Results | PROST

Summary

Q9NXS3

Homolog: F1QEG2.
Function: Kelch-like protein 41b.

Statistics

Total GO Annotation: 424
Unique PROST Go: 49
Unique BLAST Go: 250

Total Homologs: 576
Unique PROST Homologs: 32
Unique BLAST Homologs: 325

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was F1QEG2 (Kelch-like protein 41b) with a FATCAT P-Value: 0.0 and RMSD of 2.74 angstrom. The sequence alignment identity is 26.6%.
Structural alignment shown in left. Query protein Q9NXS3 colored as red in alignment, homolog F1QEG2 colored as blue. Query protein Q9NXS3 is also shown in right top, homolog F1QEG2 showed in right bottom. They are colored based on secondary structures.

  Q9NXS3 MDHTSPTYMLANLTHLHSEQLLQ-GLN-LLRQHHELCDIILRVGDVKIHAHKVVLASVSPYFKAMF---TGNLSEKE-NSEVEFQCIDETALQAIVEYAY 94
  F1QEG2 MD---PKAIKEEL-RLFQSTLLQDGLKELL-NENKFVDCTLKIGDRCFPCHRLIMAACSPYFRELFFSEDG--KEKDIGKEVVLDDVDPNIMDMILQYLY 93

  Q9NXS3 TGTVFISQDTVESLLPAANLLQIKLVLKECCAFLESQLDPGNCIGISRFAETYGC-----RDLYLAATKYICQNFEAVCQTEEFFELT-HADLDEIVSND 188
  F1QEG2 SAEIDLVDDNVQEIFAVANRFQIPSVFTVCVNYLQQKLSMANCLAVFRL----GLVLSVPR-LAIAARDFIADRFETVSSEEEFLQLAPH-ELLALIGGD 187

  Q9NXS3 CLNVATEETVFYALESWIKYDVQERQKYLAQLLNSVRLPLLSVKFLTRLYEANHLIR-DDRTCK--HLLNEALKYHFMPEHRLSHQT--VLMTR---PRC 280
  F1QEG2 MLNVEKEEVVFESVMKWVRNDKANRVKSLAEAFDCIRFRLLPEKYFREKVETDDIIKGDPELLKKLQLVKDAFKGK-LPEKKPKEKKEGEVNGEEEGEEM 286

  Q9NXS3 APKVLC---AVG--GKSGLFACL-DSVEM-Y-FPQNDSWIGLAPL--NIPRYEFGICVLDQKVYVIGGIATNVRPGVTIRKHENSVEC--WNPD--TNTW 366
  F1QEG2 LPGFLNDNRRLGMYGRD-LIVMINDTAAVAYDVVENECF--LAAMAEQVPKNHVSLCTKKNQLFIVGGLFVDEE-----SK-ESPLQCYFYQLDSFSSDW 377

  Q9NXS3 TSLERMNESRSTLGVVVLAGE----LYALGGYDGQS--YLQSVEKYIPKIRKWQPV--APMTTTRSCFAAAVL--DGMIYAIGGYGPAHMN-SVER---Y 452
  F1QEG2 RALPPMPSPRCLFNL----GESENLLFAIAGKDLQTNESLDSVMCFDTERMKWSETKKLPL----HIHGHSVVSHNNLVYCIG--GKTDDNKALSKMFVY 467

  Q9NXS3 DPSKDSWEMVASMADKRIHFGVGVMLGFIFVVGGHN--GVSHLSSIERYDPHQNQW-TVCR-PMKEPRTGVGAAVID---NYLYVVGGHS---------G 536
  F1QEG2 NHKQSEWRELASMKTPRAMFGAVVHKGKIIVTGGVNEDGLTALS--ETYDFDTNKWDTFTEFP-QE-RSSVN--LVSSGGN-LFSIGGFAIVELEDKNIG 560

  Q9NXS3 SSYLNTVQKYDPISD--TWLDSAGMI----YC---RCNFG--LTAL----- 571
  F1QEG2 PSEITDIWQYE--EDKKTW---SGMLREMRYASGSSC-VGMRLNAARMPKL 605

