Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
P61565
(Endogenous retrovirus group K member 21 Env polyprotein) with a FATCAT P-Value: 0.0 and RMSD of 3.14 angstrom. The sequence alignment identity is 97.7%.
Structural alignment shown in left. Query protein Q9UKH3 colored as red in alignment, homolog P61565 colored as blue.
Query protein Q9UKH3 is also shown in right top, homolog P61565 showed in right bottom. They are colored based on secondary structures.
Q9UKH3 MNPSEMQRKAPPRRRRHRNRAPLTHKMNKMVTSEEQMKLPSTKKAEPPTWAQLKKLTQLATKYLENTKVTQTPESMLLAALMIVSMVVSLPMPAGAAAAN 100 P61565 MHPSEMQRKAPPRRRRHRNRAPLTHKMNKMVTS-EQMKLPSTKKAEPPTWAQLKKLTQLATKYLENTKVTQTPESMLLAALMIVSMVVSLPMPAGAAAAN 99 Q9UKH3 YTNWAYVPFPPLIRAVTWMDNPIEVYVNDSVWVPGPIDDRCPAKPEEEGMMINISIGYRY-PICLGRAPGCLMPAVQNWLVEVPIVSPICRFTYHMVSGM 199 P61565 YTNWAYVPFPPLIRAVTWMDNPIEVYVNDSVWVHGPIDDRCPAKPEEEGMMINISIGYHYPPICLGRAPGCLMPAVQNWLVEVPTVSPISRFTYNMVSGM 199 Q9UKH3 SLRPRVNYLQDFSYQRSLKFRPKGKPCPKEIPKESKNTEVLVWEECVANSAVILQNNEFGTIIDWTPQGQFYHNCSGQTQSCPSAQVSPAVDSDLTESLD 299 P61565 SLRPRVNYLQDFSYQRSLKFRPKGKPCPKEIPKESKNTEVLVWEECVANSVVILQNNEFGTIIDWAPRGQFYHNCSGQTQSCPSAQVSPAVDSDLTESLD 299 Q9UKH3 KHKHKKLQSFYPWEWGEKGISTPRPKIISPVSGPEHPELWRLTVASHHIRIWSGNQTLETRDRKPFYTVDLNSSLTLPLQSCVKPPYMLVVGNIVIKPDS 399 P61565 KHKHKKLQSFYPWEWGEKGISTPRPKIISPVSGPEHPELWRLTVASHHIRIWSGNQTLETRDRKPFYTVDLNSSLTVPLQSCVKPPYMLVVGNIVIKPDS 399 Q9UKH3 QTITCENCRLLTCIDSTFNWQHRILLVRAREGVWIPVSMDRPWEASPSIHILTEVLKGVLNRSKRFIFTLIAVIMGLIAVTATAAVAGVALHSSVQSVNF 499 P61565 QTITCENCRLLTCIDSTFNWQHRILLVRAREGVWIPVSMDRPWEASPSIHILTEVLKGVLNRSKRFIFTLIAVIMGLIAVTAMAAVAGVALHSFVQSVNF 499 Q9UKH3 VNDGQKNSTRLWNSQSSIDQKLANQINDLRQTVIWMGDRLMSLEHRFQLQCDWNTSDFCITPQIYNESEHHWDMVRRHLQGREDNLTLDISKLKEQIFEA 599 P61565 VNDWQKNSTRLWNSQSSIDQKLANQINDLRQTVIWMGDRLMSLEHRFQLQCDWNTSDFCITPQIYNESEHHWDMVRRHLQGREDNLTLDISKLKEQIFEA 599 Q9UKH3 SKAHLNLVPGTEAIAGVADGLANLNPVTWVKTIGSTTIINLILILVCLFCLLLVCRCTQQLRRDSDHRERAMMTMAVLSKRKGGNVGKSKRDQIVTVSV 698 P61565 SKAHLNLVPGTEAIAGVADGLANLNPVTWVKTIGSTTIINLILILVCLFCLLLVCRCTQQLRRDSDHRERAMMTMVVLSKRKGGNVGKSKRDQIVTVSV 698
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source | GO | Description |
---|---|---|
1. PB | GO:0005198 | structural molecule activity |
1. PB | GO:0019064 | fusion of virus membrane with host plasma membrane |
1. PB | GO:0005886 | plasma membrane |
1. PB | GO:0019031 | viral envelope |
1. PB | GO:0019062 | virion attachment to host cell |
1. PB | GO:0016021 | integral component of membrane |
1. PB | GO:0098670 | entry receptor-mediated virion attachment to host cell |
1. PB | GO:0055036 | virion membrane |
1. PB | GO:0020002 | host cell plasma membrane |
2. P | GO:0039663 | membrane fusion involved in viral entry into host cell |
2. P | GO:0046718 | viral entry into host cell |
2. P | GO:1903911 | positive regulation of receptor clustering |
2. P | GO:0044175 | host cell endosome membrane |
2. P | GO:0046813 | receptor-mediated virion attachment to host cell |
2. P | GO:0075509 | endocytosis involved in viral entry into host cell |
2. P | GO:0039588 | suppression by virus of host antigen processing and presentation |
2. P | GO:0039587 | suppression by virus of host tetherin activity |
2. P | GO:0044167 | host cell endoplasmic reticulum membrane |
2. P | GO:0046789 | host cell surface receptor binding |
2. P | GO:0044538 | host cell periphery |
2. P | GO:0039504 | suppression by virus of host adaptive immune response |
2. P | GO:0019048 | modulation by virus of host process |
2. P | GO:0006949 | syncytium formation |
2. P | GO:0106330 | sialate 9-O-acetylesterase activity |
2. P | GO:0039654 | fusion of virus membrane with host endosome membrane |
2. P | GO:0000768 | syncytium formation by plasma membrane fusion |
2. P | GO:0030666 | endocytic vesicle membrane |
2. P | GO:0039502 | suppression by virus of host type I interferon-mediated signaling pathway |
2. P | GO:0106331 | sialate 4-O-acetylesterase activity |
2. P | GO:0044178 | host cell Golgi membrane |
2. P | GO:0075512 | clathrin-dependent endocytosis of virus by host cell |
2. P | GO:0033644 | host cell membrane |
2. P | GO:0007520 | myoblast fusion |
2. P | GO:0046872 | metal ion binding |
2. P | GO:1903908 | positive regulation of plasma membrane raft polarization |
2. P | GO:0090527 | actin filament reorganization |
2. P | GO:0005576 | extracellular region |
2. P | GO:0019082 | viral protein processing |
2. P | GO:0030683 | mitigation of host immune response by virus |
