042995	cell projection
2. P	GO:0044299	C-fiber
2. P	GO:0050770	regulation of axonogenesis
2. P	GO:1902488	cholangiocyte apoptotic process
2. P	GO:0000922	spindle pole
2. P	GO:0045104	intermediate filament cytoskeleton organization
2. P	GO:0048047	mating behavior, sex discrimination
2. P	GO:0071944	cell periphery
2. P	GO:0045727	positive regulation of translation
2. P	GO:0036466	synaptic vesicle recycling via endosome
2. P	GO:1901622	positive regulation of smoothened signaling pathway involved in dorsal/ventral neural tube patterning
2. P	GO:0005883	neurofilament
2. P	GO:0031069	hair follicle morphogenesis
2. P	GO:0005198	structural molecule activity
2. P	GO:0031252	cell leading edge
2. P	GO:0042383	sarcolemma
2. P	GO:0061057	peptidoglycan recognition protein signaling pathway
2. P	GO:0042622	photoreceptor outer segment membrane
2. P	GO:0006936	muscle contraction
2. P	GO:0001520	outer dense fiber
2. P	GO:0006612	protein targeting to membrane
2. P	GO:0043001	Golgi to plasma membrane protein transport
2. P	GO:0097386	glial cell projection
2. P	GO:0045098	type III intermediate filament
2. P	GO:0005880	nuclear microtubule
2. P	GO:0070779	D-aspartate import across plasma membrane
2. P	GO:0030280	structural constituent of skin epidermis
2. P	GO:0051649	establishment of localization in cell
2. P	GO:0031234	extrinsic component of cytoplasmic side of plasma membrane
2. P	GO:0007130	synaptonemal complex assembly
2. P	GO:1905515	non-motile cilium assembly
2. P	GO:0005856	cytoskeleton
2. P	GO:0044297	cell body
2. P	GO:0060252	positive regulation of glial cell proliferation
2. P	GO:0071222	cellular response to lipopolysaccharide
2. P	GO:0098574	cytoplasmic side of lysosomal membrane
2. P	GO:0051838	cytolysis by host of symbiont cells
2. P	GO:0000801	central element
2. P	GO:0097110	scaffold protein binding
2. P	GO:0043292	contractile fiber
2. P	GO:0097545	axonemal outer doublet
2. P	GO:0051225	spindle assembly
2. P	GO:0010564	regulation of cell cycle process
2. P	GO:0036126	sperm flagellum
2. P	GO:0002081	outer acrosomal membrane
2. P	GO:0071225	cellular response to muramyl dipeptide
2. P	GO:0016010	dystrophin-associated glycoprotein complex
2. P	GO:0060291	long-term synaptic potentiation
2. P	GO:0008057	eye pigment granule organization
2. P	GO:0030500	regulation of bone mineralization
2. P	GO:0005654	nucleoplasm
2. P	GO:0014002	astrocyte development
2. P	GO:0002080	acrosomal membrane
2. P	GO:0070056	prospore membrane leading edge
2. P	GO:0031674	I band
2. P	GO:2000536	negative regulation of entry of bacterium into host cell
2. P	GO:0016363	nuclear matrix
2. P	GO:0030855	epithelial cell differentiation
2. P	GO:0042633	hair cycle
2. P	GO:0002009	morphogenesis of an epithelium
2. P	GO:0000813	ESCRT I complex
2. P	GO:0051721	protein phosphatase 2A binding