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
1. PB	GO:0045604	regulation of epidermal cell differentiation
1. PB	GO:0016055	Wnt signaling pathway
1. PB	GO:0071466	cellular response to xenobiotic stimulus
1. PB	GO:0032886	regulation of microtubule-based process
1. PB	GO:0007094	mitotic spindle assembly checkpoint signaling
1. PB	GO:0048873	homeostasis of number of cells within a tissue
1. PB	GO:0045886	negative regulation of synaptic assembly at neuromuscular junction
1. PB	GO:0042994	cytoplasmic sequestering of transcription factor
1. PB	GO:0072156	distal tubule morphogenesis
1. PB	GO:0031398	positive regulation of protein ubiquitination
1. PB	GO:0031463	Cul3-RING ubiquitin ligase complex
1. PB	GO:0006511	ubiquitin-dependent protein catabolic process
1. PB	GO:0071353	cellular response to interleukin-4
1. PB	GO:0035020	regulation of Rac protein signal transduction
1. PB	GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process
1. PB	GO:0030424	axon
1. PB	GO:0034451	centriolar satellite
1. PB	GO:0045109	intermediate filament organization
1. PB	GO:0050951	sensory perception of temperature stimulus
1. PB	GO:0001701	in utero embryonic development
1. PB	GO:0045171	intercellular bridge
1. PB	GO:0016567	protein ubiquitination
1. PB	GO:0031430	M band
1. PB	GO:0070294	renal sodium ion absorption
1. PB	GO:0032435	negative regulation of proteasomal ubiquitin-dependent protein catabolic process
1. PB	GO:0031672	A band
1. PB	GO:0014032	neural crest cell development
1. PB	GO:0045214	sarcomere organization
1. PB	GO:0008344	adult locomotory behavior
1. PB	GO:0004842	ubiquitin-protein transferase activity
1. PB	GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport
1. PB	GO:0014029	neural crest formation
1. PB	GO:0031275	obsolete regulation of lateral pseudopodium assembly
1. PB	GO:0071233	cellular response to leucine
1. PB	GO:0002467	germinal center formation
1. PB	GO:0001726	ruffle
1. PB	GO:0006513	protein monoubiquitination
1. PB	GO:0032465	regulation of cytokinesis
1. PB	GO:0032839	dendrite cytoplasm
1. PB	GO:0007420	brain development
1. PB	GO:0005884	actin filament
1. PB	GO:2000291	regulation of myoblast proliferation
1. PB	GO:0010507	negative regulation of autophagy
1. PB	GO:0030036	actin cytoskeleton organization
1. PB	GO:0039648	modulation by virus of host protein ubiquitination
1. PB	GO:0016605	PML body
1. PB	GO:0030057	desmosome
1. PB	GO:0019964	interferon-gamma binding
1. PB	GO:0042428	serotonin metabolic process
1. PB	GO:0005802	trans-Golgi network
1. PB	GO:0043025	neuronal cell body
1. PB	GO:2001014	regulation of skeletal muscle cell differentiation
1. PB	GO:0016235	aggresome
1. PB	GO:0048808	male genitalia morphogenesis
1. PB	GO:0060586	multicellular organismal iron ion homeostasis
1. PB	GO:0005886	plasma membrane
1. PB	GO:0071322	cellular response to carbohydrate stimulus
1. PB	GO:0010506	regulation of autophagy
1. PB	GO:0097718	disordered domain specific binding
1. PB	GO:0050801	ion homeostasis
1. PB	GO:1904263	positive regulation of TORC1 signaling
1. PB	GO:0071630	nuclear protein quality control by the ubiquitin-proteasome system
1. PB	GO:0005856	cytoskeleton
1. PB	GO:0039649	modulation by virus of host ubiquitin-protein ligase activity
1. PB	GO:0034599	cellular response to oxidative stress
1. PB	GO:0097602	cullin family protein binding
1. PB	GO:0035914	skeletal muscle cell differentiation
1. PB	GO:0005912	adherens junction
1. PB	GO:0098528	skeletal muscle fiber differentiation
1. PB	GO:1990390	protein K33-linked ubiquitination
1. PB	GO:0006446	regulation of translational initiation
1. PB	GO:0021680	cerebellar Purkinje cell layer development
1. PB	GO:0016234	inclusion body
1. PB	GO:0014728	regulation of the force of skeletal muscle contraction
1. PB	GO:0030239	myofibril assembly
1. PB	GO:0015629	actin cytoskeleton
1. PB	GO:0061061	muscle structure development
1. PB	GO:0050804	modulation of chemical synaptic transmission
1. PB	GO:0031674	I band
1. PB	GO:0005819	spindle
1. PB	GO:0035024	negative regulation of Rho protein signal transduction
1. PB	GO:0048741	skeletal muscle fiber development
1. PB	GO:0051865	protein autoubiquitination
1. PB	GO:0048208	COPII vesicle coating
1. PB	GO:0072686	mitotic spindle
1. PB	GO:0042748	circadian sleep/wake cycle, non-REM sleep
1. PB	GO:0031397	negative regulation of protein ubiquitination
1. PB	GO:0030134	COPII-coated ER to Golgi transport vesicle
1. PB	GO:0033150	cytoskeletal calyx
1. PB	GO:0030496	midbody
1. PB	GO:0031208	POZ domain binding
1. PB	GO:1901992	positive regulation of mitotic cell cycle phase transition
1. PB	GO:0005827	polar microtubule
1. PB	GO:0001953	negative regulation of cell-matrix adhesion
1. PB	GO:0006895	Golgi to endosome transport
1. PB	GO:0048512	circadian behavior
1. PB	GO:0045661	regulation of myoblast differentiation
1. PB	GO:0000070	mitotic sister chromatid segregation
1. PB	GO:0042803	protein homodimerization activity
1. PB	GO:0035853	chromosome passenger complex localization to spindle midzone
1. PB	GO:0036268	swimming
1. PB	GO:0051015	actin filament binding
1. PB	GO:0030127	COPII vesicle coat
1. PB	GO:1900242	regulation of synaptic vesicle endocytosis
1. PB	GO:2000312	regulation of kainate selective glutamate receptor activity
1. PB	GO:0070936	protein K48-linked ubiquitination
1. PB	GO:0016021	integral component of membrane
1. PB	GO:0031143	pseudopodium
1. PB	GO:0033017	sarcoplasmic reticulum membrane
1. PB	GO:0015630	microtubule cytoskeleton
1. PB	GO:0005829	cytosol
1. PB	GO:0009566	fertilization
1. PB	GO:0046872	metal ion binding
1. PB	GO:0071889	14-3-3 protein binding
1. PB	GO:0007616	long-term memory
1. PB	GO:0003779	actin binding
1. PB	GO:0001933	negative regulation of protein phosphorylation
1. PB	GO:0071379	cellular response to prostaglandin stimulus
1. PB	GO:2000042	negative regulation of double-strand break repair via homologous recombination
1. PB	GO:0090076	relaxation of skeletal muscle
1. PB	GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process
1. PB	GO:0030307	positive regulation of cell growth
1. PB	GO:0042802	identical protein binding
1. PB	GO:0008584	male gonad development
1. PB	GO:0005654	nucleoplasm
2. P	GO:0036126	sperm flagellum
2. P	GO:0061912	selective autophagy
2. P	GO:0048471	perinuclear region of cytoplasm
2. P	GO:2001243	negative regulation of intrinsic apoptotic signaling pathway
2. P	GO:0035082	axoneme assembly
2. P	GO:0120197	mucociliary clearance
2. P	GO:0006367	transcription initiation from RNA polymerase II promoter
2. P	GO:1904672	regulation of somatic stem cell population maintenance
2. P	GO:0051301	cell division
2. P	GO:0051496	positive regulation of stress fiber assembly
2. P	GO:0051901	positive regulation of mitochondrial depolarization
2. P	GO:0060090	molecular adaptor activity
2. P	GO:0030430	host cell cytoplasm
2. P	GO:0016358	dendrite development
2. P	GO:0051894	positive regulation of focal adhesion assembly
2. P	GO:0038133	ERBB2-ERBB3 signaling pathway
2. P	GO:0001887	selenium compound metabolic process
2. P	GO:0045162	clustering of voltage-gated sodium channels
2. P	GO:0022011	myelination in peripheral nervous system
2. P	GO:0005764	lysosome
2. P	GO:0090660	cerebrospinal fluid circulation
2. P	GO:0043966	histone H3 acetylation
2. P	GO:0007286	spermatid development
2. P	GO:0010499	proteasomal ubiquitin-independent protein catabolic process
2. P	GO:1990716	axonemal central apparatus
2. P	GO:0007288	sperm axoneme assembly
2. P	GO:0033268	node of Ranvier
2. P	GO:0060028	convergent extension involved in axis elongation
2. P	GO:0005813	centrosome
2. P	GO:0060348	bone development
2. P	GO:0030425	dendrite
2. P	GO:0038031	non-canonical Wnt signaling pathway via JNK cascade
2. P	GO:0036464	cytoplasmic ribonucleoprotein granule
2. P	GO:0047485	protein N-terminus binding
2. P	GO:0009968	negative regulation of signal transduction
2. P	GO:0014069	postsynaptic density
2. P	GO:0043408	regulation of MAPK cascade
2. P	GO:0046329	negative regulation of JNK cascade
2. P	GO:0050853	B cell receptor signaling pathway
2. P	GO:0007049	cell cycle
2. P	GO:0007010	cytoskeleton organization
2. P	GO:0007628	adult walking behavior
2. P	GO:0014734	skeletal muscle hypertrophy
2. P	GO:0043066	negative regulation of apoptotic process
2. P	GO:0030914
2. P	GO:1900026	positive regulation of substrate adhesion-dependent cell spreading
2. P	GO:0005669	transcription factor TFIID complex
2. P	GO:0051497	negative regulation of stress fiber assembly
2. P	GO:0033276	transcription factor TFTC complex
3. B	GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific
3. B	GO:0034058	endosomal vesicle fusion
3. B	GO:0043652	engulfment of apoptotic cell
3. B	GO:0070530	K63-linked polyubiquitin modification-dependent protein binding
3. B	GO:0051260	protein homooligomerization
3. B	GO:0097237	cellular response to toxic substance
3. B	GO:1902410	mitotic cytokinetic process
3. B	GO:0045600	positive regulation of fat cell differentiation
3. B	GO:0000122	negative regulation of transcription by RNA polymerase II
3. B	GO:0003691	double-stranded telomeric DNA binding
3. B	GO:0045591	positive regulation of regulatory T cell differentiation
3. B	GO:1903688	positive regulation of border follicle cell migration
3. B	GO:0048060	negative gravitaxis
3. B	GO:0043372	positive regulation of CD4-positive, alpha-beta T cell differentiation
3. B	GO:0006338	chromatin remodeling
3. B	GO:0051285	cell cortex of cell tip
3. B	GO:0006325	chromatin organization
3. B	GO:0035167	larval lymph gland hemopoiesis
3. B	GO:0008327	methyl-CpG binding
3. B	GO:0090336	positive regulation of brown fat cell differentiation
3. B	GO:0048086	negative regulation of developmental pigmentation
3. B	GO:0007300	ovarian nurse cell to oocyte transport
3. B	GO:0070418	DNA-dependent protein kinase complex
3. B	GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage
3. B	GO:0048872	homeostasis of number of cells
3. B	GO:0007409	axonogenesis
3. B	GO:0019762	glucosinolate catabolic process
3. B	GO:0048626	myoblast fate specification
3. B	GO:0032888	regulation of mitotic spindle elongation
3. B	GO:0046843	dorsal appendage formation
3. B	GO:0007301	female germline ring canal formation
3. B	GO:0060446	branching involved in open tracheal system development
3. B	GO:0051170	import into nucleus
3. B	GO:0005576	extracellular region
3. B	GO:0001161	intronic transcription regulatory region sequence-specific DNA binding
3. B	GO:0008406	gonad development
3. B	GO:0006974	cellular response to DNA damage stimulus
3. B	GO:0030234	enzyme regulator activity
3. B	GO:0007517	muscle organ development
3. B	GO:0005700	polytene chromosome
3. B	GO:0045656	negative regulation of monocyte differentiation
3. B	GO:0001752	compound eye photoreceptor fate commitment
3. B	GO:0046889	positive regulation of lipid biosynthetic process
3. B	GO:0010428	methyl-CpNpG binding
3. B	GO:0042127	regulation of cell population proliferation
3. B	GO:0016319	mushroom body development
3. B	GO:0000117	regulation of transcription involved in G2/M transition of mitotic cell cycle
3. B	GO:0140297	DNA-binding transcription factor binding
3. B	GO:0008346	larval walking behavior
