Summary

Q9P1V8

Homolog: Q95JY5.
Function: Sterile alpha motif domain-containing protein 15.

Statistics

Total GO Annotation: 238
Unique PROST Go: 127
Unique BLAST Go: 108

Total Homologs: 87
Unique PROST Homologs: 64
Unique BLAST Homologs: 19

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q95JY5 (Sterile alpha motif domain-containing protein 15) with a FATCAT P-Value: 2.44e-05 and RMSD of 17.11 angstrom. The sequence alignment identity is 90.2%.
Structural alignment shown in left. Query protein Q9P1V8 colored as red in alignment, homolog Q95JY5 colored as blue. Query protein Q9P1V8 is also shown in right top, homolog Q95JY5 showed in right bottom. They are colored based on secondary structures. 

  Q9P1V8 MAEVPEDYDSGPDEDGELEPERPELPGLHKLYENAEPDTMAKADSKLPAEIYQEPQPETEEEDFKEGEPDSAKNVQLKPGGTSQEGIAKESKRDVPSETE 100
  Q95JY5 MAEVPEDYDSGPDEDGEPESERPE---LHKSYENAERDTMAEADSKLPAEIYHEPQPETEEEDFREGEPKSAKNVQLKPGGTALEGIAKESKRDVPSETE 97

  Q9P1V8 PGIHQEVKSETSREMGEFFKDLEAPMDETHKESDLEPPEEAKPNVTEDVFLESAMETDPDPVPPTETMSEVSGATVRERNLELLEEETEPGVPEESLRVQ 200
  Q95JY5 PGIPQEVKSE--REMGEFFKDLEAPMDETH-ESDLEPPEEAKLNVTEDVFLESAMET--DPVPPTETMSEVSGATVRERNLELLEEGTELGVPEESLRVQ 192

  Q9P1V8 HEETGLEPPEQTKQDFPSEKLGESLEETDLQPPKMTKPETPEETQRESTEKKRTEPPEQARLEFLEKEPRKSSEEAGLEPPEETQPEVPEEMQRKATEEK 300
  Q95JY5 HEETGVEPPEQTQLDFPSEKPGESLEETDLQPPKMTKPDIPEETQRESTEKKRTEPPEQARPEFPEKEPRKSSEEAGLEPPEETQPEVPGEMQRKATEEK 292

  Q9P1V8 GTELPERTKPDFPDHKPRKSTDENVPEPLEEIKLEFPEEESRKTNEETILEQSEMMKPESPEEIRKSNEKKNPQPPEETGPVLPQEINPQVEEKTQTKPT 400
  Q95JY5 GTELPERTKPDLPDHKSRKSTDENVPEPLEEIKLEFPEEESRKPNEETILEQSEMMKPESPEEIRKSNEEKNPQPPEETGLVLPQEINPRVEEKTQTKPT 392

  Q9P1V8 -EKILELPDETKPRETHVEFSKEDRPEPIKSKYSVGNDELEHREPKRGKLSLSDKFRKEYYALGSLRESEESIGTHYEFLQPLQKLLNVSEECSYSDPSE 499
  Q95JY5 EEKNLELPDETKPRETHVEFPKEDRPEPIKSKYSVGKNELEFREPKKGKWSLSDEFKKEYYALGSIRESEESIGTHYEFSQPLQKSFDVSEVCSYLDPSE 492

  Q9P1V8 SQTELSEFVHEKEVVDLSQELKERVSEDDETQPEKGTELQFEHLNWDPEEVAEWISQLGFPQYKECFITNFISGRKLIHVNCSNLPQMGITNFEDMKAIS 599
  Q95JY5 SLTELNEFVHEKEVVDLSQDLKELVSEDDETQSKQGTELQFEHLNWDPEKVAEWISQLGFPQYKGCFITNFISGRKLIHVNCSNLPQMGITNFEDMKAIS 592

  Q9P1V8 RHTQELLEIEEPLFKRSISLPYRDIIGLYLEQKGHTGIKSDSLTLSEFVKAAGLQDYAPEITAPEENEELPCTEP 674
  Q95JY5 RHTRELLEIEEPLFKRSISLPHRDIIGLYLEQKGHTGIKSDALTLSEFVKAAGLQDYAPEITAPEENEELPCTEP 667