2. P	GO:0010625	positive regulation of Schwann cell proliferation
2. P	GO:0033209	tumor necrosis factor-mediated signaling pathway
2. P	GO:0045110	intermediate filament bundle assembly
2. P	GO:0097450	astrocyte end-foot
2. P	GO:0043515	kinetochore binding
2. P	GO:0051310	metaphase plate congression
2. P	GO:0098641	cadherin binding involved in cell-cell adhesion
2. P	GO:0009267	cellular response to starvation
2. P	GO:0097512	cardiac myofibril
2. P	GO:0005634	nucleus
2. P	GO:0032120	ascospore-type prospore membrane formation
2. P	GO:0060395	SMAD protein signal transduction
2. P	GO:0036064	ciliary basal body
2. P	GO:0008092	cytoskeletal protein binding
2. P	GO:0051382	kinetochore assembly
2. P	GO:0008544	epidermis development
2. P	GO:0000445	THO complex part of transcription export complex
2. P	GO:2000647	negative regulation of stem cell proliferation
2. P	GO:0043204	perikaryon
2. P	GO:0051580	regulation of neurotransmitter uptake
2. P	GO:1990498	mitotic spindle microtubule
2. P	GO:0000070	mitotic sister chromatid segregation
2. P	GO:0060294	cilium movement involved in cell motility
2. P	GO:0019899	enzyme binding
2. P	GO:0009750	response to fructose
2. P	GO:0000347	THO complex
2. P	GO:0031594	neuromuscular junction
2. P	GO:0046784	viral mRNA export from host cell nucleus
2. P	GO:0032967	positive regulation of collagen biosynthetic process
2. P	GO:0010467	gene expression
2. P	GO:0000817	COMA complex
2. P	GO:0051599	response to hydrostatic pressure
2. P	GO:0016327	apicolateral plasma membrane
2. P	GO:0005200	structural constituent of cytoskeleton
2. P	GO:0031424	keratinization
2. P	GO:0007286	spermatid development
2. P	GO:0005777	peroxisome
2. P	GO:0045107	intermediate filament polymerization
2. P	GO:0060271	cilium assembly
2. P	GO:0008380	RNA splicing
2. P	GO:0030317	flagellated sperm motility
2. P	GO:0031514	motile cilium
2. P	GO:0019900	kinase binding
2. P	GO:0031102	neuron projection regeneration
2. P	GO:0005813	centrosome
2. P	GO:0097284	hepatocyte apoptotic process
2. P	GO:0045103	intermediate filament-based process
2. P	GO:0015630	microtubule cytoskeleton
2. P	GO:2000012	regulation of auxin polar transport
2. P	GO:0005829	cytosol
2. P	GO:0006963	positive regulation of antibacterial peptide biosynthetic process
2. P	GO:0000795	synaptonemal complex
2. P	GO:0046872	metal ion binding
2. P	GO:0070652	HAUS complex
2. P	GO:0006623	protein targeting to vacuole
2. P	GO:0051493	regulation of cytoskeleton organization
2. P	GO:1904714	regulation of chaperone-mediated autophagy
2. P	GO:0035735	intraciliary transport involved in cilium assembly
2. P	GO:0016607	nuclear speck
2. P	GO:0005882	intermediate filament
2. P	GO:0043488	regulation of mRNA stability
2. P	GO:0005916	fascia adherens
2. P	GO:0000776	kinetochore
2. P	GO:0019905	syntaxin binding