3. B	GO:0007266	Rho protein signal transduction
3. B	GO:0032956	regulation of actin cytoskeleton organization
3. B	GO:0061040	female gonad morphogenesis
3. B	GO:0140627	ubiquitin-dependent protein catabolic process via the C-end degron rule pathway
3. B	GO:0016476	regulation of embryonic cell shape
3. B	GO:0007163	establishment or maintenance of cell polarity
3. B	GO:0043565	sequence-specific DNA binding
3. B	GO:1990896	protein localization to cell cortex of cell tip
3. B	GO:0035070	salivary gland histolysis
3. B	GO:0000083	regulation of transcription involved in G1/S transition of mitotic cell cycle
3. B	GO:0048092	negative regulation of male pigmentation
3. B	GO:0005737	cytoplasm
3. B	GO:0007281	germ cell development
3. B	GO:0071472	cellular response to salt stress
3. B	GO:0030162	regulation of proteolysis
3. B	GO:0000935	division septum
3. B	GO:0061059	positive regulation of peptidoglycan recognition protein signaling pathway
3. B	GO:0043981	histone H4-K5 acetylation
3. B	GO:0043254	regulation of protein-containing complex assembly
3. B	GO:1901409	positive regulation of phosphorylation of RNA polymerase II C-terminal domain
3. B	GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding
3. B	GO:1903464	negative regulation of mitotic cell cycle DNA replication
3. B	GO:0007455	eye-antennal disc morphogenesis
3. B	GO:0035035	histone acetyltransferase binding
3. B	GO:0019901	protein kinase binding
3. B	GO:0040034	regulation of development, heterochronic
3. B	GO:0007283	spermatogenesis
3. B	GO:0048047	mating behavior, sex discrimination
3. B	GO:0007464	R3/R4 cell fate commitment
3. B	GO:0001658	branching involved in ureteric bud morphogenesis
3. B	GO:0048549	positive regulation of pinocytosis
3. B	GO:0002682	regulation of immune system process
3. B	GO:0030853	negative regulation of granulocyte differentiation
3. B	GO:0043231	intracellular membrane-bounded organelle
3. B	GO:0017053	transcription repressor complex
3. B	GO:0042826	histone deacetylase binding
3. B	GO:0099070	static microtubule bundle
3. B	GO:0035183	female germline ring canal inner rim
3. B	GO:0019985	translesion synthesis
3. B	GO:0016545	male courtship behavior, veined wing vibration
3. B	GO:1902231	positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage
3. B	GO:0035214	eye-antennal disc development
3. B	GO:1901044	protein polyubiquitination involved in nucleus-associated proteasomal ubiquitin-dependent protein catabolic process
3. B	GO:0016544	male courtship behavior, tapping to detect pheromone
3. B	GO:0080028	nitrile biosynthetic process
3. B	GO:0035151	regulation of tube size, open tracheal system
3. B	GO:0030890	positive regulation of B cell proliferation
3. B	GO:0048813	dendrite morphogenesis
3. B	GO:0006970	response to osmotic stress
3. B	GO:0140014	mitotic nuclear division
3. B	GO:0035075	response to ecdysone
3. B	GO:0006355	regulation of transcription, DNA-templated
3. B	GO:0070875	positive regulation of glycogen metabolic process
3. B	GO:0045629	negative regulation of T-helper 2 cell differentiation
3. B	GO:0045670	regulation of osteoclast differentiation
3. B	GO:0001222	transcription corepressor binding
3. B	GO:0010596	negative regulation of endothelial cell migration
3. B	GO:0048188	Set1C/COMPASS complex
3. B	GO:0043249	erythrocyte maturation
3. B	GO:0048477	oogenesis
3. B	GO:0048821	erythrocyte development
3. B	GO:0002829	negative regulation of type 2 immune response
3. B	GO:0048071	sex-specific pigmentation
3. B	GO:0005730	nucleolus
3. B	GO:0001046	core promoter sequence-specific DNA binding
3. B	GO:0045172	germline ring canal
3. B	GO:0031462	Cul2-RING ubiquitin ligase complex
3. B	GO:0043517	positive regulation of DNA damage response, signal transduction by p53 class mediator
3. B	GO:0098813	nuclear chromosome segregation
3. B	GO:0045595	regulation of cell differentiation
3. B	GO:0051141	negative regulation of NK T cell proliferation
3. B	GO:2000677	regulation of transcription regulatory region DNA binding
3. B	GO:0090721	primary adaptive immune response involving T cells and B cells
3. B	GO:0043984	histone H4-K16 acetylation
3. B	GO:0006110	regulation of glycolytic process
3. B	GO:2000640	positive regulation of SREBP signaling pathway
3. B	GO:0006964	positive regulation of biosynthetic process of antibacterial peptides active against Gram-negative bacteria
3. B	GO:0007411	axon guidance
3. B	GO:0055001	muscle cell development
3. B	GO:1903025	regulation of RNA polymerase II regulatory region sequence-specific DNA binding
3. B	GO:0007015	actin filament organization
3. B	GO:0061418	regulation of transcription from RNA polymerase II promoter in response to hypoxia
3. B	GO:0071688	striated muscle myosin thick filament assembly
3. B	GO:1990845	adaptive thermogenesis
3. B	GO:0007398	ectoderm development
3. B	GO:0003680	minor groove of adenine-thymine-rich DNA binding
3. B	GO:0060766	negative regulation of androgen receptor signaling pathway
3. B	GO:0016199	axon midline choice point recognition
3. B	GO:0045892	negative regulation of transcription, DNA-templated
3. B	GO:0045476	nurse cell apoptotic process
3. B	GO:0031625	ubiquitin protein ligase binding
3. B	GO:0016857	racemase and epimerase activity, acting on carbohydrates and derivatives
3. B	GO:0048065	male courtship behavior, veined wing extension
3. B	GO:0035147	branch fusion, open tracheal system
3. B	GO:0007526	larval somatic muscle development
3. B	GO:0016363	nuclear matrix
3. B	GO:0035324	female germline ring canal
3. B	GO:0016543	male courtship behavior, orientation prior to leg tapping and wing vibration
3. B	GO:1904511	cytoplasmic microtubule plus-end
3. B	GO:0048053	R1/R6 development
3. B	GO:0009608	response to symbiont
3. B	GO:0008285	negative regulation of cell population proliferation
3. B	GO:0120177	negative regulation of torso signaling pathway
3. B	GO:0010833	telomere maintenance via telomere lengthening
3. B	GO:0000209	protein polyubiquitination
3. B	GO:2000176	positive regulation of pro-T cell differentiation
3. B	GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific
3. B	GO:0048294	negative regulation of isotype switching to IgE isotypes
3. B	GO:0007478	leg disc morphogenesis
3. B	GO:2001199	negative regulation of dendritic cell differentiation
3. B	GO:0003700	DNA-binding transcription factor activity
3. B	GO:0045444	fat cell differentiation
3. B	GO:0032825	positive regulation of natural killer cell differentiation
3. B	GO:0051090	regulation of DNA-binding transcription factor activity
3. B	GO:0045650	negative regulation of macrophage differentiation
3. B	GO:0005634	nucleus
3. B	GO:0000123	histone acetyltransferase complex
3. B	GO:0071390	cellular response to ecdysone
3. B	GO:0010629	negative regulation of gene expression
3. B	GO:0022008	neurogenesis
3. B	GO:0016604	nuclear body
3. B	GO:0042682	regulation of compound eye cone cell fate specification
3. B	GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding
3. B	GO:0045677	negative regulation of R7 cell differentiation
3. B	GO:0035839	non-growing cell tip
3. B	GO:0043380	regulation of memory T cell differentiation
3. B	GO:0048750	compound eye corneal lens morphogenesis
3. B	GO:0030707	ovarian follicle cell development
3. B	GO:0042332	gravitaxis
3. B	GO:0043376	regulation of CD8-positive, alpha-beta T cell differentiation
3. B	GO:0001817	regulation of cytokine production
3. B	GO:1990756	ubiquitin ligase-substrate adaptor activity
3. B	GO:0000785	chromatin
3. B	GO:0034504	protein localization to nucleus
3. B	GO:2001200	positive regulation of dendritic cell differentiation
3. B	GO:0030183	B cell differentiation
3. B	GO:2000320	negative regulation of T-helper 17 cell differentiation
3. B	GO:1901981	phosphatidylinositol phosphate binding
3. B	GO:0001223	transcription coactivator binding
3. B	GO:0007458	progression of morphogenetic furrow involved in compound eye morphogenesis
3. B	GO:0019046	release from viral latency
3. B	GO:0045746	negative regulation of Notch signaling pathway
3. B	GO:0003682	chromatin binding
3. B	GO:0043377	negative regulation of CD8-positive, alpha-beta T cell differentiation
3. B	GO:0040003	chitin-based cuticle development
3. B	GO:0008270	zinc ion binding
3. B	GO:0007278	pole cell fate determination
3. B	GO:0006357	regulation of transcription by RNA polymerase II
3. B	GO:0030178	negative regulation of Wnt signaling pathway
3. B	GO:1900477	negative regulation of G1/S transition of mitotic cell cycle by negative regulation of transcription from RNA polymerase II promoter
3. B	GO:0071339	MLL1 complex
3. B	GO:0003279	cardiac septum development
3. B	GO:1990837	sequence-specific double-stranded DNA binding
3. B	GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
3. B	GO:0097680	double-strand break repair via classical nonhomologous end joining
3. B	GO:0042631	cellular response to water deprivation
3. B	GO:0090160	Golgi to lysosome transport
3. B	GO:0019102	male somatic sex determination
3. B	GO:0080037	negative regulation of cytokinin-activated signaling pathway
3. B	GO:0001702	gastrulation with mouth forming second
3. B	GO:0050681	androgen receptor binding
3. B	GO:0042789	mRNA transcription by RNA polymerase II
3. B	GO:0061246	establishment or maintenance of bipolar cell polarity regulating cell shape
3. B	GO:0007264	small GTPase mediated signal transduction
3. B	GO:0035001	dorsal trunk growth, open tracheal system
3. B	GO:0046332	SMAD binding
3. B	GO:0007426	tracheal outgrowth, open tracheal system
3. B	GO:0021987	cerebral cortex development
3. B	GO:2000104	negative regulation of DNA-dependent DNA replication
3. B	GO:0051272	positive regulation of cellular component movement
3. B	GO:0034629
3. B	GO:0031065	positive regulation of histone deacetylation
3. B	GO:0000792	heterochromatin
3. B	GO:0030865	cortical cytoskeleton organization
3. B	GO:0045582	positive regulation of T cell differentiation
3. B	GO:0001865	NK T cell differentiation
3. B	GO:0042675	compound eye cone cell differentiation
3. B	GO:0008049	male courtship behavior
3. B	GO:0007519	skeletal muscle tissue development
3. B	GO:0001669	acrosomal vesicle
3. B	GO:0016607	nuclear speck
3. B	GO:0045467	R7 cell development
3. B	GO:0002711	positive regulation of T cell mediated immunity
3. B	GO:0050727	regulation of inflammatory response
3. B	GO:0045944	positive regulation of transcription by RNA polymerase II
3. B	GO:0032874	positive regulation of stress-activated MAPK cascade
3. B	GO:0010114	response to red light
3. B	GO:0045821	positive regulation of glycolytic process
3. B	GO:2000773	negative regulation of cellular senescence
3. B	GO:0007562	eclosion
3. B	GO:0045893	positive regulation of transcription, DNA-templated
3. B	GO:0046580	negative regulation of Ras protein signal transduction
3. B	GO:0003170	heart valve development
3. B	GO:0005938	cell cortex
3. B	GO:0110070	cellularization cleavage furrow
3. B	GO:0042092	type 2 immune response
3. B	GO:0044354	macropinosome
3. B	GO:0032764	negative regulation of mast cell cytokine production
3. B	GO:0046982	protein heterodimerization activity
3. B	GO:2000762	regulation of phenylpropanoid metabolic process
3. B	GO:0043982	histone H4-K8 acetylation

