Summary

Q9ULE4

Homolog: Q0KK56.
Function: Protein FAM184B.

Statistics

Total GO Annotation: 154
Unique PROST Go: 136
Unique BLAST Go: 18

Total Homologs: 79
Unique PROST Homologs: 74
Unique BLAST Homologs: 2

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q0KK56 (Protein FAM184B) with a FATCAT P-Value: 1.06e-10 and RMSD of 9.09 angstrom. The sequence alignment identity is 67.0%.
Structural alignment shown in left. Query protein Q9ULE4 colored as red in alignment, homolog Q0KK56 colored as blue. Query protein Q9ULE4 is also shown in right top, homolog Q0KK56 showed in right bottom. They are colored based on secondary structures. 

  Q9ULE4 MASALNSKINPPGTCQGSKAD--GGAGWRMDCDPQMHVKMCKKIAQLTKVIYALNTRQDEAEASMEALREAHQEELQNAVAETKARLLQEQG-CAEE-EA 96
  Q0KK56 MASALNSKIHPPGTCASSKADARGGSGWRMDCDPEMHVKMCKKIAQLTKVIYALNTRQDEVEVSVESIREAHQEDLQDTGAETRTRLPQEQSRTSEDAET 100

  Q9ULE4 LLQRIQALESALELQKRLTEEALAESASCRLETKERELRVEAEHAERVLTLSREMLELKADYERRLQHLTSHEATPQ-GRLPQESPETKSEPGQGPEMQE 195
  Q0KK56 LLKRIQTLENALELQKRLTQEALAESASCKLETKERELRVEAEHAERVLILSKEMLELKADYEKRLQLLTSHEG-PQWGQLSQESPDATAESSQRPEMHQ 199

  Q9ULE4 VLLEVQRLRVENQQLSKDYARKAEELQATYERENEAIRQAMQQSVSQALWQWQEKESDLRKNFQVQESALQAQVRKLEGDLEHRGRKISDLKKYAQKLKE 295
  Q0KK56 VLLEVERLRAENKQLSQDYARKAEELQATYERENEAIRQAMQQSVSEALWQWQEKESGLRKNFQVQESALQAQVRKLEGDLEHRGRKISDLKKYAQKLKE 299

  Q9ULE4 RIQDLDVQLKEARQENSELKGTAKKLGEKLAVAKDRMMLQECRGTQQTDAMKTELVSENKVLREENDLEAGNLHPQQDQSCLKECPCMKGGTDMQTKKEA 395
  Q0KK56 RIQDLDVQLREARQENSELKSTARKLGEKLAIAKDRLMLQECHVTQKTDDMKT----EDGVLGKRDDLEACSLHPQQEQGFPKLCHCRNGGSETQTKKEA 395

  Q9ULE4 SAETEYMKQQYEEDLRKIKHQTEEEKKHLKDQLVKRLEDLVKKHTVEIKSVRSSVEAERKKLQREVEAQLEEVRKKSEKEIKQLEEEKAALNVKLQNSLL 495
  Q0KK56 SGEMENMKQQYEEDLRKVRHQTEEEKQQLREQLGKRLEDLVKKHTMEMKSVCSTVEVERKKL-KEVEAQLEEVKTKSEREIQQLQEEKAALSTKLQNSLL 494

  Q9ULE4 EVLRLEEFIQQNKTRPTGAEESPQELGRQHCSILETQDPCLKLDETSPRGEEYQDKLAAEEGTSSDEEERTKVLLKEG-SDPQPPLGSLLKEKTSKIQRL 594
  Q0KK56 --------------------EDP-------CS--RPKKPA--RDE----G---LEKLTDEEESSSDEEERTGESVK-GKSDLQPPFESVMKEKAVEIGHR 555

  Q9ULE4 EEDWQSQKAKLQAQVSQMQQALEQCTSNYREDLQALKQLSDLEREKLQRELQETTQQNHAMKAQLEASHQRALRMLEKARHQELKATEERLKKESSHSLQ 694
  Q0KK56 PEDWQSQRTKLQT------QAAE-C-----------------------------------------------------------------LNKDSTDSL- 582

  Q9ULE4 IQHQTHRLELQALEEKARQELQEERERMQAQQALLLESLRQELSEQQAACSGHQKDLEALQAELRA---LGRQQASSQCPGDSKDHIIATEERGGPGQAG 791
  Q0KK56 ---QAHLLELQALEDNARQELQEDCEQMQVQQSGLLESLRQELTEQRVACCEHQKALEMLQNEFRAVGPLGKWQATNQCPGDRRDHTFITEDMGVTG--- 676