2. P | GO:1903905 | positive regulation of establishment of T cell polarity |
2. P | GO:0044423 | virion component |
2. P | GO:0046761 | viral budding from plasma membrane |
2. P | GO:0019065 | receptor-mediated endocytosis of virus by host cell |
2. P | GO:0044173 | host cell endoplasmic reticulum-Golgi intermediate compartment membrane |
3. B | GO:0003723 | RNA binding |
3. B | GO:0016032 | viral process |
3. B | GO:0004523 | RNA-DNA hybrid ribonuclease activity |
3. B | GO:0006406 | mRNA export from nucleus |
3. B | GO:0003964 | RNA-directed DNA polymerase activity |
3. B | GO:0051028 | mRNA transport |
3. B | GO:0035613 | RNA stem-loop binding |
3. B | GO:0002218 | activation of innate immune response |
3. B | GO:0035458 | cellular response to interferon-beta |
3. B | GO:0005730 | nucleolus |
3. B | GO:0006310 | DNA recombination |
3. B | GO:0015074 | DNA integration |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
---|---|---|---|---|---|
1. PB | O71037 | Endogenous retrovirus group K member 19 Env polyprotein | 0.00e+00 | 9.93e-109 | 0.0 |
1. PB | Q85646 | Envelope glycoprotein gp70 | NA | 7.46e-50 | 1.12e-32 |
1. PB | Q902F8 | Endogenous retrovirus group K member 8 Env polyprotein | 0.00e+00 | 7.97e-122 | 0.0 |
1. PB | P03374 | Envelope glycoprotein gp70 | NA | 9.01e-53 | 1.59e-33 |
1. PB | P61566 | Endogenous retrovirus group K member 24 Env polyprotein | 6.87e-11 | 4.57e-22 | 0.0 |
1. PB | Q69384 | Endogenous retrovirus group K member 6 Env polyprotein | 0.00e+00 | 1.16e-121 | 0.0 |
1. PB | P61565 | Endogenous retrovirus group K member 21 Env polyprotein | 0.00e+00 | 8.08e-105 | 0.0 |
1. PB | Q902F9 | Endogenous retrovirus group K member 113 Env polyprotein | 0.00e+00 | 3.31e-109 | 0.0 |
1. PB | P31621 | Envelope glycoprotein | NA | 1.47e-44 | 2.40e-37 |
1. PB | P10259 | Envelope glycoprotein gp70 | NA | 4.14e-52 | 1.05e-33 |
1. PB | Q9NX77 | Endogenous retrovirus group K member 13-1 Env polyprotein | 4.15e-08 | 1.67e-13 | 1.79e-152 |
1. PB | Q9UKH3 | Endogenous retrovirus group K member 9 Env polyprotein | 0 | 1.88e-148 | 0.0 |
1. PB | O42043 | Endogenous retrovirus group K member 18 Env polyprotein | 2.11e-15 | 2.26e-27 | 0.0 |
1. PB | P61567 | Endogenous retrovirus group K member 7 Env polyprotein | 0.00e+00 | 9.33e-22 | 0.0 |
1. PB | P61570 | Endogenous retrovirus group K member 25 Env polyprotein | 0.00e+00 | 1.43e-58 | 0.0 |
2. P | P16060 | Hemagglutinin | NA | 7.41e-08 | NA |
2. P | P26094 | Hemagglutinin | NA | 4.29e-09 | NA |
2. P | P18094 | Envelope glycoprotein gp160 | NA | 1.68e-06 | NA |
2. P | P12487 | Envelope glycoprotein gp160 | NA | 7.63e-06 | NA |
2. P | P26139 | Hemagglutinin | NA | 7.03e-06 | NA |
2. P | P06752 | Envelope glycoprotein | NA | 1.31e-32 | NA |
2. P | Q03817 | Envelope glycoprotein gp62 | NA | 1.32e-24 | NA |
2. P | Q3LZX1 | Spike glycoprotein | NA | 1.59e-04 | NA |
2. P | Q67143 | Hemagglutinin | NA | 9.04e-05 | NA |
2. P | Q89669 | Glycoprotein | NA | 4.26e-03 | NA |
2. P | P03439 | Hemagglutinin | NA | 1.70e-05 | NA |
2. P | P87691 | Hemagglutinin-esterase-fusion glycoprotein | NA | 1.05e-10 | NA |
2. P | P26140 | Hemagglutinin | NA | 8.65e-05 | NA |
2. P | P17002 | Hemagglutinin | NA | 2.09e-06 | NA |
2. P | Q02837 | Envelope glycoprotein gp160 | NA | 9.51e-07 | NA |
2. P | P07966 | Hemagglutinin-esterase-fusion glycoprotein (Fragment) | NA | 2.25e-06 | NA |
2. P | P19694 | Hemagglutinin | NA | 9.20e-06 | NA |
2. P | P14075 | Envelope glycoprotein gp62 | NA | 3.28e-25 | NA |
2. P | P03443 | Hemagglutinin | NA | 1.06e-06 | NA |
2. P | Q9WCD8 | Hemagglutinin | NA | 7.66e-05 | NA |
2. P | P26095 | Hemagglutinin | NA | 1.69e-11 | NA |
2. P | Q3I5J5 | Spike glycoprotein | NA | 3.46e-04 | NA |
2. P | P03397 | Envelope glycoprotein gp95 | NA | 1.60e-25 | NA |
2. P | Q80A22 | Hemagglutinin (Fragment) | NA | 2.76e-06 | NA |
2. P | P18551 | Envelope glycoprotein B | NA | 5.36e-06 | NA |
2. P | Q2F7J1 | Envelope glycoprotein | NA | 1.18e-29 | NA |
2. P | Q9WC69 | Envelope glycoprotein gp160 | NA | 1.97e-04 | NA |
2. P | Q9WCE8 | Hemagglutinin | NA | 2.63e-07 | NA |
2. P | P16994 | Hemagglutinin | NA | 6.75e-07 | NA |
2. P | P07970 | Hemagglutinin-esterase-fusion glycoprotein (Fragment) | NA | 1.86e-12 | NA |
2. P | P35954 | Envelope glycoprotein gp160 | NA | 1.63e-16 | NA |
2. P | P18875 | Hemagglutinin | NA | 1.35e-05 | NA |
2. P | Q82559 | Hemagglutinin | NA | 1.53e-05 | NA |
2. P | P21436 | Envelope glycoprotein | NA | 5.55e-30 | NA |