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	E9QIN8	Kelch-like protein 41a	0.00e+00	1.73e-55	1.27e-58
1. PB	Q9Y2M5	Kelch-like protein 20	0.00e+00	5.42e-50	1.55e-155
1. PB	Q5PQR3	BTB/POZ domain-containing protein 9	1.98e-05	1.34e-04	9.81e-12
1. PB	Q5REP9	Kelch-like protein 3	0.00e+00	1.06e-71	3.45e-131
1. PB	A0A1B8YAB1	Kelch repeat and BTB domain-containing protein 8	0.00e+00	2.39e-41	1.04e-52
1. PB	Q9JFG1	Kelch repeat protein C2	NA	1.66e-21	9.11e-21
1. PB	Q8JZP3	Kelch-like protein 2	0.00e+00	3.07e-67	4.34e-125
1. PB	Q1LYM6	Kelch-like protein 38	0.00e+00	2.68e-60	1.79e-66
1. PB	A6NCF5	Kelch-like protein 33	0.00e+00	4.07e-21	3.15e-40
1. PB	Q16RL8	Kelch-like protein diablo	0.00e+00	2.79e-67	5.91e-149
1. PB	Q9CZ49	Kelch-like protein 35	0.00e+00	8.23e-54	8.21e-61
1. PB	B3DIV9	Kelch-like protein 40a	0.00e+00	2.77e-51	9.75e-61
1. PB	P21037	Kelch repeat protein C2	NA	5.63e-22	2.21e-21
1. PB	A2AUC9	Kelch-like protein 41	0.00e+00	1.83e-55	1.25e-54
1. PB	Q9C0H6	Kelch-like protein 4	0.00e+00	6.28e-16	1.56e-125
1. PB	Q8BNW9	Kelch repeat and BTB domain-containing protein 11	1.41e-08	1.24e-08	3.45e-17
1. PB	Q8BFQ9	Kelch-like protein 42	2.78e-13	1.02e-29	2.95e-14
1. PB	Q6TFL4	Kelch-like protein 24	0.00e+00	1.38e-46	2.51e-82
1. PB	A2AAX3	Kelch-like protein 15	0.00e+00	5.85e-52	2.69e-46
1. PB	Q9NVX7	Kelch repeat and BTB domain-containing protein 4	0.00e+00	1.53e-38	9.34e-24
1. PB	Q14145	Kelch-like ECH-associated protein 1	0.00e+00	5.53e-52	8.90e-115
1. PB	P32228	Protein C4	NA	8.01e-36	2.22e-27
1. PB	Q5R866	Kelch domain-containing protein 7A (Fragment)	4.95e-06	3.78e-02	1.17e-06
1. PB	Q5ZLD3	Kelch-like protein 13	0.00e+00	4.33e-47	6.64e-82
1. PB	P32206	Protein C13	NA	4.87e-42	8.47e-33
1. PB	Q5RGB8	Kelch-like protein 26	0.00e+00	8.00e-50	6.05e-66
1. PB	F1MBP6	Kelch-like protein 3	0.00e+00	5.65e-72	1.17e-131
1. PB	Q8BWA5	Kelch-like protein 31	0.00e+00	2.76e-42	7.84e-80
1. PB	Q684M4	Kelch-like ECH-associated protein 1	0.00e+00	2.79e-49	7.11e-115
1. PB	Q5ZKD9	Kelch-like protein 20	0.00e+00	1.33e-51	9.68e-154
1. PB	Q7QGL0	Kelch-like protein diablo	0.00e+00	1.49e-69	6.87e-148
1. PB	B3NDN0	Kelch-like protein diablo	0.00e+00	3.45e-45	5.25e-148
1. PB	O94819	Kelch repeat and BTB domain-containing protein 11	7.38e-10	4.49e-06	2.86e-20
1. PB	Q8IY47	Kelch repeat and BTB domain-containing protein 2	0.00e+00	9.17e-40	1.71e-50
1. PB	D3ZZC3	Kelch-like protein 22	0.00e+00	1.50e-50	3.74e-54
1. PB	Q3UQV5	Kelch repeat and BTB domain-containing protein 8	0.00e+00	3.90e-40	5.41e-49
1. PB	Q3ZB90	Kelch repeat and BTB domain-containing protein 12	0.00e+00	1.88e-37	6.27e-53
1. PB	Q8IXQ5	Kelch-like protein 7	0.00e+00	1.69e-56	4.36e-86
1. PB	Q9UH77	Kelch-like protein 3	0.00e+00	1.57e-71	1.37e-131
1. PB	E9Q4F2	Kelch-like protein 18	0.00e+00	4.76e-68	2.69e-132
1. PB	Q3U410	Kelch-like protein 21	0.00e+00	1.97e-45	4.95e-65
1. PB	O35709	Ectoderm-neural cortex protein 1	0.00e+00	5.41e-58	1.66e-74
1. PB	Q6JEL2	Kelch-like protein 10	0.00e+00	3.89e-53	5.78e-101
1. PB	Q8BUL5	Kelch-like protein 7	0.00e+00	3.33e-57	4.14e-86
1. PB	Q6Q7X9	Kelch-like protein 31	0.00e+00	2.21e-44	3.85e-75
1. PB	Q2M0J9	Kelch-like protein diablo	0.00e+00	5.99e-43	2.87e-148
1. PB	Q8QQ16	Kelch repeat and BTB domain-containing protein 1	NA	3.94e-44	5.60e-50
1. PB	Q5U374	Kelch-like protein 12	0.00e+00	4.66e-71	1.55e-133
1. PB	Q8N4N3	Kelch-like protein 36	0.00e+00	3.98e-56	5.49e-51
1. PB	Q8C726	BTB/POZ domain-containing protein 9	1.72e-05	4.30e-05	2.07e-11
1. PB	Q9H2C0	Gigaxonin	0.00e+00	2.07e-53	8.42e-63
1. PB	Q10579	Spermatocyte protein spe-26	0.00e+00	2.30e-22	2.34e-16
1. PB	Q3B7M1	Kelch-like protein 36	0.00e+00	6.58e-57	3.54e-50
1. PB	Q28068	Calicin	0.00e+00	2.76e-39	6.72e-22
1. PB	Q5U575	Kelch-like protein 21	0.00e+00	5.04e-46	7.18e-64
1. PB	O72756	Kelch repeat and BTB domain-containing protein 2	NA	7.97e-43	2.72e-23
1. PB	Q5RG82	Influenza virus NS1A-binding protein homolog A	0.00e+00	4.72e-49	1.24e-49
1. PB	Q8WVZ9	Kelch repeat and BTB domain-containing protein 7	0.00e+00	3.67e-22	1.04e-29
1. PB	Q8BHI4	Kelch repeat and BTB domain-containing protein 3	0.00e+00	2.79e-49	4.45e-38
1. PB	F1LZ52	Kelch-like protein 3	0.00e+00	2.95e-69	9.25e-130
1. PB	D2HEW7	Kelch-like protein 22	0.00e+00	3.99e-47	1.26e-53
1. PB	Q6NYM1	Kelch-like protein 21	0.00e+00	3.39e-42	9.14e-72
1. PB	Q6DFF6	Kelch-like protein 20	0.00e+00	1.49e-54	2.50e-155
1. PB	P28575	Actin-binding protein IPP	0.00e+00	7.47e-73	2.18e-97
1. PB	A2APT9	Kelch domain-containing protein 7A	1.57e-06	1.46e-02	1.52e-08
1. PB	P08073	Kelch repeat protein M-T9	NA	2.22e-50	1.76e-24
1. PB	Q5R774	Kelch-like ECH-associated protein 1	0.00e+00	1.07e-50	1.19e-114
1. PB	Q8WZ60	Kelch-like protein 6	0.00e+00	7.60e-44	1.48e-73
1. PB	Q9P2N7	Kelch-like protein 13	0.00e+00	7.16e-35	4.66e-81
1. PB	Q0GNN1	Kelch repeat and BTB domain-containing protein 2	NA	2.43e-42	2.26e-18
1. PB	Q0D2A9	Kelch-like protein 25	0.00e+00	4.75e-57	2.62e-72
1. PB	Q6RZS3	Kelch repeat protein C2	NA	2.54e-22	1.04e-20
1. PB	D3Z8N4	Kelch-like protein 20	0.00e+00	5.42e-50	1.55e-155
1. PB	Q6PF15	Kelch-like protein 35	0.00e+00	2.41e-50	2.16e-56
1. PB	Q6DEL7	Kelch-like protein 15	0.00e+00	1.77e-48	2.55e-37
1. PB	Q6V595	Kelch-like protein 6	0.00e+00	6.25e-46	5.28e-74
1. PB	Q0V8G8	Zinc finger and BTB domain-containing protein 6	1.03e-05	2.30e-02	2.15e-05
1. PB	D3ZA50	Kelch-like protein 15	0.00e+00	5.85e-52	2.69e-46
1. PB	Q8NAB2	Kelch repeat and BTB domain-containing protein 3	0.00e+00	2.03e-48	2.24e-37
1. PB	O57174	Kelch repeat protein F3	NA	1.32e-35	5.46e-21
1. PB	B4L0G9	Kelch-like protein diablo	0.00e+00	9.98e-45	1.33e-147
1. PB	P59280	Kelch-like protein 8	0.00e+00	5.70e-44	1.03e-113
1. PB	Q8R2H4	Kelch-like protein 12	0.00e+00	1.55e-72	2.16e-129
1. PB	B4HIK1	Kelch-like protein diablo	0.00e+00	2.86e-45	6.18e-148
1. PB	Q9NR64	Kelch-like protein 1	0.00e+00	7.73e-14	9.47e-134
1. PB	Q96PQ7	Kelch-like protein 5	0.00e+00	2.52e-11	1.98e-142
1. PB	Q6DFU2	Influenza virus NS1A-binding protein homolog	8.18e-13	4.87e-51	1.71e-51
1. PB	O14682	Ectoderm-neural cortex protein 1	0.00e+00	2.24e-59	1.83e-74
1. PB	Q5U504	Kelch-like protein 40	0.00e+00	2.72e-49	2.42e-50
1. PB	Q8CDE2	Calicin	0.00e+00	9.40e-40	4.42e-21
1. PB	Q6JEL3	Kelch-like protein 10	0.00e+00	2.44e-54	1.68e-101
1. PB	Q9Z2X8	Kelch-like ECH-associated protein 1	0.00e+00	2.34e-51	1.41e-115
1. PB	Q08CY1	Kelch-like protein 22	0.00e+00	9.22e-45	4.79e-65
1. PB	Q9Y573	Actin-binding protein IPP	0.00e+00	4.69e-73	3.60e-97
1. PB	Q8BRG6	Kelch-like protein 24	0.00e+00	1.77e-46	4.62e-82
1. PB	Q9NVR0	Kelch-like protein 11	0.00e+00	2.09e-22	1.22e-43
1. PB	Q9CR40	Kelch-like protein 28	0.00e+00	8.05e-133	0.0
1. PB	Q2T9Z7	Kelch-like protein 9	0.00e+00	2.74e-54	8.68e-82
1. PB	E1B932	Kelch-like protein 12	0.00e+00	2.96e-76	1.33e-127
1. PB	Q5ZI33	Kelch-like protein 7	0.00e+00	9.06e-56	2.01e-87
1. PB	Q5XI58	Calicin	0.00e+00	1.40e-39	3.95e-20
1. PB	Q08DS0	Kelch-like protein 21	0.00e+00	1.04e-43	4.03e-64
1. PB	B4GRJ2	Kelch-like protein diablo	0.00e+00	1.67e-43	3.31e-148
1. PB	Q8JLI4	Kelch repeat protein C2	NA	1.14e-23	6.30e-20
1. PB	Q8BGY4	Kelch-like protein 26	0.00e+00	7.15e-49	8.51e-69
1. PB	Q9Y6Y0	Influenza virus NS1A-binding protein	2.19e-13	1.46e-48	2.47e-58
1. PB	Q8R179	Kelch repeat and BTB domain-containing protein 4	2.77e-13	7.71e-31	2.73e-24
1. PB	Q08DK3	Kelch-like protein 20	0.00e+00	5.42e-50	1.55e-155
1. PB	Q776A6	Kelch repeat protein C2	NA	8.78e-22	1.51e-21
1. PB	C9JR72	Kelch repeat and BTB domain-containing protein 13	3.34e-12	5.61e-18	8.50e-09
1. PB	Q9P2G3	Kelch-like protein 14	0.00e+00	2.19e-47	1.24e-59
1. PB	Q9NXS3	Kelch-like protein 28	0	6.35e-151	0.0
1. PB	Q9UJP4	Kelch-like protein 21	0.00e+00	3.36e-45	5.21e-65
1. PB	B4LIG6	Kelch-like protein diablo	0.00e+00	2.68e-48	1.36e-147
1. PB	Q8R124	Kelch-like protein 36	0.00e+00	2.37e-54	2.28e-44
1. PB	Q5R7B8	Kelch-like protein 20	0.00e+00	2.50e-49	4.49e-154
1. PB	Q96M94	Kelch-like protein 15	0.00e+00	1.37e-52	2.02e-46
1. PB	Q53G59	Kelch-like protein 12	0.00e+00	1.40e-72	4.45e-129
1. PB	Q0GNQ5	Kelch repeat and BTB domain-containing protein 1	NA	4.88e-45	3.06e-49
1. PB	Q53HC5	Kelch-like protein 26	0.00e+00	4.05e-43	1.47e-65
1. PB	Q9P2J3	Kelch-like protein 9	0.00e+00	2.37e-54	5.18e-83