  Q9ULE4 SPPGAAGQGSGEGC----GLWEENAQLQDAVRRLRAEVEQHQQEAQKLRDQRRFLEETQQAQRAREVETLRQEHRKEMQAMVADFSSAQAQLQARLAALE 887
  Q0KK56 -PPGSL------PCAAEKGLLEENAQLQDTVLRLRAEVDQHLQEALQLREQHRLLEEDQKAQRAMEVEALRQEHRKEMQAMVADFSGAQARLQARLAALE 769

  Q9ULE4 AELKDSGEKPGKGASRPEDLQLIGRLQTRLKEREDIIKQLTEERRFHYAAFPSAMSHRNRSFSFNPHPGYLTPSMKKKKVEDVPSRVVSVPNLASYAKNF 987
  Q0KK56 TELKESGEKAGKGTSRPEDLQLIGRLQTRLKEREDIIRQLTEERRFHYAAFPSAVSHRNRSFSFNPHPGYLTPSMKKKKMEEVPSRVVSVPNLASYAKNF 869

  Q9ULE4 LSGDLSSRINAPPITTSPSLDPSPSCGRTYKPNQSTDAKTATRTPDGETAQAKEVQQKQGSPHQEWFTKYFSF 1060
  Q0KK56 LSGDLSSRINAPPITKSPSLDPSPSCSQPYKPTQLLDGKTASRTQDGEPAQPKEAPQKQGSPHQEWFTKYFSF 942