2. P | P16997 | Hemagglutinin | NA | 3.53e-05 | NA |
2. P | P31794 | Envelope glycoprotein | NA | 5.96e-27 | NA |
2. P | P05877 | Envelope glycoprotein gp160 | NA | 3.00e-06 | NA |
2. P | P22427 | Envelope glycoprotein | NA | 6.19e-05 | NA |
2. P | P61562 | Syncytin-1 | 2.20e-01 | 2.92e-12 | NA |
2. P | P61552 | ERV-BabFcenv provirus ancestral Env polyprotein | 1.51e-01 | 2.07e-24 | NA |
2. P | P11306 | Envelope glycoprotein | NA | 2.07e-05 | NA |
2. P | P24105 | Envelope glycoprotein gp160 | NA | 2.14e-05 | NA |
2. P | Q9QJT6 | Glycoprotein | NA | 1.97e-02 | NA |
2. P | Q9UQF0 | Syncytin-1 | 3.22e-01 | 1.89e-12 | NA |
2. P | P07974 | Hemagglutinin-esterase-fusion glycoprotein (Fragment) | NA | 5.78e-11 | NA |
2. P | Q6DQ19 | Hemagglutinin (Fragment) | NA | 5.96e-06 | NA |
2. P | P07971 | Hemagglutinin-esterase-fusion glycoprotein (Fragment) | NA | 5.39e-09 | NA |
2. P | Q73372 | Envelope glycoprotein gp160 | NA | 1.97e-05 | NA |
2. P | O41803 | Envelope glycoprotein gp160 | NA | 8.88e-04 | NA |
2. P | Q7T9D9 | Envelope glycoprotein | NA | 8.21e-03 | NA |
2. P | P11134 | Hemagglutinin (Fragment) | NA | 2.91e-02 | NA |
2. P | P09767 | Hemagglutinin (Fragment) | NA | 3.80e-09 | NA |
2. P | P24872 | Envelope glycoprotein D | NA | 9.89e-03 | NA |
2. P | P11133 | Hemagglutinin (Fragment) | NA | 1.01e-02 | NA |
2. P | P17001 | Hemagglutinin | NA | 4.94e-06 | NA |
2. P | P03381 | Envelope glycoprotein gp62 | NA | 1.01e-25 | NA |
2. P | P03435 | Hemagglutinin | NA | 1.13e-05 | NA |
2. P | Q74126 | Envelope glycoprotein gp160 | NA | 1.14e-02 | NA |
2. P | P61564 | Syncytin-1 | 1.97e-01 | 1.92e-12 | NA |
2. P | P04579 | Envelope glycoprotein gp160 | NA | 7.49e-05 | NA |
2. P | P18040 | Envelope glycoprotein gp160 | NA | 1.06e-02 | NA |
2. P | P03437 | Hemagglutinin | NA | 6.13e-05 | NA |
2. P | Q70626 | Envelope glycoprotein gp160 | NA | 3.38e-06 | NA |
2. P | P26096 | Hemagglutinin | NA | 3.11e-11 | NA |
2. P | P25057 | Envelope glycoprotein | NA | 2.17e-10 | NA |
2. P | P05880 | Envelope glycoprotein gp160 | NA | 8.08e-04 | NA |
2. P | P27977 | Envelope glycoprotein gp160 | NA | 1.87e-08 | NA |
2. P | Q87041 | Envelope glycoprotein gp130 | NA | 4.28e-04 | NA |
2. P | P15831 | Envelope glycoprotein gp160 | NA | 4.39e-03 | NA |
2. P | P07968 | Hemagglutinin-esterase-fusion glycoprotein (Fragment) | NA | 2.47e-07 | NA |
2. P | P07575 | Envelope glycoprotein | NA | 2.44e-26 | NA |
2. P | Q80A26 | Hemagglutinin (Fragment) | NA | 2.00e-05 | NA |
2. P | P43259 | Hemagglutinin (Fragment) | NA | 1.66e-03 | NA |
2. P | Q9IDV2 | Envelope glycoprotein gp160 | NA | 1.02e-04 | NA |
2. P | Q9Q0U6 | Hemagglutinin | NA | 5.15e-07 | NA |
2. P | A4K143 | Hemagglutinin | NA | 1.22e-07 | NA |
2. P | Q80A28 | Hemagglutinin (Fragment) | NA | 7.41e-05 | NA |
2. P | O10236 | Glycoprotein | NA | 5.19e-04 | NA |
2. P | P12584 | Hemagglutinin (Fragment) | NA | 2.77e-02 | NA |
2. P | P19557 | Envelope glycoprotein | NA | 1.58e-08 | NA |
2. P | P43260 | Hemagglutinin (Fragment) | NA | 3.35e-03 | NA |
2. P | P27757 | Envelope glycoprotein gp160 | NA | 5.01e-24 | NA |
2. P | P09345 | Hemagglutinin | NA | 5.89e-06 | NA |
2. P | P03383 | Envelope glycoprotein gp63 | NA | 4.14e-21 | NA |
2. P | O56861 | Envelope glycoprotein gp130 | NA | 9.75e-06 | NA |
2. P | P26137 | Hemagglutinin (Fragment) | NA | 1.10e-06 | NA |
2. P | Q6UDK4 | Envelope glycoprotein B | NA | 7.91e-04 | NA |
2. P | O70902 | Envelope glycoprotein gp160 | NA | 8.98e-04 | NA |
2. P | P07399 | Pre-glycoprotein polyprotein GP complex | NA | 2.47e-02 | NA |
2. P | P08810 | Envelope glycoprotein gp160 | NA | 9.41e-06 | NA |
2. P | P10269 | Envelope glycoprotein | NA | 2.19e-30 | NA |
2. P | P61558 | Syncytin-2 | 2.43e-01 | 2.13e-31 | NA |
2. P | P19702 | Hemagglutinin | NA | 5.10e-08 | NA |
2. P | P03386 | Envelope glycoprotein | NA | 1.41e-26 | NA |
2. P | Q03804 | Envelope glycoprotein gp150 | NA | 5.37e-21 | NA |
2. P | Q9WFX3 | Hemagglutinin | NA | 1.16e-06 | NA |
2. P | P16996 | Hemagglutinin | NA | 1.09e-05 | NA |
2. P | P05884 | Envelope glycoprotein gp160 | NA | 7.81e-06 | NA |
2. P | Q0A448 | Hemagglutinin | NA | 5.18e-14 | NA |
2. P | P18799 | Envelope glycoprotein gp160 | NA | 3.05e-05 | NA |
2. P | P61550 | Endogenous retrovirus group S71 member 1 Env polyprotein | 3.89e-01 | 5.34e-31 | NA |
2. P | P24904 | Envelope glycoprotein B | NA | 7.01e-03 | NA |
2. P | P03448 | Hemagglutinin | NA | 2.25e-06 | NA |