1. PB	P17371	Kelch repeat protein C2	NA	4.31e-21	1.99e-21
1. PB	Q8BZM0	Kelch-like protein 12	0.00e+00	6.66e-72	1.51e-129
1. PB	B1H285	Kelch repeat and BTB domain-containing protein 8	0.00e+00	5.40e-44	6.05e-48
1. PB	Q9VUU5	Kelch-like protein diablo	0.00e+00	2.86e-45	6.18e-148
1. PB	P24768	Kelch repeat and BTB domain-containing protein A55	NA	1.25e-45	3.18e-50
1. PB	Q8NBE8	Kelch-like protein 23	0.00e+00	6.63e-59	5.18e-69
1. PB	O60662	Kelch-like protein 41	0.00e+00	6.56e-56	4.91e-56
1. PB	Q69ZK5	Kelch-like protein 14	0.00e+00	1.06e-46	2.08e-58
1. PB	Q8CA72	Gigaxonin	0.00e+00	2.13e-53	1.96e-62
1. PB	Q9D783	Kelch-like protein 40	0.00e+00	5.73e-49	1.79e-44
1. PB	E9QJ30	Kelch-like protein 40b	0.00e+00	1.32e-49	9.74e-48
1. PB	P21073	Kelch repeat and BTB domain-containing protein 1	NA	2.94e-46	1.25e-50
1. PB	B4PD06	Kelch-like protein diablo	0.00e+00	2.86e-45	6.18e-148
1. PB	D4A2K4	Kelch-like protein 21	0.00e+00	1.68e-45	5.72e-65
1. PB	Q5RCQ9	Kelch-like protein 23	0.00e+00	2.64e-58	3.52e-68
1. PB	P57790	Kelch-like ECH-associated protein 1	0.00e+00	2.16e-52	4.02e-112
1. PB	A4IFG2	BTB/POZ domain-containing protein 9	2.57e-05	3.57e-05	1.48e-11
1. PB	Q9JFS4	Kelch repeat and BTB domain-containing protein 2	NA	4.11e-39	1.20e-20
1. PB	Q4KLM4	Kelch-like protein 25	0.00e+00	1.26e-52	8.24e-74
1. PB	E7F6F9	Kelch-like protein 3	0.00e+00	9.00e-65	2.30e-133
1. PB	Q5F3N5	Kelch-like protein 14	0.00e+00	2.07e-53	6.14e-61
1. PB	O72736	Kelch repeat and BTB domain-containing protein 1	NA	6.59e-46	3.25e-49
1. PB	Q8N239	Kelch-like protein 34	0.00e+00	2.39e-31	2.06e-35
1. PB	Q15916	Zinc finger and BTB domain-containing protein 6	1.13e-05	1.39e-02	1.87e-05
1. PB	Q9D618	Kelch repeat and BTB domain-containing protein 12	0.00e+00	4.50e-45	1.03e-56
1. PB	Q5R663	Kelch repeat and BTB domain-containing protein 3	0.00e+00	1.38e-48	3.48e-37
1. PB	Q8R2P1	Kelch-like protein 25	0.00e+00	4.89e-53	3.08e-74
1. PB	Q6DFF7	Kelch-like protein 25	0.00e+00	6.42e-55	2.44e-73
1. PB	Q99JN2	Kelch-like protein 22	0.00e+00	2.12e-49	1.30e-52
1. PB	E0CZ16	Kelch-like protein 3	0.00e+00	6.03e-69	8.49e-130
1. PB	Q8C828	Kelch repeat and BTB domain-containing protein 13	7.60e-12	8.06e-21	1.24e-08
1. PB	Q9D5V2	Kelch-like protein 10	0.00e+00	2.74e-54	1.79e-101
1. PB	Q9JI74	Kelch-like protein 1	0.00e+00	4.61e-14	8.75e-134
1. PB	O95198	Kelch-like protein 2	0.00e+00	6.79e-68	4.43e-125
1. PB	A0A2R8Q1W5	Kelch-like ECH-associated protein 1B	0.00e+00	2.98e-82	1.63e-111
1. PB	Q6GQU2	Kelch-like protein 23	0.00e+00	9.83e-58	1.10e-68
1. PB	Q8QMQ2	Kelch repeat and BTB domain-containing protein 1	NA	2.25e-45	1.92e-47
1. PB	Q8V2Z3	Kelch repeat protein C2	NA	8.78e-22	1.51e-21
1. PB	Q6INL2	Kelch-like protein 30	0.00e+00	1.28e-46	3.87e-54
1. PB	Q08CL3	Kelch repeat and BTB domain-containing protein 8	0.00e+00	3.82e-38	2.58e-52
1. PB	Q920Q8	Influenza virus NS1A-binding protein homolog	4.02e-13	1.98e-48	7.67e-61
1. PB	Q8C3F7	Kelch-like protein 30	0.00e+00	8.84e-57	2.60e-63
1. PB	Q5XHZ6	Kelch-like protein 7	0.00e+00	2.26e-57	9.84e-86
1. PB	Q9ER30	Kelch-like protein 41	0.00e+00	3.69e-55	8.80e-54
1. PB	B3M9V8	Kelch-like protein diablo	0.00e+00	4.77e-39	5.88e-147
1. PB	Q5BK60	Kelch-like protein 38	0.00e+00	1.71e-59	1.08e-68
1. PB	O94889	Kelch-like protein 18	0.00e+00	1.33e-71	8.00e-132
1. PB	Q5ZJU2	Kelch-like protein 15	0.00e+00	9.89e-40	1.50e-36
1. PB	P24357	Kelch repeat protein F3	NA	2.30e-32	3.98e-22
1. PB	Q56A24	Kelch-like protein 24	0.00e+00	1.77e-46	4.62e-82
1. PB	Q8JL69	Kelch repeat and BTB domain-containing protein 1	NA	2.52e-44	1.32e-49
1. PB	Q96G42	Kelch domain-containing protein 7B	2.11e-06	6.02e-05	2.27e-15
1. PB	Q802Y8	Zinc finger and BTB domain-containing protein 16-A	8.48e-01	8.77e-03	6.18e-07
1. PB	Q6TDP3	Kelch-like protein 17	0.00e+00	9.09e-46	6.44e-145
1. PB	Q6NRH0	Kelch-like protein 12	0.00e+00	3.60e-67	2.07e-126
1. PB	Q503R4	Kelch-like protein 36	0.00e+00	4.22e-57	7.74e-60
1. PB	Q9H511	Kelch-like protein 31	0.00e+00	5.99e-43	1.19e-79
1. PB	Q5EB39	Kelch-like protein 40	0.00e+00	2.73e-47	5.61e-47
1. PB	Q8QMN3	Kelch repeat and BTB domain-containing protein 2	NA	1.69e-44	1.67e-21
1. PB	A6QQY2	Kelch-like protein 13	0.00e+00	1.56e-34	4.86e-81
1. PB	Q86V97	Kelch repeat and BTB domain-containing protein 6	0.00e+00	3.66e-25	2.17e-31
1. PB	Q1ECZ2	Kelch-like ECH-associated protein 1A	0.00e+00	3.80e-68	1.21e-107
1. PB	B4MXW3	Kelch-like protein diablo	0.00e+00	3.33e-22	7.83e-147
1. PB	P87617	Kelch repeat protein C2	NA	5.52e-22	6.30e-22
1. PB	P34569	Kelch repeat-containing protein kel-10	0.00e+00	1.26e-35	4.05e-21
1. PB	Q6ZPT1	Kelch-like protein 9	0.00e+00	1.54e-55	1.93e-83
1. PB	Q6TDP4	Kelch-like protein 17	0.00e+00	5.72e-45	1.95e-144
1. PB	Q7ZVQ8	Influenza virus NS1A-binding protein homolog B	5.44e-15	4.61e-51	5.47e-46
1. PB	Q96Q07	BTB/POZ domain-containing protein 9	1.86e-05	1.69e-04	4.64e-12
1. PB	F1QEG2	Kelch-like protein 41b	0.00e+00	3.07e-48	5.20e-46
1. PB	Q2TBA0	Kelch-like protein 40	0.00e+00	2.32e-47	3.97e-29
1. PB	Q8K430	Kelch-like protein 17	0.00e+00	9.09e-46	6.44e-145
1. PB	Q5RDY3	Kelch repeat and BTB domain-containing protein 2	0.00e+00	4.33e-38	4.59e-50
1. PB	Q80TF4	Kelch-like protein 13	0.00e+00	9.40e-40	1.52e-80
1. PB	Q53GT1	Kelch-like protein 22	0.00e+00	8.46e-50	1.36e-55
1. PB	B0WWP2	Kelch-like protein diablo	0.00e+00	8.03e-70	9.48e-149
1. PB	B4QLQ2	Kelch-like protein diablo	0.00e+00	6.03e-45	1.16e-146
1. PB	Q13939	Calicin	0.00e+00	2.19e-42	1.91e-21
1. PB	Q0D2K2	Kelch-like protein 30	0.00e+00	2.76e-55	1.64e-59
1. PB	Q3ZCT8	Kelch repeat and BTB domain-containing protein 12	0.00e+00	5.67e-47	1.54e-54
1. PB	Q8NFY9	Kelch repeat and BTB domain-containing protein 8	0.00e+00	1.20e-41	5.74e-49
1. PB	Q5R4S6	Kelch repeat and BTB domain-containing protein 4	1.37e-13	9.82e-39	1.05e-23
1. PB	Q8BSF5	Kelch-like protein 38	0.00e+00	2.61e-59	7.43e-69
1. PB	Q9P2G9	Kelch-like protein 8	0.00e+00	6.92e-54	2.76e-115
1. PB	B4J045	Kelch-like protein diablo	0.00e+00	3.19e-46	3.33e-147
1. PB	Q9H0H3	Kelch-like protein 25	0.00e+00	6.92e-54	1.22e-74
1. PB	Q9P2K6	Kelch-like protein 42	1.33e-15	1.36e-32	4.07e-14
1. PB	Q96NJ5	Kelch-like protein 32	0.00e+00	6.06e-49	1.59e-54
1. PB	F1LZF0	Kelch-like protein 2	0.00e+00	4.09e-67	8.74e-125
1. PB	Q8CE33	Kelch-like protein 11	0.00e+00	5.98e-25	1.58e-43
1. PB	Q2WGJ6	Kelch-like protein 38	0.00e+00	1.95e-57	4.86e-71
1. PB	Q09563	Kelch repeat and BTB domain-containing protein F47D12.7	0.00e+00	3.08e-41	7.29e-23
1. PB	P22611	Kelch repeat protein M-T8	NA	3.27e-45	2.30e-19
1. PB	Q66HD2	Kelch-like protein 36	0.00e+00	1.45e-55	5.02e-45
1. PB	P21013	Kelch repeat protein F3	NA	1.06e-31	1.32e-21
1. PB	G5ED84	Kelch-like protein 8	0.00e+00	1.63e-31	1.03e-93
1. PB	Q9N010	Kelch repeat and BTB domain-containing protein 4	0.00e+00	2.09e-26	3.81e-23
1. PB	Q8VCK5	Kelch-like protein 20	0.00e+00	1.23e-53	1.24e-155
2. P	Q5UPB5	Putative BTB/POZ domain-containing protein L35	NA	7.31e-03	NA
2. P	O75529	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L	6.98e-04	1.38e-03	NA
2. P	Q6S7B0	Transcription initiation factor TFIID subunit 5	3.39e-03	5.55e-03	NA
2. P	Q9XTA3	Myocilin	7.17e-03	3.47e-02	NA
2. P	Q5UPG1	Putative BTB/POZ domain-containing protein L85	NA	4.51e-05	NA
2. P	Q5UPS2	Putative BTB/POZ domain and WD-repeat protein R783	NA	3.93e-02	NA
2. P	Q8N0X2	Sperm-associated antigen 16 protein	1.67e-03	9.50e-03	NA
2. P	O74319	Transcription initiation factor TFIID subunit taf73	6.51e-04	4.41e-02	NA
2. P	P49846	Transcription initiation factor TFIID subunit 5	2.29e-03	3.45e-03	NA
2. P	Q5UPH2	Putative BTB/POZ domain-containing protein L98	NA	5.72e-03	NA
2. P	Q5UPF2	Putative BTB/POZ domain-containing protein L76	NA	2.69e-02	NA
2. P	Q5UQA8	Putative BTB/POZ domain-containing protein R541	NA	8.95e-03	NA
2. P	Q8K450	Sperm-associated antigen 16 protein	1.06e-03	3.30e-04	NA
2. P	Q866N2	Myocilin	1.24e-03	1.76e-02	NA
2. P	Q5UPH7	Putative BTB/POZ domain-containing protein L107	NA	8.86e-03	NA
2. P	Q5UPR9	Putative BTB/POZ domain and WD-repeat protein R786	NA	1.03e-02	NA
2. P	Q5UQ07	Putative BTB/POZ domain-containing protein L788	NA	1.25e-07	NA
2. P	Q5UPD8	Putative BTB/POZ domain-containing protein L67	NA	1.44e-05	NA
2. P	P0DPA1	WD repeat-containing protein DDB_G0349043	1.83e-03	4.43e-03	NA