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0008157 protein phosphatase 1 binding
1. PB GO:0030426 growth cone
1. PB GO:0031175 neuron projection development
2. P GO:0030173 integral component of Golgi membrane
2. P GO:0035128 post-embryonic forelimb morphogenesis
2. P GO:0050680 negative regulation of epithelial cell proliferation
2. P GO:0010389 regulation of G2/M transition of mitotic cell cycle
2. P GO:0005768 endosome
2. P GO:0043313 regulation of neutrophil degranulation
2. P GO:0034765 regulation of ion transmembrane transport
2. P GO:0032039 integrator complex
2. P GO:0032922 circadian regulation of gene expression
2. P GO:0051401 CH domain binding
2. P GO:0010880 regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum
2. P GO:0060296 regulation of cilium beat frequency involved in ciliary motility
2. P GO:0034472 snRNA 3'-end processing
2. P GO:1901582 positive regulation of telomeric RNA transcription from RNA pol II promoter
2. P GO:0008327 methyl-CpG binding
2. P GO:0006821 chloride transport
2. P GO:0000079 regulation of cyclin-dependent protein serine/threonine kinase activity
2. P GO:0005244 voltage-gated ion channel activity
2. P GO:0030669 clathrin-coated endocytic vesicle membrane
2. P GO:0032206 positive regulation of telomere maintenance
2. P GO:0097499 protein localization to non-motile cilium
2. P GO:0019042 viral latency
2. P GO:1901899 positive regulation of relaxation of cardiac muscle
2. P GO:0000793 condensed chromosome
2. P GO:0051321 meiotic cell cycle
2. P GO:0031430 M band
2. P GO:0070198 protein localization to chromosome, telomeric region
2. P GO:0017020 myosin phosphatase regulator activity
2. P GO:0010571 positive regulation of nuclear cell cycle DNA replication
2. P GO:0090543 Flemming body
2. P GO:0061484 hematopoietic stem cell homeostasis
2. P GO:0005788 endoplasmic reticulum lumen
2. P GO:0005227 calcium activated cation channel activity
2. P GO:0014823 response to activity
2. P GO:0050896 response to stimulus
2. P GO:0010168 ER body
2. P GO:0001533 cornified envelope
2. P GO:0005815 microtubule organizing center
2. P GO:1900112 regulation of histone H3-K9 trimethylation
2. P GO:0060009 Sertoli cell development
2. P GO:0010460 positive regulation of heart rate
2. P GO:0051315 attachment of mitotic spindle microtubules to kinetochore
2. P GO:0031528 microvillus membrane
2. P GO:0010466 negative regulation of peptidase activity
2. P GO:0019901 protein kinase binding
2. P GO:0030036 actin cytoskeleton organization
2. P GO:0015616 DNA translocase activity
2. P GO:0007283 spermatogenesis
2. P GO:0016605 PML body
2. P GO:0039504 suppression by virus of host adaptive immune response
2. P GO:0072659 protein localization to plasma membrane
2. P GO:0010881 regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion
2. P GO:0039503 suppression by virus of host innate immune response
2. P GO:0039626 viral intermediate capsid
2. P GO:0045907 positive regulation of vasoconstriction
2. P GO:0097718 disordered domain specific binding
2. P GO:0001520 outer dense fiber
2. P GO:0072520 seminiferous tubule development
2. P GO:2001235 positive regulation of apoptotic signaling pathway
2. P GO:0005254 chloride channel activity
2. P GO:0030330 DNA damage response, signal transduction by p53 class mediator
2. P GO:0032184 SUMO polymer binding
2. P GO:1900181 negative regulation of protein localization to nucleus
2. P GO:0001540 amyloid-beta binding
2. P GO:0045823 positive regulation of heart contraction
2. P GO:0034707 chloride channel complex
2. P GO:0080119 ER body organization
2. P GO:0051219 phosphoprotein binding
2. P GO:0043292 contractile fiber
2. P GO:1903169 regulation of calcium ion transmembrane transport
2. P GO:0033018 sarcoplasmic reticulum lumen
2. P GO:0007229 integrin-mediated signaling pathway
2. P GO:1990172 G protein-coupled receptor catabolic process