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0099041 vesicle tethering to Golgi
2. P GO:0030173 integral component of Golgi membrane
2. P GO:0097539 ciliary transition fiber
2. P GO:0050772 positive regulation of axonogenesis
2. P GO:0010369 chromocenter
2. P GO:0070530 K63-linked polyubiquitin modification-dependent protein binding
2. P GO:0060050 positive regulation of protein glycosylation
2. P GO:0007094 mitotic spindle assembly checkpoint signaling
2. P GO:0097224 sperm connecting piece
2. P GO:0045141 meiotic telomere clustering
2. P GO:0090161 Golgi ribbon formation
2. P GO:0071539 protein localization to centrosome
2. P GO:0003413 chondrocyte differentiation involved in endochondral bone morphogenesis
2. P GO:0032059 bleb
2. P GO:0051026 chiasma assembly
2. P GO:0047496 vesicle transport along microtubule
2. P GO:0044615 nuclear pore nuclear basket
2. P GO:0003690 double-stranded DNA binding
2. P GO:0031965 nuclear membrane
2. P GO:1902254 negative regulation of intrinsic apoptotic signaling pathway by p53 class mediator
2. P GO:0032091 negative regulation of protein binding
2. P GO:0009903 chloroplast avoidance movement
2. P GO:0048193 Golgi vesicle transport
2. P GO:0035092 sperm DNA condensation
2. P GO:0007030 Golgi organization
2. P GO:0010758 regulation of macrophage chemotaxis
2. P GO:0008017 microtubule binding
2. P GO:0007020 microtubule nucleation
2. P GO:0051645 Golgi localization
2. P GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport
2. P GO:0120103 centriolar subdistal appendage
2. P GO:0006997 nucleus organization
2. P GO:0034399 nuclear periphery
2. P GO:0098535 de novo centriole assembly involved in multi-ciliated epithelial cell differentiation
2. P GO:0001673 male germ cell nucleus
2. P GO:0006891 intra-Golgi vesicle-mediated transport
2. P GO:0090166 Golgi disassembly
2. P GO:0042110 T cell activation
2. P GO:0034067 protein localization to Golgi apparatus
2. P GO:0000711 meiotic DNA repair synthesis
2. P GO:0051301 cell division
2. P GO:0005524 ATP binding
2. P GO:0002756 MyD88-independent toll-like receptor signaling pathway
2. P GO:0072518 Rho-dependent protein serine/threonine kinase activity
2. P GO:0008356 asymmetric cell division
2. P GO:0051315 attachment of mitotic spindle microtubules to kinetochore
2. P GO:0005136 interleukin-4 receptor binding
2. P GO:0098871 postsynaptic actin cytoskeleton
2. P GO:0010507 negative regulation of autophagy
2. P GO:0000802 transverse filament
2. P GO:0007098 centrosome cycle
2. P GO:0032880 regulation of protein localization
2. P GO:0051878 lateral element assembly
2. P GO:0000922 spindle pole
2. P GO:0005802 trans-Golgi network
2. P GO:0051451 myoblast migration
2. P GO:0060287 epithelial cilium movement involved in determination of left/right asymmetry
2. P GO:0044565 dendritic cell proliferation
2. P GO:0007129 homologous chromosome pairing at meiosis
2. P GO:0048309 endoplasmic reticulum inheritance
2. P GO:0060285 cilium-dependent cell motility
2. P GO:0055107 Golgi to secretory granule transport
2. P GO:0007288 sperm axoneme assembly
2. P GO:0042130 negative regulation of T cell proliferation
2. P GO:0120229 protein localization to motile cilium
2. P GO:0005652 nuclear lamina
2. P GO:0032815 negative regulation of natural killer cell activation
2. P GO:0001520 outer dense fiber
2. P GO:0036159 inner dynein arm assembly
2. P GO:0005694 chromosome
2. P GO:0090306 meiotic spindle assembly
2. P GO:0005816 spindle pole body
2. P GO:0051298 centrosome duplication
2. P GO:0007130 synaptonemal complex assembly
2. P GO:0005856 cytoskeleton
2. P GO:0061676 importin-alpha family protein binding
2. P GO:0090235 regulation of metaphase plate congression
2. P GO:1901888 regulation of cell junction assembly
2. P GO:0032580 Golgi cisterna membrane
2. P GO:0000801 central element
2. P GO:0051225 spindle assembly
2. P GO:0002081 outer acrosomal membrane
2. P GO:0034142 toll-like receptor 4 signaling pathway
2. P GO:0009637 response to blue light
2. P GO:0097298 regulation of nucleus size
2. P GO:0060122 inner ear receptor cell stereocilium organization
2. P GO:0002079 inner acrosomal membrane
2. P GO:0009904 chloroplast accumulation movement
2. P GO:0045162 clustering of voltage-gated sodium channels
2. P GO:0007249 I-kappaB kinase/NF-kappaB signaling
2. P GO:0007131 reciprocal meiotic recombination
2. P GO:0072686 mitotic spindle
2. P GO:0030134 COPII-coated ER to Golgi transport vesicle
2. P GO:0006486 protein glycosylation
2. P GO:0043515 kinetochore binding
2. P GO:0048278 vesicle docking
2. P GO:0000242 pericentriolar material
2. P GO:0007099 centriole replication
2. P GO:0120317 sperm mitochondrial sheath assembly
2. P GO:0005930 axoneme
2. P GO:0051660 establishment of centrosome localization
2. P GO:0090307 mitotic spindle assembly
2. P GO:0033116 endoplasmic reticulum-Golgi intermediate compartment membrane
2. P GO:1901990 regulation of mitotic cell cycle phase transition
2. P GO:0048471 perinuclear region of cytoplasm
2. P GO:0051289 protein homotetramerization
2. P GO:0000775 chromosome, centromeric region
2. P GO:0032695 negative regulation of interleukin-12 production
2. P GO:0097028 dendritic cell differentiation
2. P GO:0098536 deuterosome
2. P GO:0031393 negative regulation of prostaglandin biosynthetic process
2. P GO:0005814 centriole
2. P GO:0042976 activation of Janus kinase activity
2. P GO:0048538 thymus development
2. P GO:0005794 Golgi apparatus
2. P GO:0042532 negative regulation of tyrosine phosphorylation of STAT protein
2. P GO:0000800 lateral element
2. P GO:0031267 small GTPase binding
2. P GO:0060271 cilium assembly
2. P GO:1902426 deactivation of mitotic spindle assembly checkpoint
2. P GO:0005813 centrosome
2. P GO:0000795 synaptonemal complex
2. P GO:0000137 Golgi cis cisterna
2. P GO:0099010 modification of postsynaptic structure
2. P GO:0001669 acrosomal vesicle
2. P GO:0005801 cis-Golgi network
2. P GO:0000139 Golgi membrane
2. P GO:0051220 cytoplasmic sequestering of protein
2. P GO:0042770 signal transduction in response to DNA damage
2. P GO:0000077 DNA damage checkpoint signaling
2. P GO:0019905 syntaxin binding
2. P GO:0042802 identical protein binding
2. P GO:0005635 nuclear envelope
2. P GO:0071439 clathrin complex
2. P GO:0005654 nucleoplasm
2. P GO:1902902 negative regulation of autophagosome assembly
3. B GO:0071711 basement membrane organization
3. B GO:0007411 axon guidance
3. B GO:0009408 response to heat
3. B GO:0001764 neuron migration
3. B GO:0007414 axonal defasciculation
3. B GO:0016477 cell migration
3. B GO:0043001 Golgi to plasma membrane protein transport
3. B GO:0009888 tissue development
3. B GO:0051788 response to misfolded protein
3. B GO:0005201 extracellular matrix structural constituent
3. B GO:0005604 basement membrane
3. B GO:0042127 regulation of cell population proliferation
3. B GO:0000003 reproduction
3. B GO:0040017 positive regulation of locomotion
3. B GO:0007155 cell adhesion
3. B GO:0034976 response to endoplasmic reticulum stress
3. B GO:0010950 positive regulation of endopeptidase activity
3. B GO:0009887 animal organ morphogenesis