2. P	A6ZZZ8	CCR4-associated factor 4	1.82e-03	3.97e-02	NA
2. P	Q5UPC7	Putative BTB/POZ domain-containing protein L55	NA	2.25e-03	NA
2. P	Q5URB7	Putative BTB/POZ domain-containing protein R842	NA	5.91e-04	NA
2. P	Q5UQT6	Uncharacterized WD repeat-containing protein L344	NA	1.90e-03	NA
2. P	O82253	BTB/POZ domain-containing protein SETH6	4.45e-03	2.24e-02	NA
2. P	Q5UPG9	Putative BTB/POZ domain-containing protein L89	NA	8.09e-03	NA
2. P	Q91WQ5	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L	5.39e-04	3.73e-04	NA
2. P	Q5UPL6	Putative BTB/POZ domain and WD-repeat protein R154	NA	1.31e-02	NA
2. P	Q5UPQ3	Putative BTB/POZ domain-containing protein R765	NA	1.75e-02	NA
2. P	Q5UNY1	Putative BTB/POZ domain and WD-repeat protein R731	NA	2.29e-04	NA
2. P	Q5UPD3	Putative BTB/POZ domain and WD-repeat protein R61	NA	1.31e-04	NA
2. P	Q5UNZ2	Putative BTB/POZ domain and WD-repeat protein R739	NA	6.11e-04	NA
2. P	Q5UQI0	Putative BTB/POZ domain-containing protein R830	NA	5.73e-06	NA
3. B	Q7TQI7	Ankyrin repeat and BTB/POZ domain-containing protein 2	1.09e-02	NA	6.79e-06
3. B	P51610	Host cell factor 1	1.68e-05	NA	0.002
3. B	Q08376	Zinc finger and BTB domain-containing protein 14	8.51e-01	NA	5.60e-09
3. B	Q6P8B3	Speckle-type POZ protein	6.82e-08	NA	4.46e-06
3. B	P87061	Tip elongation aberrant protein 1	2.05e-06	NA	4.46e-05
3. B	Q0IJ29	Zinc finger and BTB domain-containing protein 18	8.62e-01	NA	4.70e-07
3. B	Q84M94	F-box/kelch-repeat protein At1g26930	1.30e-06	NA	3.38e-06
3. B	Q4VBD9	GDNF-inducible zinc finger protein 1	4.38e-01	NA	8.62e-07
3. B	P34147	Rho-related protein racA	1.90e-04	NA	0.029
3. B	B1WAZ8	Zinc finger and BTB domain-containing protein 8A	5.17e-04	NA	1.16e-05
3. B	Q9XV51	BTB and MATH domain-containing protein 45	1.05e-03	NA	8.39e-05
3. B	Q8NCN2	Zinc finger and BTB domain-containing protein 34	1.89e-04	NA	1.49e-08
3. B	Q8RY71	Epithiospecifier protein	1.03e-12	NA	6.08e-04
3. B	Q0IHH9	Speckle-type POZ protein B	6.02e-08	NA	5.75e-06
3. B	Q8IYD2	Kelch domain-containing protein 8A	4.44e-16	NA	4.56e-17
3. B	Q8K2J9	BTB/POZ domain-containing protein 6	5.06e-05	NA	3.42e-11
3. B	Q86UZ6	Zinc finger and BTB domain-containing protein 46	4.96e-03	NA	5.29e-08
3. B	Q9ULJ3	Zinc finger and BTB domain-containing protein 21	3.07e-02	NA	3.47e-08
3. B	O43829	Zinc finger and BTB domain-containing protein 14	8.07e-01	NA	5.70e-09
3. B	Q9D2D9	Kelch domain-containing protein 8B	5.20e-14	NA	1.98e-14
3. B	Q9QZ48	Zinc finger and BTB domain-containing protein 7A	2.64e-02	NA	3.05e-14
3. B	O94844	Rho-related BTB domain-containing protein 1	1.57e-04	NA	8.60e-05
3. B	P0C2F9	Putative F-box/kelch-repeat protein At4g39756	2.36e-04	NA	1.35e-04
3. B	O82374	Putative F-box/kelch-repeat protein At2g29820	9.37e-06	NA	0.038
3. B	Q64321	Zinc finger and BTB domain-containing protein 7B	4.76e-01	NA	5.97e-10
3. B	Q24206	Broad-complex core protein isoform 6	1.62e-02	NA	2.11e-04
3. B	Q80X44	Zinc finger and BTB domain-containing protein 24	4.02e-01	NA	1.04e-06
3. B	Q9DB72	BTB/POZ domain-containing protein 17	1.22e-07	NA	0.002
3. B	Q8CII0	Zinc finger and BTB domain-containing protein 8B	3.19e-03	NA	4.01e-04
3. B	Q7KQZ4	Longitudinals lacking protein, isoforms A/B/D/L	2.12e-02	NA	3.82e-06
3. B	Q9CAG8	F-box/kelch-repeat protein At1g67480	1.70e-07	NA	4.60e-10
3. B	Q9DAI4	Zinc finger and BTB domain-containing protein 43	1.43e-04	NA	2.32e-06
3. B	Q5SVQ8	Zinc finger and BTB domain-containing protein 41	2.09e-01	NA	5.27e-04
3. B	Q5RCZ7	RCC1 and BTB domain-containing protein 2	1.55e-06	NA	2.88e-04
3. B	Q9M2B5	Putative F-box/kelch-repeat protein At3g43710	6.28e-06	NA	0.027
3. B	Q9CQ33	Leucine-zipper-like transcriptional regulator 1	7.12e-08	NA	1.50e-04
3. B	Q8N143	B-cell CLL/lymphoma 6 member B protein	7.67e-01	NA	1.60e-04
3. B	Q9LYY6	Putative F-box/kelch-repeat protein At5g02995	5.63e-04	NA	0.001
3. B	O14248	Tip elongation aberrant protein 3	1.33e-04	NA	1.69e-06
3. B	Q9T0E4	Putative F-box/kelch-repeat protein At4g11770	4.27e-06	NA	0.005
3. B	O28112	Kelch domain-containing protein AF_2170	8.94e-14	NA	0.004
3. B	Q811H0	Zinc finger and BTB domain-containing protein 42	7.06e-01	NA	6.42e-05
3. B	Q9H116	GDNF-inducible zinc finger protein 1	4.78e-01	NA	1.34e-04
3. B	Q9BYZ6	Rho-related BTB domain-containing protein 2	9.20e-05	NA	0.002
3. B	Q9Y2F9	BTB/POZ domain-containing protein 3	7.46e-05	NA	3.29e-10
3. B	Q01820	Protein germ cell-less	3.06e-04	NA	9.10e-05
3. B	O15060	Zinc finger and BTB domain-containing protein 39	7.73e-01	NA	4.60e-04
3. B	Q9LI89	F-box/kelch-repeat protein At3g27150	3.92e-06	NA	5.01e-05
3. B	O14867	Transcription regulator protein BACH1	3.47e-02	NA	8.16e-06
3. B	Q8NAP8	Zinc finger and BTB domain-containing protein 8B	4.02e-03	NA	4.32e-04
3. B	Q9W0K4	Protein bric-a-brac 2	6.15e-03	NA	6.40e-06
3. B	A1YPR0	Zinc finger and BTB domain-containing protein 7C	9.00e-04	NA	1.76e-12
3. B	M3XQV7	BTB/POZ domain-containing protein 3	5.74e-05	NA	3.53e-10
3. B	Q9HC78	Zinc finger and BTB domain-containing protein 20	8.04e-01	NA	1.26e-09
3. B	P10074	Telomere zinc finger-associated protein	2.90e-02	NA	0.027
3. B	Q96K62	Zinc finger and BTB domain-containing protein 45	6.92e-03	NA	1.03e-09
3. B	Q5R633	Telomere zinc finger-associated protein	3.80e-01	NA	0.027
3. B	P42283	Longitudinals lacking protein, isoform G	3.65e-03	NA	5.51e-06
3. B	O49488	Putative F-box/kelch-repeat protein At4g34170	7.77e-06	NA	5.23e-04
3. B	B9DHT4	ARM REPEAT PROTEIN INTERACTING WITH ABF2	1.34e-04	NA	4.48e-06
3. B	Q8NAP3	Zinc finger and BTB domain-containing protein 38	9.49e-01	NA	6.39e-05
3. B	O82375	Putative F-box/kelch-repeat protein At2g29810	6.58e-06	NA	0.002
3. B	Q8BXX2	Zinc finger and BTB domain-containing protein 49	6.34e-01	NA	2.66e-10
3. B	Q6GQW0	Ankyrin repeat and BTB/POZ domain-containing protein BTBD11	8.36e-03	NA	1.09e-09
3. B	Q6P882	Zinc finger and BTB domain-containing protein 8A.2	5.18e-04	NA	1.17e-06
3. B	Q5XKL5	BTB/POZ domain-containing protein 8	1.50e-05	NA	4.93e-05
3. B	Q9FZJ3	Putative F-box/kelch-repeat protein At1g27420	7.15e-08	NA	6.11e-09
3. B	Q9FKJ0	F-box/kelch-repeat protein At5g60570	1.82e-07	NA	2.07e-04
3. B	O08764	Ankyrin repeat and BTB/POZ domain-containing protein 2	9.20e-03	NA	1.98e-04
3. B	Q96IK5	Germ cell-less protein-like 1	2.22e-06	NA	4.20e-07
3. B	Q9P2R3	Rabankyrin-5	2.01e-02	NA	0.010
3. B	P52739	Zinc finger protein 131	7.68e-01	NA	0.001
3. B	Q9LM55	F-box/kelch-repeat protein At1g22040	5.79e-06	NA	4.29e-04
3. B	Q7KRI2	Longitudinals lacking protein-like	1.56e-06	NA	1.04e-07
3. B	Q99592	Zinc finger and BTB domain-containing protein 18	8.97e-01	NA	2.82e-07
3. B	Q8H4D4	tRNA wybutosine-synthesizing protein 2/3/4	4.06e-04	NA	0.008
3. B	Q19981	Putative protein tag-53	7.38e-05	NA	0.005
3. B	Q8IXV7	Kelch domain-containing protein 8B	2.00e-15	NA	1.03e-14
3. B	Q9M0E6	F-box/kelch-repeat protein At4g29370	7.46e-06	NA	0.012
3. B	Q9DCM7	Nucleus accumbens-associated protein 2	2.48e-04	NA	0.023
3. B	Q52KB5	Zinc finger and BTB domain-containing protein 24	6.92e-01	NA	5.14e-08
3. B	Q8LEV3	BTB/POZ domain-containing protein At2g30600	5.80e-05	NA	9.05e-08
3. B	Q86B87	Modifier of mdg4	2.19e-03	NA	6.42e-05
3. B	Q9SJ04	F-box/kelch-repeat protein SKIP6	1.61e-06	NA	6.29e-11
3. B	Q70JS2	Ring canal kelch homolog	NA	NA	6.39e-127
3. B	Q8K0L9	Zinc finger and BTB domain-containing protein 20	7.92e-01	NA	1.22e-09
3. B	Q3B7N9	Myoneurin	2.30e-01	NA	2.78e-08
3. B	Q3SWU4	Zinc finger and BTB domain-containing protein 44	4.25e-04	NA	4.23e-13
3. B	O49326	Nitrile-specifier protein 2	3.06e-12	NA	3.91e-06
3. B	Q9LYL9	BTB/POZ domain-containing protein At3g56230	1.04e-05	NA	3.76e-04
3. B	O80582	F-box/kelch-repeat protein At2g44130	4.78e-05	NA	6.49e-09
3. B	Q7TSZ8	Nucleus accumbens-associated protein 1	2.75e-04	NA	0.005
3. B	Q6ZSB9	Zinc finger and BTB domain-containing protein 49	6.12e-01	NA	5.48e-10
3. B	Q9M2C9	F-box/kelch-repeat protein SKIP4	5.79e-07	NA	2.01e-04
3. B	O35260	Nucleus accumbens-associated protein 1	4.70e-05	NA	0.004
3. B	Q0V9W6	BTB/POZ domain-containing protein 6	3.97e-05	NA	1.76e-11
3. B	Q9LYY3	F-box/kelch-repeat protein At5g03020	5.12e-04	NA	4.17e-05
3. B	A6QL63	Ankyrin repeat and BTB/POZ domain-containing protein BTBD11	1.19e-02	NA	3.00e-09