2. P | P25218 | Envelope glycoprotein B | NA | 2.14e-05 | NA |
2. P | P28977 | Envelope glycoprotein | NA | 2.27e-02 | NA |
2. P | Q82857 | Envelope glycoprotein | NA | 9.40e-11 | NA |
2. P | P17281 | Envelope glycoprotein gp160 | NA | 3.04e-04 | NA |
2. P | Q9QBZ4 | Envelope glycoprotein gp160 | NA | 2.89e-06 | NA |
2. P | P31626 | Envelope glycoprotein | NA | 2.55e-20 | NA |
2. P | P14351 | Envelope glycoprotein gp130 | NA | 1.11e-03 | NA |
2. P | A4GCI6 | Hemagglutinin | NA | 4.66e-07 | NA |
2. P | P50491 | Apical membrane antigen 1 | 7.65e-01 | 3.05e-02 | NA |
2. P | P11267 | Envelope glycoprotein gp160 | NA | 9.75e-06 | NA |
2. P | P03378 | Envelope glycoprotein gp160 | NA | 3.89e-04 | NA |
2. P | P03389 | Glycoprotein 55 | NA | 2.32e-05 | NA |
2. P | B6SEH9 | Endogenous retrovirus group V member 2 Env polyprotein | 1.78e-01 | 2.92e-16 | NA |
2. P | Q09SZ7 | Envelope glycoprotein gp63 | NA | 3.05e-23 | NA |
2. P | P04583 | Envelope glycoprotein gp160 | NA | 4.52e-05 | NA |
2. P | P10448 | Hemagglutinin (Fragment) | NA | 1.15e-10 | NA |
2. P | Q2VNF2 | Hemagglutinin | NA | 1.76e-05 | NA |
2. P | Q82509 | Hemagglutinin | NA | 5.24e-06 | NA |
2. P | P12589 | Hemagglutinin | NA | 3.18e-03 | NA |
2. P | P03436 | Hemagglutinin | NA | 1.04e-04 | NA |
2. P | P22380 | Envelope glycoprotein gp160 | NA | 2.05e-21 | NA |
2. P | P19701 | Hemagglutinin | NA | 2.94e-07 | NA |
2. P | P07973 | Hemagglutinin-esterase-fusion glycoprotein (Fragment) | NA | 3.33e-07 | NA |
2. P | P26103 | Hemagglutinin | NA | 1.53e-11 | NA |
2. P | Q9WCE3 | Hemagglutinin | NA | 2.22e-06 | NA |
2. P | P36320 | Envelope glycoprotein B | NA | 8.29e-03 | NA |
2. P | P32536 | Envelope glycoprotein gp160 | NA | 8.73e-19 | NA |
2. P | P17504 | Hemagglutinin | NA | 1.06e-09 | NA |
2. P | P09343 | Hemagglutinin | NA | 2.57e-08 | NA |
2. P | Q04463 | Envelope glycoprotein B | NA | 1.25e-02 | NA |
2. P | Q67018 | Hemagglutinin | NA | 2.10e-07 | NA |
2. P | Q2A069 | Pre-glycoprotein polyprotein GP complex | NA | 4.04e-05 | NA |
2. P | P17005 | Hemagglutinin-esterase-fusion glycoprotein (Fragment) | NA | 1.24e-13 | NA |
2. P | P03440 | Hemagglutinin | NA | 9.40e-07 | NA |
2. P | Q6S6T9 | Envelope glycoprotein B | NA | 6.86e-06 | NA |
2. P | A4GCK8 | Hemagglutinin | NA | 2.96e-08 | NA |
2. P | P22429 | Envelope glycoprotein | NA | 2.63e-05 | NA |
2. P | P27399 | Envelope glycoprotein gp130 | NA | 8.54e-03 | NA |
2. P | P19106 | Hemagglutinin | NA | 1.76e-05 | NA |
2. P | P04581 | Envelope glycoprotein gp160 | NA | 7.03e-06 | NA |
2. P | Q6DLH8 | Envelope glycoprotein B | NA | 2.14e-05 | NA |
2. P | P19550 | Envelope glycoprotein gp160 | NA | 3.85e-03 | NA |
2. P | P17003 | Hemagglutinin-esterase-fusion glycoprotein (Fragment) | NA | 2.51e-14 | NA |
2. P | P25505 | Envelope glycoprotein | NA | 1.30e-09 | NA |
2. P | Q6DQ20 | Hemagglutinin (Fragment) | NA | 1.31e-06 | NA |
2. P | P26141 | Hemagglutinin | NA | 1.27e-06 | NA |
2. P | A4GCH5 | Hemagglutinin | NA | 1.35e-04 | NA |
2. P | Q6X1D5 | Glycoprotein | NA | 2.21e-02 | NA |
2. P | A4GCL9 | Hemagglutinin | NA | 9.81e-08 | NA |
2. P | P18876 | Hemagglutinin | NA | 1.19e-07 | NA |
2. P | P04580 | Envelope glycoprotein gp160 | NA | 3.86e-05 | NA |
2. P | A4U6V2 | Hemagglutinin | NA | 5.77e-09 | NA |
2. P | P26135 | Hemagglutinin | NA | 2.72e-06 | NA |
2. P | P03377 | Envelope glycoprotein gp160 | NA | 8.21e-07 | NA |
2. P | P25173 | Outer capsid protein VP4 | NA | 2.43e-02 | NA |
2. P | P17472 | Envelope glycoprotein B | NA | 1.21e-03 | NA |
2. P | A3EXG6 | Spike glycoprotein | NA | 4.42e-04 | NA |
2. P | P19695 | Hemagglutinin | NA | 4.33e-06 | NA |
2. P | Q6E0W7 | Glycoprotein | NA | 7.35e-04 | NA |
2. P | P11225 | Spike glycoprotein | NA | 4.87e-02 | NA |
2. P | P12587 | Hemagglutinin (Fragment) | NA | 4.66e-03 | NA |
2. P | Q04464 | Envelope glycoprotein B | NA | 1.79e-04 | NA |
2. P | P26097 | Hemagglutinin | NA | 1.94e-10 | NA |
2. P | P32541 | Envelope glycoprotein | NA | 5.96e-06 | NA |
2. P | P03451 | Hemagglutinin | NA | 1.14e-06 | NA |
2. P | P19696 | Hemagglutinin | NA | 1.16e-06 | NA |
2. P | P03188 | Envelope glycoprotein B | NA | 2.17e-04 | NA |
2. P | Q8V3T9 | Fusion glycoprotein F0 | NA | 4.72e-07 | NA |
2. P | Q9WCE1 | Hemagglutinin | NA | 2.11e-08 | NA |
2. P | P0C763 | Envelope glycoprotein B | NA | 3.04e-04 | NA |
2. P | Q9N2J8 | HERV-H_2q24.1 provirus ancestral Env polyprotein | 1.89e-02 | 2.71e-19 | NA |