2. P GO:0034501 protein localization to kinetochore
2. P GO:0045892 negative regulation of transcription, DNA-templated
2. P GO:0031674 I band
2. P GO:0005819 spindle
2. P GO:0003713 transcription coactivator activity
2. P GO:0031134 sister chromatid biorientation
2. P GO:0005523 tropomyosin binding
2. P GO:0043621 protein self-association
2. P GO:0048012 hepatocyte growth factor receptor signaling pathway
2. P GO:0000779 condensed chromosome, centromeric region
2. P GO:0050852 T cell receptor signaling pathway
2. P GO:0099115 chromosome, subtelomeric region
2. P GO:0090190 positive regulation of branching involved in ureteric bud morphogenesis
2. P GO:0000212 meiotic spindle organization
2. P GO:0005634 nucleus
2. P GO:0004705 JUN kinase activity
2. P GO:0030414 peptidase inhibitor activity
2. P GO:0016604 nuclear body
2. P GO:1902465 negative regulation of histone H3-K27 trimethylation
2. P GO:0098671 adhesion receptor-mediated virion attachment to host cell
2. P GO:1901844 regulation of cell communication by electrical coupling involved in cardiac conduction
2. P GO:0030140 trans-Golgi network transport vesicle
2. P GO:0048644 muscle organ morphogenesis
2. P GO:0018149 peptide cross-linking
2. P GO:0070087 chromo shadow domain binding
2. P GO:1904908 negative regulation of maintenance of mitotic sister chromatid cohesion, telomeric
2. P GO:1901581 negative regulation of telomeric RNA transcription from RNA pol II promoter
2. P GO:0039588 suppression by virus of host antigen processing and presentation
2. P GO:0031749 D2 dopamine receptor binding
2. P GO:0048599 oocyte development
2. P GO:0006816 calcium ion transport
2. P GO:0033135 regulation of peptidyl-serine phosphorylation
2. P GO:0007608 sensory perception of smell
2. P GO:0030317 flagellated sperm motility
2. P GO:0031750 D3 dopamine receptor binding
2. P GO:0042025 host cell nucleus
2. P GO:0070192 chromosome organization involved in meiotic cell cycle
2. P GO:0001664 G protein-coupled receptor binding
2. P GO:0032991 protein-containing complex
2. P GO:0043406 positive regulation of MAP kinase activity
2. P GO:0072711 cellular response to hydroxyurea
2. P GO:0009640 photomorphogenesis
2. P GO:0099503 secretory vesicle
2. P GO:0010224 response to UV-B
2. P GO:0036128 CatSper complex
2. P GO:0060314 regulation of ryanodine-sensitive calcium-release channel activity
2. P GO:0014850 response to muscle activity
2. P GO:0000776 kinetochore
2. P GO:0035372 protein localization to microtubule
2. P GO:0031751 D4 dopamine receptor binding
2. P GO:0042310 vasoconstriction
2. P GO:0031941 filamentous actin
2. P GO:0030017 sarcomere
2. P GO:0042752 regulation of circadian rhythm
3. B GO:0035591 signaling adaptor activity
3. B GO:0007015 actin filament organization
3. B GO:0003951 NAD+ kinase activity
3. B GO:2000359 regulation of binding of sperm to zona pellucida
3. B GO:0060291 long-term synaptic potentiation
3. B GO:0071625 vocalization behavior
3. B GO:0097237 cellular response to toxic substance
3. B GO:0051020 GTPase binding
3. B GO:0030160 synaptic receptor adaptor activity
3. B GO:0060292 long-term synaptic depression
3. B GO:0015629 actin cytoskeleton
3. B GO:0046339 diacylglycerol metabolic process
3. B GO:0043197 dendritic spine
3. B GO:0051285 cell cortex of cell tip
3. B GO:0048786 presynaptic active zone
3. B GO:1900454 positive regulation of long-term synaptic depression
3. B GO:0032093 SAM domain binding
3. B GO:0043086 negative regulation of catalytic activity
3. B GO:0007205 protein kinase C-activating G protein-coupled receptor signaling pathway
3. B GO:0098974 postsynaptic actin cytoskeleton organization
3. B GO:0008022 protein C-terminus binding
3. B GO:0008328 ionotropic glutamate receptor complex
3. B GO:0040017 positive regulation of locomotion