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q8NB25 Protein FAM184A 8.71e-10 7.92e-16 2.33e-71
1. PB Q0KK56 Protein FAM184B 1.06e-10 2.29e-14 0.0
1. PB Q9ULE4 Protein FAM184B 0 9.96e-162 0.0
2. P P21249 Major antigen 7.68e-05 9.17e-03 NA
2. P Q5T655 Cilia- and flagella-associated protein 58 2.94e-08 1.76e-04 NA
2. P Q08379 Golgin subfamily A member 2 1.09e-07 1.17e-03 NA
2. P Q62209 Synaptonemal complex protein 1 1.80e-07 2.29e-05 NA
2. P D3YZP9 Coiled-coil domain-containing protein 6 1.44e-04 4.83e-04 NA
2. P Q8CHW5 BICD family-like cargo adapter 2 7.50e-08 2.36e-02 NA
2. P Q9M8T5 WEB family protein At3g02930, chloroplastic 7.23e-08 4.02e-03 NA
2. P Q9CW79 Golgin subfamily A member 1 7.28e-07 2.21e-05 NA
2. P Q4KLY0 Centrosomal protein of 63 kDa 2.69e-07 6.79e-03 NA
2. P P61430 Synaptonemal complex protein 2 8.31e-09 1.26e-06 NA
2. P Q60563 Synaptonemal complex protein 1 (Fragment) 4.70e-08 1.56e-02 NA
2. P C5DLA5 SWI5-dependent HO expression protein 3 4.06e-03 5.23e-03 NA
2. P B9V5F5 Centrosomal protein of 63 kDa-A 5.35e-09 1.05e-02 NA
2. P Q6ZU80 Centrosomal protein of 128 kDa 1.66e-05 2.85e-02 NA
2. P Q9WTX8 Mitotic spindle assembly checkpoint protein MAD1 6.85e-03 5.00e-02 NA
2. P Q5M9N0 Coiled-coil domain-containing protein 158 5.12e-07 7.79e-04 NA
2. P Q96NL6 Sodium channel and clathrin linker 1 3.04e-09 1.16e-03 NA
2. P Q6ZUS5 Coiled-coil domain-containing protein 121 1.61e-05 4.67e-02 NA
2. P Q6NZK5 Protein hinderin 5.56e-02 8.80e-03 NA
2. P A6NCC3 Golgin subfamily A member 8O 1.22e-04 1.31e-02 NA
2. P Q6DIX6 BICD family-like cargo adapter 2 6.66e-08 3.57e-04 NA
2. P Q15643 Thyroid receptor-interacting protein 11 2.16e-04 3.47e-03 NA
2. P Q62839 Golgin subfamily A member 2 7.75e-07 3.26e-04 NA
2. P Q96KP6 TNFAIP3-interacting protein 3 2.48e-04 7.37e-04 NA
2. P Q7YS99 Optineurin 3.04e-05 3.18e-02 NA
2. P F4K1B4 Nuclear envelope-associated protein 2 6.12e-05 3.84e-02 NA
2. P Q15431 Synaptonemal complex protein 1 3.27e-07 2.55e-02 NA
2. P F1R4Y7 Centrosomal protein of 83 kDa 2.55e-08 6.38e-04 NA
2. P Q7FAD5 Synaptonemal complex protein ZEP1 5.49e-06 1.81e-04 NA
2. P Q9Z221 Polyamine-modulated factor 1-binding protein 1 1.27e-08 2.55e-02 NA
2. P Q9LME2 Synaptonemal complex protein 1 6.77e-09 8.25e-07 NA
2. P Q5R8V1 Protein CASP 4.32e-07 3.37e-02 NA
2. P Q9C9N6 Protein PLASTID MOVEMENT IMPAIRED 2 9.53e-07 8.60e-04 NA
2. P Q6FY25 Spindle pole body component 110 5.83e-07 1.14e-02 NA
2. P Q9LS42 Protein CASP 8.60e-06 8.27e-03 NA
2. P A2BDR7 Cilia- and flagella-associated protein 157 4.52e-05 5.63e-03 NA