2. P | P03454 | Hemagglutinin | NA | 7.63e-07 | NA |
2. P | P03458 | Hemagglutinin | NA | 2.87e-12 | NA |
2. P | A4GCJ7 | Hemagglutinin | NA | 4.44e-06 | NA |
2. P | Q27ID8 | Envelope glycoprotein | NA | 5.43e-32 | NA |
2. P | P03456 | Hemagglutinin | NA | 1.32e-06 | NA |
2. P | B4URD6 | Hemagglutinin | NA | 6.19e-08 | NA |
2. P | Q01977 | Spike glycoprotein | NA | 6.48e-03 | NA |
2. P | P06445 | Envelope glycoprotein | NA | 2.44e-30 | NA |
2. P | O12164 | Envelope glycoprotein gp160 | NA | 2.08e-04 | NA |
2. P | P19549 | Envelope glycoprotein gp160 | NA | 8.57e-06 | NA |
2. P | Q6DQ15 | Hemagglutinin (Fragment) | NA | 2.88e-04 | NA |
2. P | P25506 | Envelope glycoprotein | NA | 1.49e-09 | NA |
2. P | Q1A243 | Envelope glycoprotein gp160 | NA | 4.19e-04 | NA |
2. P | P03442 | Hemagglutinin | NA | 1.05e-03 | NA |
2. P | Q9QBY2 | Envelope glycoprotein gp160 | NA | 2.45e-05 | NA |
2. P | Q9TTC0 | Envelope glycoprotein | NA | 7.85e-34 | NA |
2. P | P36319 | Envelope glycoprotein B | NA | 5.75e-03 | NA |
2. P | P03399 | Envelope glycoprotein | NA | 2.52e-35 | NA |
2. P | P13103 | Hemagglutinin | NA | 1.20e-07 | NA |
2. P | P27427 | Envelope glycoprotein | NA | 3.53e-05 | NA |
2. P | P03380 | Envelope glycoprotein | NA | 1.04e-08 | NA |
2. P | P03392 | Envelope glycoprotein (Fragment) | NA | 5.69e-06 | NA |
2. P | P04661 | Hemagglutinin | NA | 3.37e-08 | NA |
2. P | P07967 | Hemagglutinin-esterase-fusion glycoprotein (Fragment) | NA | 1.33e-05 | NA |
2. P | O91086 | Envelope glycoprotein gp160 | NA | 1.19e-04 | NA |
2. P | P60608 | Endogenous retrovirus group FC1 member 1 Env polyprotein | 8.19e-01 | 8.63e-11 | NA |
2. P | A4GBX7 | Hemagglutinin | NA | 2.50e-06 | NA |
2. P | P61557 | Syncytin-2 | 4.48e-01 | 1.28e-30 | NA |
2. P | P61559 | ERV-H1 provirus ancestral Env polyprotein | 9.83e-02 | 1.81e-06 | NA |
2. P | P08667 | Glycoprotein | NA | 9.32e-03 | NA |
2. P | P03460 | Hemagglutinin | NA | 8.27e-11 | NA |
2. P | P61563 | Syncytin-1 | 3.04e-01 | 1.42e-12 | NA |
2. P | P68761 | Hemagglutinin-esterase-fusion glycoprotein (Fragment) | NA | 2.10e-09 | NA |
2. P | Q6DPZ9 | Hemagglutinin (Fragment) | NA | 9.75e-06 | NA |
2. P | P12581 | Hemagglutinin | NA | 1.16e-11 | NA |
2. P | Q27YE4 | Pre-glycoprotein polyprotein GP complex | NA | 6.67e-07 | NA |
2. P | P61556 | Syncytin-2 | 4.18e-01 | 7.73e-32 | NA |
2. P | P31796 | Envelope glycoprotein | NA | 1.92e-27 | NA |
2. P | P26562 | Hemagglutinin | NA | 1.39e-08 | NA |
2. P | A8C8W3 | Hemagglutinin | NA | 6.06e-05 | NA |
2. P | P05886 | Envelope glycoprotein gp160 | NA | 2.07e-07 | NA |
2. P | Q2RCH5 | Hemagglutinin | NA | 4.33e-07 | NA |
2. P | Q9Q714 | Envelope glycoprotein gp160 | NA | 3.57e-05 | NA |
2. P | Q8AYW1 | Pre-glycoprotein polyprotein GP complex | NA | 9.67e-05 | NA |
2. P | O11283 | Hemagglutinin | NA | 5.88e-08 | NA |
2. P | O56140 | Hemagglutinin | NA | 1.38e-07 | NA |
2. P | P12439 | Hemagglutinin | NA | 9.27e-12 | NA |
2. P | P51519 | Envelope glycoprotein | NA | 2.79e-09 | NA |
2. P | Q9QSQ7 | Envelope glycoprotein gp160 | NA | 3.70e-03 | NA |
2. P | Q76638 | Envelope glycoprotein gp160 | NA | 1.30e-04 | NA |
2. P | Q9H9K5 | Endogenous retroviral envelope protein HEMO | 5.39e-01 | 1.91e-09 | NA |
2. P | P22430 | Envelope glycoprotein | NA | 2.13e-04 | NA |
2. P | P43258 | Hemagglutinin (Fragment) | NA | 3.09e-03 | NA |
2. P | P16995 | Hemagglutinin | NA | 2.37e-03 | NA |
2. P | Q1A261 | Envelope glycoprotein gp160 | NA | 2.32e-07 | NA |
2. P | P03393 | Glycoprotein 55 | NA | 2.72e-05 | NA |
2. P | P03463 | Hemagglutinin | NA | 1.12e-10 | NA |
2. P | P03459 | Hemagglutinin | NA | 1.21e-08 | NA |
2. P | P60508 | Syncytin-2 | 3.98e-01 | 6.94e-31 | NA |
2. P | Q9QBZ8 | Envelope glycoprotein gp160 | NA | 5.86e-05 | NA |
2. P | P16998 | Hemagglutinin | NA | 1.82e-03 | NA |
2. P | Q07FI5 | Hemagglutinin | NA | 5.89e-06 | NA |
2. P | P04027 | Envelope glycoprotein | NA | 4.38e-27 | NA |
2. P | P08355 | Envelope glycoprotein B | NA | 1.84e-05 | NA |
2. P | P19697 | Hemagglutinin | NA | 3.37e-09 | NA |
2. P | P11135 | Hemagglutinin | NA | 4.33e-07 | NA |
2. P | Q2F4V2 | Hemagglutinin (Fragment) | NA | 7.63e-07 | NA |
2. P | P17755 | Envelope glycoprotein gp160 | NA | 2.22e-04 | NA |
2. P | Q67387 | Hemagglutinin-esterase-fusion glycoprotein | NA | 4.02e-10 | NA |
2. P | O36362 | Envelope glycoprotein B | NA | 3.21e-04 | NA |
2. P | P12488 | Envelope glycoprotein gp160 | NA | 2.00e-05 | NA |