3. B GO:0090038 negative regulation of protein kinase C signaling
3. B GO:0099562 maintenance of postsynaptic density structure
3. B GO:0034128 negative regulation of MyD88-independent toll-like receptor signaling pathway
3. B GO:0019992 diacylglycerol binding
3. B GO:0035255 ionotropic glutamate receptor binding
3. B GO:0007622 rhythmic behavior
3. B GO:0044326 dendritic spine neck
3. B GO:0010514 induction of conjugation with cellular fusion
3. B GO:0044325 transmembrane transporter binding
3. B GO:0030425 dendrite
3. B GO:0006897 endocytosis
3. B GO:0030168 platelet activation
3. B GO:0050807 regulation of synapse organization
3. B GO:0051286 cell tip
3. B GO:0098919 structural constituent of postsynaptic density
3. B GO:0031410 cytoplasmic vesicle
3. B GO:0003953 NAD+ nucleosidase activity
3. B GO:0001881 receptor recycling
3. B GO:0005905 clathrin-coated pit
3. B GO:0045742 positive regulation of epidermal growth factor receptor signaling pathway
3. B GO:1901214 regulation of neuron death
3. B GO:0050840 extracellular matrix binding
3. B GO:1900272 negative regulation of long-term synaptic potentiation
3. B GO:0019677 NAD catabolic process
3. B GO:0060999 positive regulation of dendritic spine development
3. B GO:0007613 memory
3. B GO:0045860 positive regulation of protein kinase activity
3. B GO:1904049 negative regulation of spontaneous neurotransmitter secretion
3. B GO:0051968 positive regulation of synaptic transmission, glutamatergic
3. B GO:0051489 regulation of filopodium assembly
3. B GO:0098978 glutamatergic synapse
3. B GO:0031594 neuromuscular junction
3. B GO:0051015 actin filament binding
3. B GO:0046473 phosphatidic acid metabolic process
3. B GO:0007416 synapse assembly
3. B GO:0000935 division septum
3. B GO:0060170 ciliary membrane
3. B GO:0010033 response to organic substance
3. B GO:0017124 SH3 domain binding
3. B GO:0030175 filopodium
3. B GO:0007612 learning
3. B GO:0051963 regulation of synapse assembly
3. B GO:0043005 neuron projection
3. B GO:0098871 postsynaptic actin cytoskeleton
3. B GO:0001750 photoreceptor outer segment
3. B GO:0016324 apical plasma membrane
3. B GO:0060079 excitatory postsynaptic potential
3. B GO:0004709 MAP kinase kinase kinase activity
3. B GO:0031097 medial cortex
3. B GO:0031526 brush border membrane
3. B GO:0030421 defecation
3. B GO:0019722 calcium-mediated signaling
3. B GO:0035176 social behavior
3. B GO:0030833 regulation of actin filament polymerization
3. B GO:0004143 diacylglycerol kinase activity
3. B GO:0006654 phosphatidic acid biosynthetic process
3. B GO:0032279 asymmetric synapse
3. B GO:0000003 reproduction
3. B GO:0019932 second-messenger-mediated signaling
3. B GO:0030534 adult behavior
3. B GO:0005883 neurofilament
3. B GO:0043025 neuronal cell body
3. B GO:0032153 cell division site
3. B GO:0008284 positive regulation of cell population proliferation
3. B GO:0019900 kinase binding
3. B GO:0031143 pseudopodium
3. B GO:1990761 growth cone lamellipodium
3. B GO:0014069 postsynaptic density
3. B GO:2000370 positive regulation of clathrin-dependent endocytosis
3. B GO:0043051 regulation of pharyngeal pumping
3. B GO:0007528 neuromuscular junction development
3. B GO:0061001 regulation of dendritic spine morphogenesis
3. B GO:0030864 cortical actin cytoskeleton
3. B GO:0035331 negative regulation of hippo signaling
3. B GO:0035556 intracellular signal transduction
3. B GO:0007568 aging
3. B GO:0098686 hippocampal mossy fiber to CA3 synapse
3. B GO:0001917 photoreceptor inner segment
3. B GO:0046834 lipid phosphorylation
3. B GO:0042802 identical protein binding
3. B GO:0010976 positive regulation of neuron projection development
3. B GO:0035640 exploration behavior
3. B GO:0051497 negative regulation of stress fiber assembly
3. B GO:0071507 pheromone response MAPK cascade
3. B GO:0051823 regulation of synapse structural plasticity