2. P	GO:0031667	response to nutrient levels
2. P	GO:0045335	phagocytic vesicle
2. P	GO:0070307	lens fiber cell development
2. P	GO:0070365	hepatocyte differentiation
2. P	GO:0042802	identical protein binding
2. P	GO:0060378	regulation of brood size
2. P	GO:1905342	positive regulation of protein localization to kinetochore
2. P	GO:1990254	keratin filament binding
2. P	GO:0001899	negative regulation of cytolysis by symbiont of host cells
3. B	GO:0005581	collagen trimer
3. B	GO:0030023	extracellular matrix constituent conferring elasticity
3. B	GO:0062023	collagen-containing extracellular matrix
3. B	GO:0007155	cell adhesion

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	Q9NUD7	Uncharacterized protein C20orf96	0	3.57e-139	0.0
2. P	Q9NUQ3	Gamma-taxilin	2.90e-07	1.80e-04	NA
2. P	Q8BGZ7	Keratin, type II cytoskeletal 75	4.64e-06	1.56e-03	NA
2. P	Q6IFX4	Keratin, type I cytoskeletal 39	1.32e-07	2.67e-03	NA
2. P	A8KB59	Coiled-coil domain-containing protein 153	1.78e-08	1.81e-03	NA
2. P	Q5EB94	Myocardial zonula adherens protein	1.26e-07	1.89e-10	NA
2. P	A5PKK7	RAB6-interacting golgin	3.19e-05	2.36e-06	NA
2. P	Q8R2X8	Golgin-45	2.05e-04	3.12e-04	NA
2. P	Q9VVT5	Dysbindin protein homolog	3.72e-08	1.08e-02	NA
2. P	P38871	Sporulation-specific protein 1	2.52e-02	3.66e-02	NA
2. P	P24790	Vimentin-4	3.87e-06	8.99e-05	NA
2. P	P40222	Alpha-taxilin	2.70e-06	4.57e-02	NA
2. P	Q3UIJ9	Myocardial zonula adherens protein	2.94e-07	8.81e-11	NA
2. P	P84198	Vimentin	2.15e-07	4.81e-05	NA
2. P	Q5BJY9	Keratin, type I cytoskeletal 18	2.71e-08	7.38e-04	NA
2. P	P02646	Troponin I, cardiac muscle	3.87e-05	1.07e-02	NA
2. P	P02541	Desmin	7.40e-07	1.52e-03	NA
2. P	Q148H7	Keratin, type II cytoskeletal 79	8.24e-07	3.70e-03	NA
2. P	P23729	Type III intermediate filament	1.29e-07	2.39e-07	NA
2. P	Q0P5D1	Coiled-coil domain-containing protein 153	2.51e-10	1.97e-02	NA
2. P	Q5FVL4	Coiled-coil domain-containing protein 153	2.47e-09	8.71e-03	NA
2. P	P48670	Vimentin (Fragment)	4.18e-08	1.57e-03	NA
2. P	Q8BP22	Protein FAM92A	1.30e-05	4.94e-02	NA
2. P	B4YNF1	Uncharacterized protein V11	NA	1.95e-04	NA
2. P	Q6IFX2	Keratin, type I cytoskeletal 42	7.75e-07	5.11e-03	NA
2. P	Q148H6	Keratin, type I cytoskeletal 28	3.37e-06	2.70e-04	NA
2. P	Q8LE98	Interactor of constitutive active ROPs 1	3.09e-04	5.96e-03	NA
2. P	P15331	Peripherin	1.45e-06	4.89e-02	NA
2. P	Q28115	Glial fibrillary acidic protein	1.41e-07	9.45e-03	NA
2. P	Q6IME9	Keratin, type II cytoskeletal 72	1.03e-06	1.05e-02	NA
2. P	Q6BWL0	Tethering factor for nuclear proteasome STS1	3.66e-02	4.28e-03	NA
2. P	A5A6N0	Keratin, type II cytoskeletal 7	3.15e-07	2.31e-02	NA
2. P	Q08D91	Keratin, type II cytoskeletal 75	2.59e-06	1.80e-02	NA
2. P	Q6DGZ3	THO complex subunit 7 homolog	6.14e-10	4.11e-02	NA
2. P	Q8BHN1	Gamma-taxilin	5.45e-06	9.85e-05	NA