3. B	O95199	RCC1 and BTB domain-containing protein 2	4.39e-05	NA	2.88e-04
3. B	Q5RAU9	Zinc finger protein 131	6.98e-01	NA	0.001
3. B	Q9T031	F-box/kelch-repeat protein At4g39240	2.77e-06	NA	1.96e-05
3. B	Q9M1Y1	F-box/kelch-repeat protein SKIP20	3.32e-05	NA	0.007
3. B	P97303	Transcription regulator protein BACH2	4.45e-02	NA	6.99e-07
3. B	Q9SDM9	Nitrile-specifier protein 1	2.84e-12	NA	3.54e-08
3. B	Q20681	BTB and MATH domain-containing protein 38	1.07e-04	NA	9.40e-08
3. B	A6NE02	BTB/POZ domain-containing protein 17	1.15e-08	NA	6.44e-05
3. B	Q9V410	Leucine-zipper-like transcriptional regulator 1 homolog	1.02e-05	NA	6.19e-04
3. B	Q8K088	Zinc finger and BTB domain-containing protein 6	1.41e-05	NA	2.49e-05
3. B	Q99LJ7	RCC1 and BTB domain-containing protein 2	1.33e-04	NA	4.67e-04
3. B	Q55BF8	RING finger domain and kelch repeat-containing protein DDB_G0271372	9.62e-08	NA	1.27e-07
3. B	Q717B4	TD and POZ domain-containing protein 3	8.24e-06	NA	0.002
3. B	Q2M2N2	Speckle-type POZ protein-like	2.63e-06	NA	2.83e-05
3. B	Q2LE78	BTB/POZ domain-containing protein 6	8.68e-05	NA	3.91e-12
3. B	O15062	Zinc finger and BTB domain-containing protein 5	4.17e-03	NA	7.94e-11
3. B	Q5EXX3	Zinc finger and BTB domain-containing protein 38	9.82e-01	NA	7.09e-05
3. B	Q6NRS1	Inhibitor of Bruton tyrosine kinase	1.05e-01	NA	0.007
3. B	Q5RCW7	Kelch domain-containing protein 8B	2.89e-15	NA	6.38e-15
3. B	P34371	BTB and MATH domain-containing protein 42	1.65e-05	NA	3.34e-11
3. B	Q6ZWS8	Speckle-type POZ protein	5.24e-06	NA	1.03e-05
3. B	Q5R5N5	Myoneurin	5.24e-01	NA	2.20e-08
3. B	Q9V5M6	Longitudinals lacking protein, isoforms J/P/Q/S/Z	1.30e-02	NA	3.79e-06
3. B	Q6DBN1	BTB/POZ domain-containing protein At4g08455	1.90e-06	NA	1.88e-11
3. B	O82370	Putative F-box/kelch-repeat protein At2g29860	6.09e-04	NA	0.002
3. B	Q8NDN9	RCC1 and BTB domain-containing protein 1	4.14e-08	NA	1.01e-04
3. B	D3ZUU2	GDNF-inducible zinc finger protein 1	1.96e-02	NA	5.92e-05
3. B	Q25386	Beta-scruin	4.70e-05	NA	1.51e-14
3. B	Q9W2S3	BTB/POZ domain-containing protein 9	1.47e-04	NA	2.64e-12
3. B	Q8BID6	Zinc finger and BTB domain-containing protein 46	3.58e-02	NA	3.02e-07
3. B	Q6NRM8	Zinc finger and BTB domain-containing protein 18.3	6.70e-01	NA	1.04e-06
3. B	Q99MD8	Myoneurin	8.05e-02	NA	3.00e-08
3. B	B1WBU4	Zinc finger and BTB domain-containing protein 8A	2.09e-04	NA	3.04e-08
3. B	Q8N961	Ankyrin repeat and BTB/POZ domain-containing protein 2	8.57e-03	NA	5.59e-05
3. B	Q0P4X6	Zinc finger and BTB domain-containing protein 44	2.67e-03	NA	2.13e-14
3. B	P0DMR6	TD and POZ domain-containing protein 1-like	1.26e-05	NA	2.00e-04
3. B	Q9Y2K1	Zinc finger and BTB domain-containing protein 1	9.03e-01	NA	3.35e-06
3. B	O15209	Zinc finger and BTB domain-containing protein 22	2.95e-03	NA	8.94e-07
3. B	A1L4W5	BTB/POZ and MATH domain-containing protein 6	7.60e-05	NA	9.06e-06
3. B	P42284	Longitudinals lacking protein, isoforms H/M/V	5.58e-03	NA	2.50e-06
3. B	Q96C00	Zinc finger and BTB domain-containing protein 9	1.04e-04	NA	1.17e-06
3. B	P51611	Host cell factor 1	2.23e-05	NA	5.86e-04
3. B	Q8L765	BTB/POZ and MATH domain-containing protein 1	3.10e-05	NA	1.84e-05
3. B	Q9W0K7	Protein bric-a-brac 1	3.76e-02	NA	8.13e-05
3. B	Q97Z97	Kelch domain-containing protein SSO1033	1.08e-08	NA	3.64e-04
3. B	Q6GR09	Speckle-type POZ protein-like	2.22e-06	NA	1.07e-04
3. B	Q9FI70	F-box/kelch-repeat protein At5g49000	4.56e-06	NA	0.005
3. B	Q7ZVR6	Myoneurin	2.42e-01	NA	2.17e-06
3. B	Q9UFB7	Zinc finger and BTB domain-containing protein 47	8.87e-01	NA	2.91e-05
3. B	Q8VEM9	Kelch domain-containing protein 3	2.77e-12	NA	0.018
3. B	Q96RE7	Nucleus accumbens-associated protein 1	4.94e-04	NA	0.003
3. B	Q8NCP5	Zinc finger and BTB domain-containing protein 44	1.09e-03	NA	5.52e-13
3. B	P0C7A6	Ankyrin repeat and BTB/POZ domain-containing protein BTBD11-B	7.67e-03	NA	3.28e-05
3. B	Q91X45	Zinc finger and BTB domain-containing protein 3	6.84e-05	NA	1.54e-08
3. B	Q9ZW38	F-box/kelch-repeat protein At2g29600	7.82e-06	NA	6.85e-06
3. B	Q9NPC7	Myoneurin	4.34e-02	NA	2.07e-08
3. B	F7ASZ0	BTB/POZ domain-containing protein 3	5.94e-05	NA	3.12e-10
3. B	Q867Z4	Longitudinals lacking protein, isoforms F/I/K/T	4.86e-03	NA	1.31e-05
3. B	Q5E9V5	Kelch domain-containing protein 8B	2.66e-15	NA	2.12e-17
3. B	Q93XW5	Nitrile-specifier protein 5	4.44e-16	NA	2.07e-04
3. B	Q7T330	Speckle-type POZ protein	1.34e-07	NA	3.45e-06
3. B	Q973G3	Kelch domain-containing protein STK_09390	4.03e-10	NA	7.55e-05
3. B	B7U179	ARMADILLO BTB ARABIDOPSIS PROTEIN 1	4.08e-04	NA	1.77e-05
3. B	Q9SIJ3	Putative F-box/kelch-repeat protein At2g21680	2.88e-05	NA	2.62e-06
3. B	Q94420	Protein maternal effect lethal 26	4.23e-06	NA	1.43e-05
3. B	Q0IIC2	Kelch domain-containing protein 10	9.35e-13	NA	0.006
3. B	P17789	Protein tramtrack, beta isoform	3.36e-03	NA	4.60e-04
3. B	Q9M1W7	F-box/kelch-repeat protein SKIP30	8.42e-09	NA	3.92e-07
3. B	Q9Z0G7	Zinc finger and BTB domain-containing protein 22	4.20e-02	NA	1.28e-06
3. B	Q562B4	Nucleus accumbens-associated protein 2	5.34e-04	NA	0.022
3. B	Q9KR69	N-acetylneuraminate epimerase	5.38e-14	NA	0.039
3. B	Q0IH98	Zinc finger and BTB domain-containing protein 8A.1-A	5.65e-04	NA	4.45e-06
3. B	Q6IQ16	Speckle-type POZ protein-like	1.22e-06	NA	1.17e-05
3. B	O88939	Zinc finger and BTB domain-containing protein 7A	3.53e-03	NA	4.73e-14
3. B	B1WBS3	Zinc finger and BTB domain-containing protein 42	6.99e-01	NA	5.30e-05
3. B	Q5R4Q7	Leucine-zipper-like transcriptional regulator 1	2.31e-11	NA	6.20e-05
3. B	Q6P798	RCC1 and BTB domain-containing protein 2	3.72e-05	NA	0.002
3. B	Q9LK86	Putative F-box/kelch-repeat protein At3g27910	5.42e-06	NA	3.11e-08
3. B	Q8GXF6	F-box/kelch-repeat protein At4g19870	3.56e-05	NA	0.003
3. B	O88282	B-cell CLL/lymphoma 6 member B protein	5.81e-01	NA	1.26e-04
3. B	Q60821	Zinc finger and BTB domain-containing protein 17	8.68e-02	NA	5.09e-09
3. B	Q0VCJ6	Zinc finger and BTB domain-containing protein 8A	1.27e-03	NA	8.90e-09
3. B	Q3B725	Zinc finger and BTB domain-containing protein 24	5.66e-01	NA	5.27e-06
3. B	Q8BN78	Transcriptional regulator Kaiso	1.42e-04	NA	1.77e-04
3. B	Q6NXM2	RCC1 and BTB domain-containing protein 1	1.39e-06	NA	8.57e-05
3. B	Q91XA8	Kelch domain-containing protein 8A	3.33e-16	NA	1.16e-17
3. B	Q04652	Ring canal kelch protein	NA	NA	2.37e-124
3. B	Q6AYI2	Kelch domain-containing protein 3	2.05e-12	NA	0.017
3. B	Q25390	Alpha-scruin	4.41e-06	NA	1.70e-13
3. B	Q8N653	Leucine-zipper-like transcriptional regulator 1	5.44e-08	NA	1.18e-04
3. B	P41182	B-cell lymphoma 6 protein	6.65e-01	NA	0.007
3. B	Q5XIA9	Kelch domain-containing protein 8B	4.10e-14	NA	1.28e-14
3. B	Q96CT2	Kelch-like protein 29	0.00e+00	NA	2.01e-72
3. B	Q9FPW6	BTB/POZ domain-containing protein POB1	2.18e-03	NA	1.53e-08
3. B	Q9JLZ6	Hypermethylated in cancer 2 protein	5.79e-01	NA	0.002
3. B	Q9T0E2	Putative F-box/kelch-repeat protein At4g11750	4.87e-05	NA	1.26e-04
3. B	O82373	F-box/kelch-repeat protein At2g29830	2.98e-06	NA	6.91e-04
3. B	Q96BR9	Zinc finger and BTB domain-containing protein 8A	4.24e-03	NA	9.46e-09
3. B	Q9V5M3	Longitudinals lacking protein, isoforms N/O/W/X/Y	9.82e-03	NA	3.73e-06
3. B	Q9BYV9	Transcription regulator protein BACH2	4.28e-02	NA	1.57e-06
3. B	Q7ZX06	Speckle-type POZ protein A	6.05e-08	NA	4.46e-06
3. B	Q9LYY5	Putative F-box/kelch-repeat protein At5g03000	1.20e-03	NA	7.58e-04
3. B	Q96JB3	Hypermethylated in cancer 2 protein	3.88e-01	NA	0.001
3. B	Q52KG4	Zinc finger and BTB domain-containing protein 45	7.43e-01	NA	6.10e-09
3. B	Q93W93	F-box/kelch-repeat protein At1g55270	4.53e-05	NA	1.52e-09
3. B	Q14526	Hypermethylated in cancer 1 protein	4.88e-01	NA	0.023
3. B	Q9SRV1	BTB/POZ and MATH domain-containing protein 4	8.80e-05	NA	0.001
3. B	Q6PID8	Kelch domain-containing protein 10	1.49e-12	NA	0.006
3. B	O43298	Zinc finger and BTB domain-containing protein 43	2.60e-04	NA	1.15e-05
3. B	Q07797	Galectin-3-binding protein	3.39e-05	NA	0.047
3. B	Q9VQ30	Zinc finger protein chinmo	1.34e-03	NA	1.27e-05
3. B	P34568	BTB and MATH domain-containing protein 43	1.27e-04	NA	5.07e-05
3. B	Q5F293	Zinc finger and BTB domain-containing protein 4	4.15e-01	NA	0.007
3. B	Q91VL9	Zinc finger and BTB domain-containing protein 1	8.89e-01	NA	3.24e-06