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q8K070 Sterile alpha motif domain-containing protein 14 1.54e-02 3.38e-02 7.66e-04
1. PB Q9P1V8 Sterile alpha motif domain-containing protein 15 0 9.52e-176 0.0
1. PB Q95JY5 Sterile alpha motif domain-containing protein 15 2.44e-05 3.42e-104 0.0
1. PB F6XZJ7 Sterile alpha motif domain-containing protein 15 1.22e-02 3.74e-31 2.81e-96
2. P Q5JRC9 Protein FAM47A 1.19e-01 6.46e-08 NA
2. P Q5R7U0 G-protein coupled receptor-associated sorting protein 2 1.40e-02 1.28e-02 NA
2. P Q8N3D4 EH domain-binding protein 1-like protein 1 2.75e-01 9.91e-03 NA
2. P Q64909 Protein VP6 NA 9.97e-04 NA
2. P E9Q6E9 SUMO-interacting motif-containing protein 1 7.91e-01 1.28e-02 NA
2. P O75335 Liprin-alpha-4 4.45e-01 3.08e-02 NA
2. P Q2KI51 Protein phosphatase 1 regulatory subunit 15A 5.09e-02 1.28e-03 NA
2. P Q99MS7 EH domain-binding protein 1-like protein 1 5.88e-01 3.74e-02 NA
2. P Q99LM3 Smoothelin-like protein 1 1.29e-01 5.62e-04 NA
2. P Q7Z2K8 G protein-regulated inducer of neurite outgrowth 1 5.22e-02 1.76e-03 NA
2. P Q13342 Nuclear body protein SP140 2.79e-01 4.50e-02 NA
2. P Q9LTJ8 Methyl-CpG-binding domain-containing protein 13 1.36e-01 1.72e-05 NA
2. P Q4ZJY7 Mucin-like protein Glc1.8b NA 1.55e-02 NA
2. P Q659K0 G2/mitotic-specific cyclin-B3 1.95e-01 8.60e-04 NA
2. P Q9ES73 Melanoma-associated antigen D1 4.12e-02 1.78e-04 NA
2. P Q149B8 PGC-1 and ERR-induced regulator in muscle protein 1 3.92e-02 1.28e-06 NA
2. P Q8V9R9 Uncharacterized protein B407L NA 2.40e-02 NA
2. P Q8N307 Mucin-20 5.65e-01 3.90e-03 NA
2. P Q8NEC5 Cation channel sperm-associated protein 1 3.05e-02 2.14e-02 NA
2. P J3KML8 Golgi-associated olfactory signaling regulator 2.45e-01 5.66e-03 NA
2. P A5D7L8 PGC-1 and ERR-induced regulator in muscle protein 1 7.31e-02 6.19e-08 NA
2. P Q9QYH6 Melanoma-associated antigen D1 2.66e-01 1.68e-04 NA
2. P Q6BCL1 PML-RARA-regulated adapter molecule 1 1.29e-02 1.33e-02 NA
2. P Q62314 Trans-Golgi network integral membrane protein 2 3.11e-02 3.52e-02 NA
2. P Q5U4C1 G-protein coupled receptor-associated sorting protein 1 2.24e-01 4.15e-02 NA
2. P Q6BSL1 RNA-binding protein VTS1 2.74e-01 7.66e-03 NA
2. P F4ICX9 TSK-associating protein 1 9.26e-01 1.76e-05 NA
2. P A8MU46 Smoothelin-like protein 1 1.81e-01 1.50e-08 NA
2. P A6NJ88 Putative SAGE1-like protein 9.55e-01 1.77e-02 NA
2. P Q8NA70 Protein FAM47B 1.95e-01 7.53e-06 NA
2. P Q96QH2 PML-RARA-regulated adapter molecule 1 7.62e-02 6.91e-04 NA
2. P O43493 Trans-Golgi network integral membrane protein 2 6.73e-02 1.33e-04 NA
2. P P0CV57 Secreted RxLR effector protein 138 2.58e-01 8.13e-06 NA
2. P P48998 Involucrin 3.02e-02 9.64e-05 NA
2. P I3L273 Golgi-associated olfactory signaling regulator 7.05e-02 5.85e-03 NA
2. P Q96NY7 Chloride intracellular channel protein 6 2.07e-01 3.41e-05 NA
2. P Q5SV97 PGC-1 and ERR-induced regulator in muscle protein 1 3.83e-03 3.78e-07 NA
2. P Q9D5N8 Spermidine/spermine N(1)-acetyltransferase-like protein 1 3.31e-02 7.91e-03 NA