2. P	P24789	Vimentin-1/2	1.22e-06	6.29e-05	NA
2. P	A5A6M8	Keratin, type II cytoskeletal 5	1.19e-06	1.91e-02	NA
2. P	Q7ZTS4	Keratin, type I cytoskeletal 18	8.20e-07	5.47e-06	NA
2. P	O95678	Keratin, type II cytoskeletal 75	2.64e-06	2.88e-03	NA
2. P	P0C7Q1	Coiled-coil domain-containing protein 153	1.07e-10	2.65e-03	NA
2. P	Q10006	Uncharacterized protein hal-3	3.72e-07	3.03e-06	NA
2. P	P02540	Desmin	2.54e-08	2.91e-03	NA
2. P	Q4V8G8	Tektin-3	1.91e-06	2.75e-02	NA
2. P	E1AB55	Keratin, type II cytoskeletal 71	3.77e-06	4.66e-02	NA
2. P	Q29S21	Keratin, type II cytoskeletal 7	6.04e-08	2.13e-02	NA
2. P	P48674	Vimentin	6.08e-07	2.59e-07	NA
2. P	Q04948	Non-neuronal cytoplasmic intermediate filament protein	2.63e-07	1.11e-02	NA
2. P	Q497I4	Keratin, type I cuticular Ha5	1.63e-07	3.22e-02	NA
2. P	P31000	Vimentin	1.42e-06	1.10e-04	NA
2. P	Q9CQU5	ZW10 interactor	1.08e-09	3.01e-02	NA
2. P	P25030	Keratin, type I cytoskeletal 20	3.12e-07	1.76e-04	NA
2. P	P48616	Vimentin	3.83e-07	1.65e-04	NA
2. P	Q7TMY4	THO complex subunit 7 homolog	4.45e-08	6.09e-03	NA
2. P	Q5SV66	Coiled-coil domain-containing protein 42	5.45e-10	3.19e-02	NA
2. P	P41219	Peripherin	1.22e-06	3.82e-03	NA
2. P	P05783	Keratin, type I cytoskeletal 18	8.68e-07	9.94e-03	NA
2. P	Q5RCA7	Coiled-coil domain-containing protein 91	9.39e-07	3.22e-02	NA
2. P	Q5K2P4	Keratin, type I cytoskeletal 13	1.57e-07	7.51e-06	NA
2. P	Q4R7G2	Centromere protein Q	1.43e-04	8.42e-04	NA
2. P	P0CU51	Cytosolic-abundant heat soluble protein 107838	1.01e-05	1.58e-02	NA
2. P	Q6IFZ9	Keratin, type II cytoskeletal 74	1.16e-06	4.80e-02	NA
2. P	Q5XQN5	Keratin, type II cytoskeletal 5	5.44e-06	1.13e-03	NA
2. P	P31001	Desmin	2.76e-07	1.66e-03	NA
2. P	Q10758	Keratin, type II cytoskeletal 8	3.85e-07	2.70e-02	NA
2. P	Q148H8	Keratin, type II cytoskeletal 72	3.07e-06	2.26e-02	NA
2. P	Q08550	Meiotic plaque component protein 54	1.28e-05	1.92e-05	NA
2. P	Q8C963	Coiled-coil domain-containing protein 159	7.31e-06	2.79e-03	NA
2. P	F4IK01	AUGMIN subunit 1	8.09e-09	5.27e-03	NA
2. P	Q6RCE1	Intraflagellar transport protein 74	4.60e-06	9.48e-04	NA
2. P	Q7Z3Z0	Keratin, type I cytoskeletal 25	9.02e-07	3.59e-02	NA
2. P	O57607	Keratin, type I cytoskeletal 18	1.02e-06	2.22e-02	NA
2. P	Q7L2Z9	Centromere protein Q	6.30e-06	8.08e-06	NA
2. P	P02538	Keratin, type II cytoskeletal 6A	1.23e-05	1.87e-02	NA
2. P	P02544	Vimentin	3.91e-07	8.89e-05	NA
2. P	Q14CN4	Keratin, type II cytoskeletal 72	2.53e-06	2.62e-02	NA
2. P	P08802	Keratin, type I cytoskeletal 18-A	1.38e-06	8.80e-03	NA
2. P	Q9U389	Allophagy receptor allo-1	1.72e-06	4.75e-05	NA
2. P	Q9BXF9	Tektin-3	5.03e-07	4.80e-02	NA
2. P	Q9SCP9	Vacuolar protein-sorting-associated protein 37 homolog 1	3.75e-03	9.74e-03	NA
2. P	Q9M9F9	Interactor of constitutive active ROPs 4	1.66e-05	2.12e-03	NA