2. P Q9D5R3 Centrosomal protein of 83 kDa 4.00e-10 1.96e-05 NA
2. P Q498G2 Centrosomal protein of 152 kDa 8.92e-07 4.52e-05 NA
2. P Q92805 Golgin subfamily A member 1 2.54e-07 1.85e-04 NA
2. P Q6CRH4 SWI5-dependent HO expression protein 3 5.30e-04 8.99e-04 NA
2. P Q8CDI6 Coiled-coil domain-containing protein 158 1.16e-06 3.94e-03 NA
2. P Q9FLH0 Protein CROWDED NUCLEI 4 2.36e-05 2.91e-04 NA
2. P A0A125S9M6 Cytotardin 6.43e-07 1.48e-02 NA
2. P I6L899 Golgin subfamily A member 8R 1.44e-04 1.56e-02 NA
2. P Q8S2T0 Protein GRIP 3.46e-06 3.25e-03 NA
2. P F8WBI6 Golgin subfamily A member 8N 4.39e-04 9.75e-03 NA
2. P B1AJZ9 Forkhead-associated domain-containing protein 1 1.79e-04 1.82e-02 NA
2. P Q9QYP6 5-azacytidine-induced protein 2 1.10e-02 4.11e-02 NA
2. P H3BV12 Golgin subfamily A member 8Q 8.85e-04 2.31e-02 NA
2. P Q6PGZ0 Centrosomal protein of 63 kDa 1.61e-06 1.81e-04 NA
2. P A8HUA1 Cilia- and flagella-associated protein 58 8.06e-10 3.15e-04 NA
2. P Q9SAF6 Protein CROWDED NUCLEI 2 2.51e-08 1.14e-03 NA
2. P P0CK98 Coiled-coil domain-containing protein 39 3.47e-10 5.02e-03 NA
2. P Q95XR4 Ectopic P granules protein 2 4.04e-10 3.45e-04 NA
2. P C5DY19 Spindle pole body component 110 1.18e-09 8.02e-03 NA
2. P Q4KMA0 5-azacytidine-induced protein 2 4.35e-03 2.63e-03 NA
2. P Q9Y6D9 Mitotic spindle assembly checkpoint protein MAD1 7.96e-08 7.38e-03 NA
2. P Q96CN9 GRIP and coiled-coil domain-containing protein 1 1.52e-08 4.71e-03 NA
2. P Q17QT2 Microtubule-associated tumor suppressor 1 homolog 4.24e-05 3.91e-04 NA
2. P Q8NCX0 Coiled-coil domain-containing protein 150 4.17e-07 1.98e-04 NA
2. P Q8N0S2 Synaptonemal complex central element protein 1 4.63e-04 2.90e-03 NA
2. P Q9CS72 Filamin-A-interacting protein 1 8.16e-06 4.85e-02 NA
2. P Q5NVN6 Centrosomal protein of 63 kDa 1.27e-08 9.96e-03 NA
2. P Q9Y592 Centrosomal protein of 83 kDa 2.56e-05 3.34e-04 NA
2. P Q32LM7 Coiled-coil domain-containing protein 152 2.53e-05 2.66e-06 NA
2. P O31700 Sporulation protein cse15 2.44e-05 9.02e-07 NA
2. P Q66H89 Centrosomal protein of 83 kDa 3.65e-05 4.91e-05 NA
2. P Q8WXW3 Progesterone-induced-blocking factor 1 1.43e-09 6.51e-05 NA
2. P Q13948 Protein CASP 4.70e-07 3.03e-02 NA
2. P F4HRT5 Protein CROWDED NUCLEI 1 2.29e-04 1.78e-02 NA
2. P Q921M4 Golgin subfamily A member 2 4.40e-06 2.29e-03 NA
2. P A1A5D9 BICD family-like cargo adapter 2 1.59e-07 1.21e-03 NA
2. P Q9UTJ3 Meiotic expression up-regulated protein 1/2 2.73e-07 5.33e-05 NA
2. P P61584 Rho-associated protein kinase 1 (Fragment) 1.30e-07 3.34e-04 NA
3. B Q21313 Laminin-like protein epi-1 NA NA 0.002
3. B Q75AF5 Golgin IMH1 7.09e-06 NA 0.009