2. P F1LWT0 SUMO-interacting motif-containing protein 1 7.25e-01 2.05e-02 NA
2. P B1B0V2 EZH inhibitory protein 1.35e-01 2.99e-04 NA
2. P O46383 Sodium/potassium/calcium exchanger 1 (Fragment) 9.11e-01 2.12e-02 NA
2. P P23327 Sarcoplasmic reticulum histidine-rich calcium-binding protein 6.09e-02 5.12e-04 NA
2. P Q25662 Repetitive organellar protein NA 4.83e-02 NA
2. P Q5ND19 Uncharacterized protein C17orf47 homolog 9.82e-02 4.06e-02 NA
2. P P70486 Transcriptional regulator ATRX (Fragment) 9.77e-02 3.21e-04 NA
2. P Q6A058 Armadillo repeat-containing X-linked protein 2 1.93e-01 1.35e-04 NA
2. P Q8WWL7 G2/mitotic-specific cyclin-B3 8.10e-02 1.63e-05 NA
2. P Q9LSB4 TSA1-like protein 8.20e-01 2.02e-05 NA
2. P Q9N2G5 Chloride intracellular channel protein 6 1.30e-01 4.86e-03 NA
2. P Q9NXZ1 Sarcoma antigen 1 9.10e-01 5.26e-06 NA
2. P Q4ZJZ0 Mucin-like protein Glc1.8a NA 3.94e-02 NA
2. P Q01042 Transcriptional regulator ICP22 homolog NA 2.27e-03 NA
2. P Q03553 Fiber protein NA 7.42e-03 NA
2. P Q811Q2 Chloride intracellular channel protein 6 7.42e-02 5.98e-03 NA
2. P Q96M34 Testis-specific expressed protein 55 4.53e-02 3.99e-09 NA
2. P P03211 Epstein-Barr nuclear antigen 1 NA 4.68e-02 NA
2. P Q96D09 G-protein coupled receptor-associated sorting protein 2 8.80e-02 1.07e-02 NA
2. P A0A1B0GTH6 Casein kinase II subunit alpha'-interacting protein 6.62e-02 4.05e-05 NA
2. P Q3UNH4 G protein-regulated inducer of neurite outgrowth 1 2.80e-01 3.17e-03 NA
2. P Q8K327 Chromosome alignment-maintaining phosphoprotein 1 2.15e-02 2.38e-02 NA
2. P Q96JM3 Chromosome alignment-maintaining phosphoprotein 1 7.87e-02 7.07e-04 NA
2. P Q6P902 Thioredoxin domain-containing protein 2 5.65e-02 3.26e-06 NA
2. P Q9Y5V3 Melanoma-associated antigen D1 1.88e-02 3.45e-02 NA
2. P P16230 Sarcoplasmic reticulum histidine-rich calcium-binding protein 5.20e-02 2.03e-03 NA
3. B Q9ULJ8 Neurabin-1 6.77e-01 NA 0.015
3. B E9PUQ8 Diacylglycerol kinase delta 7.04e-01 NA 0.001
3. B Q9UPX8 SH3 and multiple ankyrin repeat domains protein 2 3.51e-01 NA 0.018
3. B Q52KW0 SH3 and multiple ankyrin repeat domains protein 2 2.16e-01 NA 0.038
3. B O35867 Neurabin-1 8.07e-01 NA 0.002
3. B B7WN72 Protein shank 3.06e-01 NA 0.011
3. B Q86XP1 Diacylglycerol kinase eta 9.08e-01 NA 0.005
3. B Q16760 Diacylglycerol kinase delta 6.08e-01 NA 7.79e-04
3. B P36622 Sexual differentiation protein ste4 9.13e-02 NA 0.009
3. B O88799 Zonadhesin NA NA 0.014
3. B D3YXJ0 Diacylglycerol kinase eta 9.00e-01 NA 1.39e-04
3. B Q9QX74 SH3 and multiple ankyrin repeat domains protein 2 3.19e-01 NA 0.029
3. B Q6IDD9 NAD(+) hydrolase sarm1 8.31e-01 NA 0.046
3. B Q5BJU3 Sterile alpha motif domain-containing protein 14 2.27e-02 NA 6.84e-04
3. B Q8IZD0 Sterile alpha motif domain-containing protein 14 6.05e-02 NA 0.002
3. B Q80Z38 SH3 and multiple ankyrin repeat domains protein 2 1.64e-01 NA 0.030
3. B Q94071 Liprin-beta homolog 3.13e-01 NA 5.26e-04
3. B P28829 Protein kinase byr2 6.53e-01 NA 0.033
3. B O74653 Protein pob1 4.96e-02 NA 0.018