2. P	Q99L00	HAUS augmin-like complex subunit 8	1.02e-05	1.14e-06	NA
2. P	Q5K2P6	Keratin, type 1 cytoskeletal 11	2.16e-07	5.54e-07	NA
2. P	Q9DCV7	Keratin, type II cytoskeletal 7	1.83e-07	1.08e-03	NA
2. P	Q8IYJ2	Uncharacterized protein C10orf67, mitochondrial	7.86e-06	5.61e-03	NA
2. P	Q6PVZ1	Keratin, type I cytoskeletal 14	6.96e-08	1.05e-03	NA
2. P	P13647	Keratin, type II cytoskeletal 5	8.94e-06	9.74e-03	NA
2. P	Q0IHJ3	HAUS augmin-like complex subunit 8	1.73e-05	4.33e-05	NA
2. P	Q6IFU7	Keratin, type I cytoskeletal 42	8.69e-07	3.55e-03	NA
2. P	Q99176	Protein SRN2	2.13e-04	4.03e-02	NA
2. P	Q3T0L1	Centromere protein H	7.01e-07	1.97e-04	NA
2. P	Q8VED5	Keratin, type II cytoskeletal 79	4.75e-07	3.91e-02	NA
2. P	Q8BRM2	RAB6-interacting golgin	1.83e-04	2.10e-03	NA
2. P	C4R159	Autophagy-related protein 28	1.29e-04	3.45e-02	NA
2. P	P16878	Keratin, type II cytoskeletal	8.05e-07	4.15e-02	NA
2. P	O76013	Keratin, type I cuticular Ha6	4.09e-07	3.95e-04	NA
2. P	P35900	Keratin, type I cytoskeletal 20	2.55e-06	4.28e-03	NA
2. P	B1H222	RAB6-interacting golgin	4.15e-04	4.98e-04	NA
2. P	Q9CPQ5	Centromere protein Q	7.04e-05	1.16e-05	NA
2. P	Q6I9Y2	THO complex subunit 7 homolog	1.08e-09	4.70e-03	NA
2. P	O57611	Keratin, type I cytoskeletal 18	4.80e-07	2.86e-02	NA
2. P	Q9D312	Keratin, type I cytoskeletal 20	5.29e-06	2.76e-03	NA
2. P	P48676	Peripherin	5.74e-07	4.12e-07	NA
2. P	Q9H2G9	Golgin-45	4.61e-05	2.67e-05	NA
2. P	Q99M74	Keratin, type II cuticular Hb2	7.04e-07	2.47e-02	NA
2. P	P17661	Desmin	1.55e-07	2.03e-03	NA
2. P	Q7Z3Y9	Keratin, type I cytoskeletal 26	1.67e-06	1.78e-02	NA
2. P	P48675	Desmin	9.65e-08	1.52e-03	NA
2. P	Q9P7J4	THO complex subunit mft1	2.80e-07	3.88e-02	NA
2. P	Q148H5	Keratin, type II cytoskeletal 71	4.15e-08	4.31e-02	NA
2. P	Q6IMF1	Keratin, type II cytoskeletal 80	3.81e-07	1.08e-02	NA
2. P	Q9NVX0	HAUS augmin-like complex subunit 2	2.11e-06	4.56e-03	NA
2. P	O74324	Uncharacterized protein C1685.04	1.18e-06	1.46e-05	NA
2. P	Q60595	X-linked lymphocyte-regulated protein 3A	7.77e-08	4.48e-05	NA
2. P	Q5PYI0	Troponin I, cardiac muscle	7.56e-05	4.80e-03	NA
2. P	Q6P643	THO complex subunit 7 homolog	1.82e-07	1.50e-02	NA
2. P	Q4R4X4	Vimentin	1.43e-06	4.81e-05	NA
2. P	Q6A163	Keratin, type I cytoskeletal 39	7.00e-07	3.65e-04	NA
2. P	P04259	Keratin, type II cytoskeletal 6B	9.23e-07	3.19e-02	NA
2. P	Q6P205	X-linked lymphocyte-regulated protein 3B	2.95e-07	1.47e-03	NA
2. P	Q5XKE5	Keratin, type II cytoskeletal 79	1.12e-06	4.66e-02	NA
2. P	Q6P6Q2	Keratin, type II cytoskeletal 5	9.13e-07	7.55e-03	NA
2. P	P55925	SF-assemblin	9.95e-12	4.03e-02	NA
2. P	A3KN27	Keratin, type II cytoskeletal 74	9.99e-09	2.67e-05	NA
2. P	Q12234	GRIP domain-containing protein RUD3	1.86e-06	6.99e-04	NA
2. P	P48673	Vimentin beta	4.16e-07	3.31e-07	NA
2. P	Q6IFW3	Keratin, type I cytoskeletal 39	1.68e-07	6.55e-04	NA