2. P | P19699 | Hemagglutinin | NA | 1.17e-05 | NA |
2. P | P25507 | Envelope glycoprotein | NA | 5.01e-11 | NA |
2. P | P31627 | Envelope glycoprotein | NA | 6.33e-23 | NA |
2. P | P03394 | Glycoprotein 55 | NA | 8.38e-06 | NA |
2. P | Q04993 | Envelope glycoprotein gp150 | NA | 1.92e-24 | NA |
2. P | Q80A30 | Hemagglutinin (Fragment) | NA | 3.46e-07 | NA |
2. P | P19698 | Hemagglutinin | NA | 2.61e-09 | NA |
2. P | P05879 | Envelope glycoprotein gp160 | NA | 3.67e-06 | NA |
2. P | P61554 | Syncytin-2 | 2.00e-01 | 2.13e-31 | NA |
2. P | P07977 | Hemagglutinin (Fragment) | NA | 4.24e-04 | NA |
2. P | Q67282 | Hemagglutinin | NA | 7.28e-06 | NA |
2. P | P03438 | Hemagglutinin | NA | 2.76e-06 | NA |
2. P | P51520 | Envelope glycoprotein | NA | 3.85e-21 | NA |
2. P | P08669 | Pre-glycoprotein polyprotein GP complex | NA | 5.69e-03 | NA |
2. P | P16899 | Envelope glycoprotein gp160 | NA | 4.73e-20 | NA |
2. P | P09766 | Hemagglutinin (Fragment) | NA | 1.40e-07 | NA |
2. P | Q0HD60 | Hemagglutinin | NA | 3.89e-08 | NA |
2. P | P51515 | Envelope glycoprotein | NA | 2.51e-23 | NA |
2. P | P23422 | Envelope glycoprotein gp160 | NA | 1.35e-16 | NA |
2. P | Q8AIH5 | Envelope glycoprotein gp160 | NA | 2.76e-04 | NA |
2. P | P31872 | Envelope glycoprotein gp160 | NA | 3.38e-06 | NA |
2. P | P19700 | Hemagglutinin | NA | 2.47e-08 | NA |
2. P | P09257 | Envelope glycoprotein B | NA | 1.84e-02 | NA |
2. P | P31791 | Envelope glycoprotein | NA | 1.14e-25 | NA |
2. P | P03375 | Envelope glycoprotein gp160 | NA | 2.96e-06 | NA |
2. P | P04582 | Envelope glycoprotein gp160 | NA | 9.98e-06 | NA |
2. P | P43257 | Hemagglutinin (Fragment) | NA | 7.89e-03 | NA |
2. P | P03391 | Envelope glycoprotein | NA | 1.91e-31 | NA |
2. P | P03452 | Hemagglutinin | NA | 1.26e-08 | NA |
2. P | Q289M7 | Hemagglutinin | NA | 7.90e-08 | NA |
2. P | P17000 | Hemagglutinin | NA | 5.12e-05 | NA |
2. P | P08359 | Envelope glycoprotein | NA | 2.34e-32 | NA |
2. P | P10404 | MLV-related proviral Env polyprotein | 6.96e-01 | 3.27e-29 | NA |
2. P | P03441 | Hemagglutinin (Fragment) | NA | 1.19e-02 | NA |
2. P | A3DRP0 | Hemagglutinin | NA | 5.82e-07 | NA |
2. P | P0C762 | Envelope glycoprotein B | NA | 3.04e-04 | NA |
2. P | Q89607 | Envelope glycoprotein gp160 | NA | 3.19e-05 | NA |
2. P | P16082 | Envelope glycoprotein | NA | 1.91e-05 | NA |
2. P | Q6J8F6 | Hemagglutinin (Fragment) | NA | 9.17e-07 | NA |
2. P | P26101 | Hemagglutinin | NA | 8.26e-10 | NA |
2. P | P19240 | Pre-glycoprotein polyprotein GP complex | NA | 1.42e-03 | NA |
2. P | P19503 | Envelope glycoprotein gp160 | NA | 6.90e-04 | NA |
2. P | Q79670 | Envelope glycoprotein gp160 | NA | 2.96e-08 | NA |
2. P | P20871 | Envelope glycoprotein gp160 | NA | 1.52e-04 | NA |
2. P | P21412 | Envelope glycoprotein | NA | 1.99e-26 | NA |
2. P | P13101 | Hemagglutinin | NA | 4.72e-08 | NA |
2. P | P03446 | Hemagglutinin | NA | 9.40e-11 | NA |
2. P | Q30NQ1 | Hemagglutinin | NA | 7.32e-05 | NA |
2. P | P26100 | Hemagglutinin | NA | 1.36e-11 | NA |
2. P | Q6DQ18 | Hemagglutinin (Fragment) | NA | 1.16e-07 | NA |
2. P | P21415 | Envelope glycoprotein | NA | 2.23e-32 | NA |
2. P | P05878 | Envelope glycoprotein gp160 | NA | 7.63e-06 | NA |
2. P | P23073 | Envelope glycoprotein gp130 | NA | 1.78e-05 | NA |
2. P | P26098 | Hemagglutinin | NA | 2.73e-11 | NA |
2. P | P20888 | Envelope glycoprotein gp160 | NA | 1.23e-05 | NA |
2. P | P03449 | Hemagglutinin | NA | 1.23e-05 | NA |
2. P | P36346 | Hemagglutinin | NA | 4.13e-10 | NA |
2. P | P22092 | Hemagglutinin | NA | 1.71e-08 | NA |
2. P | P03453 | Hemagglutinin | NA | 2.56e-07 | NA |
2. P | P20872 | Envelope glycoprotein gp160 | NA | 1.20e-03 | NA |
2. P | Q6LEJ4 | Hemagglutinin | NA | 3.35e-10 | NA |
2. P | P35961 | Envelope glycoprotein gp160 | NA | 8.65e-05 | NA |
2. P | P07946 | Spike glycoprotein | NA | 7.44e-03 | NA |
2. P | P31789 | Envelope glycoprotein | NA | 2.10e-30 | NA |
2. P | B6SEH8 | Endogenous retrovirus group V member 1 Env polyprotein | 4.07e-01 | 2.14e-15 | NA |
2. P | F5HB81 | Envelope glycoprotein B | NA | 1.91e-05 | NA |
2. P | P09765 | Hemagglutinin (Fragment) | NA | 3.19e-09 | NA |
2. P | P32550 | Glycoprotein | NA | 1.52e-02 | NA |
2. P | P18450 | Spike glycoprotein | NA | 5.15e-03 | NA |
2. P | P28864 | Envelope glycoprotein B | NA | 1.72e-02 | NA |
2. P | Q9QBZ0 | Envelope glycoprotein gp160 | NA | 2.19e-05 | NA |
2. P | P04578 | Envelope glycoprotein gp160 | NA | 2.36e-06 | NA |