3. B	Q6YCH2	TD and POZ domain-containing protein 4	7.56e-05	NA	1.62e-04
3. B	P0DMR5	TD and POZ domain-containing protein 1	4.14e-06	NA	3.35e-04
3. B	A9JRD8	BTB/POZ domain-containing protein 6-A	4.08e-05	NA	1.88e-11
3. B	P97302	Transcription regulator protein BACH1	3.21e-02	NA	2.06e-06
3. B	Q5BL35	Speckle-type POZ protein-like A	1.90e-06	NA	7.87e-06
3. B	Q8L736	F-box/kelch-repeat protein SKIP11	7.97e-07	NA	2.48e-05
3. B	Q9Y330	Zinc finger and BTB domain-containing protein 12	7.82e-01	NA	7.44e-06
3. B	Q5TZE1	BTB/POZ domain-containing protein 6-B	1.87e-05	NA	8.32e-11
3. B	P41183	B-cell lymphoma 6 protein homolog	8.26e-01	NA	0.010
3. B	Q0VCW1	Speckle-type POZ protein	1.26e-05	NA	1.03e-05
3. B	A0JN76	Zinc finger and BTB domain-containing protein 18	4.65e-01	NA	2.72e-07
3. B	Q8VCZ7	Zinc finger and BTB domain-containing protein 7C	1.34e-03	NA	4.56e-13
3. B	Q9P1Z0	Zinc finger and BTB domain-containing protein 4	5.70e-01	NA	0.004
3. B	Q6NPN5	F-box/kelch-repeat protein At5g26960	1.41e-07	NA	5.82e-09
3. B	O43167	Zinc finger and BTB domain-containing protein 24	4.69e-01	NA	3.80e-05
3. B	Q9H0C5	BTB/POZ domain-containing protein 1	5.95e-07	NA	1.88e-10
3. B	Q01295	Broad-complex core protein isoforms 1/2/3/4/5	5.39e-02	NA	1.24e-04
3. B	Q920G9	Germ cell-less protein-like 1	2.75e-06	NA	9.70e-07
3. B	Q801P1	Zinc finger and BTB domain-containing protein 18	8.40e-01	NA	8.11e-07
3. B	P58544	BTB/POZ domain-containing protein 1	1.82e-06	NA	1.33e-10
3. B	Q91V93	Rho-related BTB domain-containing protein 2	5.35e-04	NA	0.002
3. B	Q8R0A2	Zinc finger and BTB domain-containing protein 44	3.91e-04	NA	4.16e-13
3. B	P14083	Protein jim lovell	1.91e-02	NA	2.62e-05
3. B	Q67XN8	F-box/kelch-repeat protein At4g39560	4.12e-03	NA	0.004
3. B	O15156	Zinc finger and BTB domain-containing protein 7B	4.40e-01	NA	4.97e-10
3. B	A1YEX3	Zinc finger and BTB domain-containing protein 25	4.43e-03	NA	4.34e-05
3. B	Q0WW40	F-box/kelch-repeat protein At1g16250	2.72e-08	NA	5.15e-10
3. B	Q90850	Hypermethylated in cancer 1 protein (Fragment)	3.69e-01	NA	0.001
3. B	D3YUB6	BTB/POZ domain-containing protein 8	2.11e-06	NA	0.044
3. B	Q96BF6	Nucleus accumbens-associated protein 2	6.49e-04	NA	0.023
3. B	Q3ED93	Kelch repeat-containing protein At1g19460	1.19e-05	NA	0.003
3. B	Q54D84	Trishanku	1.44e-03	NA	1.35e-06
3. B	Q13105	Zinc finger and BTB domain-containing protein 17	6.63e-02	NA	8.65e-09
3. B	Q811F1	Zinc finger and BTB domain-containing protein 41	2.22e-01	NA	6.75e-04
3. B	Q9WUK6	Zinc finger and BTB domain-containing protein 18	7.09e-01	NA	2.65e-07
3. B	Q9LX87	Putative F-box/kelch-repeat protein At3g46050	2.29e-03	NA	0.018
3. B	B2RXH4	BTB/POZ domain-containing protein 18	3.90e-03	NA	0.026
3. B	Q8NEA9	Germ cell-less protein-like 2	1.14e-05	NA	1.72e-05
3. B	Q9NUA8	Zinc finger and BTB domain-containing protein 40	6.84e-01	NA	6.20e-04
3. B	Q0V7S6	F-box/kelch-repeat protein OR23	1.44e-06	NA	2.40e-04
3. B	A5F7B3	N-acetylneuraminate epimerase	6.28e-14	NA	0.039
3. B	Q24174	Protein abrupt	3.67e-03	NA	9.15e-05
3. B	Q1LVW0	Ankyrin repeat and BTB/POZ domain-containing protein BTBD11-A	1.06e-02	NA	6.14e-07
3. B	O43791	Speckle-type POZ protein	4.55e-06	NA	1.03e-05
3. B	Q5VTJ3	Kelch domain-containing protein 7A	6.96e-05	NA	2.38e-07
3. B	Q92010	Zinc finger and BTB domain-containing protein 14	7.90e-01	NA	8.45e-09
3. B	Q9WTY8	Zinc finger and BTB domain-containing protein 10	4.56e-02	NA	3.34e-05
3. B	Q9CWH1	Zinc finger and BTB domain-containing protein 8A	1.50e-04	NA	2.26e-08
3. B	Q5TJE2	Zinc finger and BTB domain-containing protein 22	2.30e-04	NA	9.71e-07
3. B	Q86T24	Transcriptional regulator Kaiso	1.25e-04	NA	1.25e-04
3. B	Q5NVK7	Speckle-type POZ protein	2.08e-05	NA	1.03e-05
3. B	Q9DAK3	Rho-related BTB domain-containing protein 1	2.01e-04	NA	1.76e-04
3. B	Q8LAW2	F-box protein AFR	6.61e-07	NA	5.67e-06
3. B	O22286	BTB/POZ and MATH domain-containing protein 3	5.28e-05	NA	1.96e-07
3. B	Q9JKY3	Zinc finger and BTB domain-containing protein 18	6.82e-01	NA	2.31e-07
3. B	Q969K4	Ankyrin repeat and BTB/POZ domain-containing protein 1	5.83e-04	NA	4.74e-04
3. B	O76612	BTB and MATH domain-containing protein 47	3.77e-02	NA	0.040
3. B	Q8IN81	Sex determination protein fruitless	7.58e-02	NA	1.30e-04
3. B	Q86J11	Kelch repeat-containing protein DDB_G0274267	1.07e-04	NA	0.001
3. B	Q717B2	TD and POZ domain-containing protein 2	4.85e-06	NA	0.001
3. B	Q9SVA0	F-box/kelch-repeat protein At4g39580	5.07e-06	NA	8.28e-09
3. B	Q9CA63	F-box/kelch-repeat protein At1g74510	7.63e-06	NA	5.44e-09
3. B	Q5NBY9	POZ (BTB) and AT hook-containing zinc finger 1	NA	NA	1.10e-08
3. B	Q9BX70	BTB/POZ domain-containing protein 2	6.54e-06	NA	2.69e-11
3. B	Q96KE9	BTB/POZ domain-containing protein 6	4.60e-05	NA	1.41e-10
3. B	Q08605	Transcription factor GAGA	2.80e-03	NA	2.37e-04
3. B	Q61191	Host cell factor 1	1.37e-05	NA	5.85e-04
3. B	Q1L8W0	Zinc finger and BTB domain-containing protein 18	8.79e-01	NA	1.74e-07
3. B	O95365	Zinc finger and BTB domain-containing protein 7A	1.38e-02	NA	3.04e-13
3. B	Q810B6	Rabankyrin-5	3.14e-02	NA	0.001
3. B	B2RXF5	Zinc finger and BTB domain-containing protein 42	6.93e-01	NA	5.99e-07
3. B	Q5ZM39	B-cell lymphoma 6 protein homolog	7.28e-01	NA	7.37e-04
3. B	A6QPA3	BTB/POZ domain-containing protein 19	3.99e-08	NA	0.035
3. B	Q8CDC7	Zinc finger and BTB domain-containing protein 9	1.96e-04	NA	1.05e-06
3. B	Q7ZWZ4	Zinc finger and BTB domain-containing protein 18.2	4.86e-01	NA	5.14e-09
3. B	Q7TQG0	Zinc finger and BTB domain-containing protein 5	2.65e-03	NA	6.24e-11
3. B	O04316	Nitrile-specifier protein 4	9.75e-11	NA	4.20e-07
3. B	Q99LJ2	Ankyrin repeat and BTB/POZ domain-containing protein 1	4.28e-05	NA	0.004
3. B	Q6YCH1	TD and POZ domain-containing protein 5	4.42e-06	NA	0.002
3. B	Q96DT7	Zinc finger and BTB domain-containing protein 10	2.10e-02	NA	4.98e-06
3. B	O04615	BTB/POZ domain-containing protein At4g01160	1.10e-03	NA	6.76e-07
3. B	O82376	Putative F-box/kelch-repeat protein At2g29800	5.14e-06	NA	3.14e-04
3. B	Q05516	Zinc finger and BTB domain-containing protein 16	8.41e-01	NA	1.40e-06
3. B	Q9H5J0	Zinc finger and BTB domain-containing protein 3	2.30e-03	NA	4.01e-09
3. B	A0JMG1	Speckle-type POZ protein-like B	3.41e-05	NA	7.40e-06
3. B	P24278	Zinc finger and BTB domain-containing protein 25	4.56e-03	NA	4.38e-05
3. B	Q9R1Y5	Hypermethylated in cancer 1 protein	5.65e-01	NA	0.009
3. B	Q9C6Z0	F-box/kelch-repeat protein At1g30090	4.81e-07	NA	3.29e-10
3. B	Q8K3J5	Zinc finger protein 131	8.12e-01	NA	0.002
3. B	Q9SJ85	BTB/POZ domain-containing protein At2g04740	1.27e-03	NA	0.006
3. B	P34324	BTB and MATH domain-containing protein 15 (Fragment)	4.13e-04	NA	8.83e-13
3. B	Q9XWB9	BTB and MATH domain-containing protein 36	4.23e-05	NA	3.71e-05
3. B	Q9HCK0	Zinc finger and BTB domain-containing protein 26	3.92e-01	NA	2.20e-06
3. B	Q8N680	Zinc finger and BTB domain-containing protein 2	5.90e-01	NA	6.60e-05
3. B	Q6DDV0	Myoneurin	1.02e-01	NA	7.25e-08
3. B	Q5XIU1	Ankyrin repeat and BTB/POZ domain-containing protein 1	6.28e-04	NA	0.010
3. B	O80573	Putative F-box/kelch-repeat protein At2g44030	5.14e-04	NA	0.005
3. B	O82343	BTB/POZ domain-containing protein At2g46260	4.74e-04	NA	6.63e-06
3. B	P42282	Protein tramtrack, alpha isoform	8.04e-03	NA	0.002
3. B	Q9HBE1	POZ-, AT hook-, and zinc finger-containing protein 1	9.24e-01	NA	1.09e-08
3. B	Q9XHZ8	BTB/POZ domain-containing protein At1g21780	3.95e-06	NA	1.82e-05
3. B	Q8UVQ4	Transcriptional regulator Kaiso	1.40e-03	NA	0.039
3. B	A1L2U9	Zinc finger and BTB domain-containing protein 8A.1-B	6.53e-04	NA	1.18e-05
3. B	O93567	Zinc finger and BTB domain-containing protein 7A	1.43e-02	NA	2.15e-13
3. B	P58545	BTB/POZ domain-containing protein 3	1.18e-04	NA	2.57e-10
3. B	D4A8X0	Zinc finger and BTB domain-containing protein 4	8.95e-01	NA	0.005
3. B	Q9SVA3	F-box/kelch-repeat protein At4g39550	6.59e-06	NA	0.021
3. B	Q5TC79	Zinc finger and BTB domain-containing protein 37	4.04e-04	NA	3.43e-10
3. B	Q9VFP2	Protein roadkill	1.58e-04	NA	1.76e-05
3. B	Q9P2D0	Inhibitor of Bruton tyrosine kinase	1.18e-01	NA	0.002
3. B	Q680K8	BTB/POZ domain-containing protein At1g55760	4.90e-06	NA	1.94e-05
3. B	Q80T74	Kelch-like protein 29	0.00e+00	NA	1.78e-73
3. B	Q0D1P4	Kelch-like protein terF	4.25e-09	NA	9.59e-15