2. P	Q5R1W8	Vimentin	3.63e-07	2.92e-04	NA
2. P	P47819	Glial fibrillary acidic protein	2.85e-07	1.99e-03	NA
2. P	P08729	Keratin, type II cytoskeletal 7	4.11e-07	4.24e-03	NA
2. P	Q9D9F8	Mirror-image polydactyly gene 1 protein homolog	1.87e-07	2.52e-02	NA
2. P	O62654	Desmin	1.13e-07	6.96e-03	NA
2. P	Q9H0I3	Coiled-coil domain-containing protein 113	1.71e-06	1.13e-02	NA
2. P	Q9QYM8	Centromere protein H	3.79e-06	1.73e-02	NA
2. P	Q32LK9	Synaptonemal complex central element protein 1	2.81e-08	1.14e-03	NA
2. P	M1V4Y8	Cilia- and flagella-associated protein 73	1.40e-09	1.19e-03	NA
2. P	Q5T7V8	RAB6-interacting golgin	8.39e-05	7.71e-07	NA
2. P	P08552	Neurofilament medium polypeptide (Fragment)	5.98e-07	2.24e-05	NA
2. P	Q58EE9	Glial fibrillary acidic protein	2.59e-07	5.74e-04	NA
2. P	P20152	Vimentin	4.26e-07	1.14e-04	NA
2. P	A0A1S3X835	Protein MICROTUBULE BINDING PROTEIN 2C	3.97e-05	5.61e-03	NA
2. P	Q96M95	Coiled-coil domain-containing protein 42	9.96e-09	1.39e-02	NA
2. P	Q96LB3	Intraflagellar transport protein 74 homolog	1.66e-05	1.44e-02	NA
2. P	Q9GYV5	NF-kappa-B essential modulator	4.17e-07	2.94e-03	NA
2. P	A9UM82	Myocardial zonula adherens protein	3.00e-06	5.23e-10	NA
2. P	Q5K2N9	Keratin, type I cytoskeletal 18	1.03e-06	4.42e-03	NA
2. P	Q5BK57	HAUS augmin-like complex subunit 8	1.63e-05	3.31e-09	NA
2. P	Q8C5T8	Coiled-coil domain-containing protein 113	3.61e-08	9.35e-03	NA
2. P	Q6IG04	Keratin, type II cytoskeletal 72	1.62e-06	8.80e-03	NA
2. P	B1AQ75	Keratin, type I cuticular Ha6	2.10e-06	4.31e-02	NA
2. P	Q9D495	Synaptonemal complex central element protein 1	6.42e-09	1.44e-02	NA
2. P	Q9D4K7	Coiled-coil domain-containing protein 105	5.92e-07	4.84e-02	NA
2. P	Q6P864	Keratin, type I cytoskeletal 18	9.26e-07	6.21e-03	NA
2. P	Q8LDS5	THO complex subunit 7A	2.34e-07	1.71e-06	NA
2. P	P02542	Desmin	1.43e-06	3.38e-04	NA
2. P	P03995	Glial fibrillary acidic protein	7.21e-08	4.95e-03	NA
2. P	Q93V84	Protein FLX-like 1	2.40e-05	3.13e-02	NA
2. P	Q6IG12	Keratin, type II cytoskeletal 7	1.69e-06	1.08e-03	NA
2. P	P22225	69 kDa paraflagellar rod protein	6.42e-07	8.10e-05	NA
2. P	A0JMQ7	Microtubule-associated tumor suppressor 1 homolog A	1.68e-07	2.11e-04	NA
2. P	Q3TRJ4	Keratin, type I cytoskeletal 26	9.98e-07	1.35e-02	NA
2. P	Q9Z331	Keratin, type II cytoskeletal 6B	5.02e-07	1.50e-02	NA
2. P	Q9LEZ4	Protein MICROTUBULE BINDING PROTEIN 2C	8.47e-05	6.82e-05	NA
2. P	A7RX34	THO complex subunit 7 homolog	1.01e-09	4.11e-02	NA
2. P	P50446	Keratin, type II cytoskeletal 6A	3.12e-07	1.95e-02	NA
2. P	P08670	Vimentin	2.54e-07	3.82e-04	NA
2. P	Q8VYU8	Interactor of constitutive active ROPs 5	7.24e-10	3.22e-09	NA
2. P	Q5IF00	Autophagy-related protein 28	6.97e-05	3.45e-02	NA
2. P	P53298	Inner kinetochore subunit OKP1	1.87e-03	6.89e-03	NA
2. P	O76014	Keratin, type I cuticular Ha7	5.50e-06	1.07e-04	NA