2. P | P05881 | Envelope glycoprotein gp160 | NA | 1.14e-04 | NA |
2. P | Q6DQ21 | Hemagglutinin (Fragment) | NA | 6.92e-07 | NA |
2. P | P03462 | Hemagglutinin (Fragment) | NA | 1.47e-09 | NA |
2. P | Q2ICR0 | Hemagglutinin | NA | 1.70e-05 | NA |
2. P | Q91DS0 | Glycoprotein | NA | 2.74e-02 | NA |
2. P | P26136 | Hemagglutinin | NA | 8.49e-09 | NA |
2. P | Q9WC60 | Envelope glycoprotein gp160 | NA | 5.06e-05 | NA |
2. P | P50490 | Apical membrane antigen 1 | 8.53e-01 | 3.02e-02 | NA |
2. P | P07975 | Hemagglutinin-esterase-fusion glycoprotein | NA | 2.01e-09 | NA |
2. P | A8C8J4 | Hemagglutinin | NA | 2.50e-08 | NA |
2. P | Q05320 | Envelope glycoprotein | NA | 3.32e-02 | NA |
2. P | P03396 | Envelope glycoprotein gp95 | NA | 2.61e-23 | NA |
2. P | P17332 | Pre-glycoprotein polyprotein GP complex | NA | 8.25e-04 | NA |
2. P | P19030 | Envelope glycoprotein gp150 | NA | 1.24e-18 | NA |
2. P | Q03816 | Envelope glycoprotein gp62 | NA | 1.40e-24 | NA |
2. P | P33470 | Spike glycoprotein | NA | 8.29e-03 | NA |
2. P | Q0R5Q9 | Envelope glycoprotein gp63 | NA | 4.31e-26 | NA |
2. P | P59594 | Spike glycoprotein | NA | 1.06e-04 | NA |
2. P | Q77377 | Envelope glycoprotein gp160 | NA | 2.47e-07 | NA |
2. P | P21443 | Envelope glycoprotein | NA | 1.01e-27 | NA |
2. P | P60509 | Endogenous retrovirus group PABLB member 1 Env polyprotein | 2.91e-01 | 8.39e-11 | NA |
2. P | P04577 | Envelope glycoprotein gp160 | NA | 2.94e-04 | NA |
2. P | P09344 | Hemagglutinin | NA | 2.28e-08 | NA |
2. P | Q04995 | Envelope glycoprotein gp150 | NA | 3.23e-20 | NA |
2. P | P03455 | Hemagglutinin | NA | 7.54e-07 | NA |
2. P | Q05312 | Envelope glycoprotein gp150 | NA | 1.11e-19 | NA |
2. P | J7HBH4 | Glycoprotein | NA | 3.82e-07 | NA |
2. P | P12492 | Envelope glycoprotein gp160 | NA | 7.74e-05 | NA |
2. P | Q77JN0 | Envelope glycoprotein B | NA | 7.01e-03 | NA |
2. P | P04884 | Glycoprotein | NA | 6.16e-03 | NA |
2. P | P03464 | Hemagglutinin | NA | 2.05e-10 | NA |
2. P | Q6J8E7 | Hemagglutinin (Fragment) | NA | 9.63e-07 | NA |
2. P | P26804 | Envelope glycoprotein | NA | 9.47e-28 | NA |
2. P | Q2F7I8 | Envelope glycoprotein | NA | 9.29e-30 | NA |
2. P | P25504 | Envelope glycoprotein | NA | 1.30e-08 | NA |
2. P | P03390 | Envelope glycoprotein | NA | 2.87e-26 | NA |
2. P | O89746 | Hemagglutinin | NA | 3.92e-07 | NA |
2. P | Q5GA86 | Glycoprotein | NA | 4.19e-02 | NA |
2. P | P08360 | Envelope glycoprotein | NA | 4.58e-26 | NA |
2. P | P11132 | Hemagglutinin | NA | 2.02e-07 | NA |
2. P | P0C212 | Envelope glycoprotein gp62 | NA | 1.32e-24 | NA |
2. P | D8V075 | Glycoprotein | NA | 1.19e-03 | NA |
2. P | Q0GBY1 | Glycoprotein | NA | 1.34e-02 | NA |
2. P | Q0A3Y1 | Hemagglutinin | NA | 9.07e-09 | NA |
2. P | P09991 | Pre-glycoprotein polyprotein GP complex | NA | 3.21e-03 | NA |
2. P | Q0Q475 | Spike glycoprotein | NA | 3.17e-04 | NA |
2. P | P26102 | Hemagglutinin | NA | 2.17e-11 | NA |
2. P | P61561 | Syncytin-1 | 4.22e-01 | 8.61e-13 | NA |
2. P | P61555 | Syncytin-2 | 1.58e-01 | 7.91e-32 | NA |
2. P | P21445 | Envelope glycoprotein | NA | 1.12e-30 | NA |
2. P | Q02282 | Envelope glycoprotein gp150 | NA | 1.35e-19 | NA |
2. P | P03388 | Envelope glycoprotein | NA | 4.39e-31 | NA |
2. P | P12588 | Hemagglutinin (Fragment) | NA | 8.62e-03 | NA |
2. P | P31819 | Envelope glycoprotein gp160 | NA | 1.22e-05 | NA |
2. P | P05885 | Envelope glycoprotein gp160 | NA | 5.24e-05 | NA |
2. P | Q5G5D5 | Syncytin-A | 9.15e-02 | 3.02e-31 | NA |
2. P | P12651 | Spike glycoprotein | NA | 3.89e-02 | NA |
2. P | Q08011 | Hemagglutinin | NA | 2.29e-07 | NA |
2. P | P19551 | Envelope glycoprotein gp160 | NA | 5.18e-05 | NA |
2. P | P18050 | Envelope glycoprotein B | NA | 1.88e-05 | NA |
2. P | D0QX25 | Envelope glycoprotein | NA | 1.25e-02 | NA |
2. P | P10757 | Hemagglutinin | NA | 3.96e-10 | NA |
2. P | P26138 | Hemagglutinin | NA | 9.56e-05 | NA |
2. P | Q14264 | Endogenous retrovirus group 3 member 1 Env polyprotein | 7.22e-01 | 1.43e-03 | NA |
2. P | Q75008 | Envelope glycoprotein gp160 | NA | 5.30e-05 | NA |
2. P | P03461 | Hemagglutinin (Fragment) | NA | 2.00e-08 | NA |
2. P | P22428 | Envelope glycoprotein | NA | 7.66e-05 | NA |
2. P | P11268 | Envelope glycoprotein | NA | 2.13e-27 | NA |
2. P | A4U7A6 | Hemagglutinin | NA | 3.42e-07 | NA |
2. P | P23423 | Envelope glycoprotein gp160 | NA | 9.36e-18 | NA |
2. P | P06751 | Envelope glycoprotein | NA | 4.13e-06 | NA |
2. P | P12449 | Envelope glycoprotein gp160 | NA | 5.79e-05 | NA |
2. P | P26803 | Envelope glycoprotein | NA | 1.67e-28 | NA |
2. P | P05883 | Envelope glycoprotein gp160 | NA | 3.86e-05 | NA |
2. P | P07976 | Hemagglutinin | NA | 6.70e-06 | NA |
2. P | P26134 | Hemagglutinin | NA | 4.12e-07 | NA |
2. P | P26099 | Hemagglutinin | NA | 2.10e-11 | NA |
2. P | P11261 | Envelope glycoprotein | NA | 8.79e-34 | NA |
2. P | Q2VND2 | Hemagglutinin | NA | 1.24e-05 | NA |
2. P | P60507 | Endogenous retrovirus group FC1 Env polyprotein | 4.23e-01 | 7.72e-25 | NA |
2. P | P0DTC2 | Spike glycoprotein | NA | 1.51e-03 | NA |
2. P | P12583 | Hemagglutinin | NA | 6.70e-05 | NA |
2. P | P12586 | Hemagglutinin (Fragment) | NA | 5.64e-03 | NA |
2. P | P17004 | Hemagglutinin-esterase-fusion glycoprotein (Fragment) | NA | 1.19e-13 | NA |
2. P | O89292 | Envelope glycoprotein gp160 | NA | 1.67e-04 | NA |
2. P | Q6DQ22 | Hemagglutinin (Fragment) | NA | 1.50e-04 | NA |
2. P | P87506 | Hemagglutinin | NA | 1.90e-06 | NA |
2. P | Q38SQ8 | Hemagglutinin | NA | 1.60e-09 | NA |
2. P | P03385 | Envelope glycoprotein | NA | 1.95e-25 | NA |
2. P | Q8BI41 | Syncytin-B | 2.53e-02 | 4.78e-33 | NA |
2. P | P61553 | Syncytin-2 | 3.48e-01 | 7.81e-29 | NA |
2. P | P68762 | Hemagglutinin-esterase-fusion glycoprotein | NA | 2.23e-11 | NA |
2. P | P03379 | Envelope glycoprotein gp160 | NA | 4.29e-17 | NA |
2. P | P03465 | Hemagglutinin-esterase-fusion glycoprotein | NA | 3.70e-09 | NA |
2. P | Q8MIB6 | Endogenous retrovirus group FC1 Env polyprotein | 4.77e-01 | 1.02e-24 | NA |
2. P | P16999 | Hemagglutinin | NA | 4.44e-06 | NA |
2. P | Q9N2K0 | HERV-H_2q24.3 provirus ancestral Env polyprotein | 5.01e-02 | 6.34e-27 | NA |
2. P | Q1PUD9 | Hemagglutinin | NA | 2.45e-05 | NA |
2. P | P12489 | Envelope glycoprotein gp160 | NA | 1.97e-05 | NA |
2. P | Q8B120 | Pre-glycoprotein polyprotein GP complex | NA | 3.57e-02 | NA |
2. P | P15073 | Envelope glycoprotein | NA | 8.44e-31 | NA |
2. P | P16090 | Envelope glycoprotein gp150 | NA | 1.51e-24 | NA |
2. P | Q8QPL1 | Hemagglutinin | NA | 5.42e-06 | NA |
2. P | P04624 | Envelope glycoprotein gp160 | NA | 9.87e-07 | NA |
2. P | A7WNB3 | Glycoprotein | NA | 3.59e-03 | NA |
2. P | P04883 | Glycoprotein | NA | 4.57e-03 | NA |
2. P | Q9WCD9 | Hemagglutinin | NA | 4.33e-07 | NA |
2. P | P03457 | Hemagglutinin | NA | 1.46e-10 | NA |
2. P | P15658 | Hemagglutinin | NA | 5.30e-06 | NA |
2. P | P24905 | Envelope glycoprotein B | NA | 1.34e-02 | NA |
2. P | Q03909 | Hemagglutinin | NA | 4.80e-03 | NA |
2. P | Q67333 | Hemagglutinin | NA | 3.99e-06 | NA |
2. P | Q2RFA5 | Hemagglutinin | NA | 1.23e-05 | NA |
2. P | P13102 | Hemagglutinin | NA | 7.92e-07 | NA |
2. P | Q91MA7 | Hemagglutinin | NA | 5.12e-05 | NA |
2. P | P23064 | Envelope glycoprotein gp62 | NA | 6.85e-25 | NA |
2. P | P05882 | Envelope glycoprotein gp160 | NA | 3.37e-05 | NA |
2. P | P11370 | Retrovirus-related Env polyprotein from Fv-4 locus | 1.51e-01 | 9.23e-25 | NA |
3. B | P63135 | Endogenous retrovirus group K member 7 Pol protein | 4.68e-06 | NA | 0.0 |
3. B | Q9HDB8 | Endogenous retrovirus group K member 5 Env polyprotein | 9.08e-02 | NA | 5.13e-159 |
3. B | P61571 | Endogenous retrovirus group K member 21 Rec protein | 1.11e-01 | NA | 2.66e-48 |
3. B | P61572 | Endogenous retrovirus group K member 19 Rec protein | 1.11e-01 | NA | 1.24e-51 |
3. B | Q69383 | Endogenous retrovirus group K member 6 Rec protein | 8.75e-02 | NA | 1.24e-51 |
3. B | P10266 | Endogenous retrovirus group K member 10 Pol protein | 8.21e-01 | NA | 3.17e-85 |
3. B | P61578 | Endogenous retrovirus group K member 16 Rec protein | 1.32e-01 | NA | 8.15e-29 |
3. B | Q9UQG0 | Endogenous retrovirus group K member 11 Pol protein | 8.22e-01 | NA | 2.49e-53 |
3. B | P61579 | Endogenous retrovirus group K member 25 Rec protein | 9.82e-02 | NA | 1.24e-51 |
3. B | P61573 | Endogenous retrovirus group K member 9 Rec protein | 1.05e-01 | NA | 1.24e-51 |
3. B | P61574 | Endogenous retrovirus group K member 113 Rec protein | 2.64e-01 | NA | 1.74e-51 |
3. B | P61568 | Putative endogenous retrovirus group K member 11-1 Env polyprotein | 9.43e-01 | NA | 7.50e-27 |
3. B | P61575 | Endogenous retrovirus group K member 8 Rec protein | 1.44e-01 | NA | 8.92e-52 |
3. B | P61576 | Endogenous retrovirus group K member 104 Rec protein | 2.70e-01 | NA | 1.47e-46 |
3. B | Q3V3Q4 | Pyrin domain-containing protein 3 | 9.64e-01 | NA | 0.002 |