2. P	Q7RTS7	Keratin, type II cytoskeletal 74	1.48e-06	1.79e-03	NA
2. P	P23239	Desmin	1.72e-08	8.29e-05	NA
2. P	Q07427	Keratin, type I cytoskeletal 18	8.28e-08	7.88e-06	NA
2. P	Q0VBK2	Keratin, type II cytoskeletal 80	2.89e-07	1.42e-02	NA
2. P	A6QQQ9	Keratin, type I cytoskeletal 20	6.84e-07	2.60e-02	NA
2. P	Q7SYF8	Keratin, type I cytoskeletal 18	2.56e-07	3.59e-02	NA
2. P	Q922U2	Keratin, type II cytoskeletal 5	5.28e-06	2.89e-02	NA
2. P	O95229	ZW10 interactor	5.01e-06	8.71e-03	NA
2. P	Q6IG05	Keratin, type II cytoskeletal 75	2.28e-06	1.08e-02	NA
2. P	Q5XFN2	Desmin	1.27e-07	3.10e-03	NA
2. P	P23565	Alpha-internexin	1.20e-06	1.56e-02	NA
2. P	O76011	Keratin, type I cuticular Ha4	1.25e-07	8.11e-03	NA
2. P	P05787	Keratin, type II cytoskeletal 8	6.29e-07	4.44e-02	NA
2. P	P0CAP1	Myocardial zonula adherens protein	3.20e-06	1.09e-08	NA
2. P	Q9M8T6	THO complex subunit 7B	8.02e-09	1.35e-02	NA
2. P	P38413	Giardin subunit gamma	1.15e-04	1.38e-03	NA
2. P	Q61806	X-linked lymphocyte-regulated protein 3C	5.33e-09	2.26e-04	NA
2. P	P34606	Uncharacterized protein ZK1098.6	7.57e-09	6.36e-05	NA
2. P	P21807	Peripherin	1.63e-06	5.16e-03	NA
2. P	Q96Q35	Flagellum-associated coiled-coil domain-containing protein 1	3.96e-09	2.77e-10	NA
2. P	Q2YDN4	Coiled-coil domain-containing protein 105	2.61e-05	3.01e-02	NA
2. P	Q6AY08	Flagellum-associated coiled-coil domain-containing protein 1	6.40e-09	7.82e-10	NA
2. P	Q92155	Vimentin	5.56e-06	7.84e-09	NA
2. P	P02543	Vimentin	4.40e-07	1.39e-04	NA
2. P	Q9TSV3	Coiled-coil alpha-helical rod protein 1 (Fragment)	3.37e-09	3.05e-04	NA
2. P	A0A098DT87	Autophagy-related protein 28	7.88e-04	7.40e-03	NA
2. P	P08778	Keratin, type I cytoskeletal 47 kDa	1.48e-06	7.55e-03	NA
2. P	Q8BVM7	Flagellum-associated coiled-coil domain-containing protein 1	2.38e-05	1.89e-03	NA
2. P	Q6NXH9	Keratin, type II cytoskeletal 73	1.28e-06	1.58e-02	NA
2. P	P48668	Keratin, type II cytoskeletal 6C	2.49e-06	2.13e-02	NA
2. P	Q6AYB8	Golgin-45	2.01e-04	1.77e-05	NA
2. P	Q6X6Z7	Tektin-3	5.21e-07	4.19e-02	NA
2. P	Q66H02	Centromere protein Q	1.15e-04	6.21e-03	NA
2. P	A6QQJ3	Peripherin	1.45e-06	1.18e-03	NA
2. P	Q9BT25	HAUS augmin-like complex subunit 8	1.17e-04	1.12e-04	NA
2. P	A1KQY9	Keratin, type I cytoskeletal 18-A	3.54e-09	3.88e-02	NA
2. P	P05784	Keratin, type I cytoskeletal 18	1.63e-07	2.56e-03	NA
2. P	Q3SZ60	THO complex subunit 7 homolog	1.81e-09	4.70e-03	NA
2. P	Q7SY65	Keratin, type I cytoskeletal 18-B	3.37e-07	4.51e-03	NA
2. P	O76015	Keratin, type I cuticular Ha8	6.80e-08	3.59e-02	NA
2. P	P09654	Vimentin	1.13e-06	6.98e-05	NA
2. P	Q3EBL9	Vacuolar protein-sorting-associated protein 37 homolog 2	1.18e-04	8.23e-04	NA
2. P	A8MT33	Synaptonemal complex central element protein 1-like	3.26e-06	1.09e-06	NA
3. B	Q9BXX0	EMILIN-2	1.44e-03	NA	0.037