Summary

Q9ULN7

Homolog: A0A1B0GUJ8.
Function: Paraneoplastic antigen-like protein 8C.

Statistics

Total GO Annotation: 39
Unique PROST Go: 24
Unique BLAST Go: 15

Total Homologs: 49
Unique PROST Homologs: 24
Unique BLAST Homologs: 21

Structures and Sequence Alignment

The best structural homolog that predicted by 3. B was A0A1B0GUJ8 (Paraneoplastic antigen-like protein 8C) with a FATCAT P-Value: 0.000182 and RMSD of 2.42 angstrom. The sequence alignment identity is 10.7%.
Structural alignment shown in left. Query protein Q9ULN7 colored as red in alignment, homolog A0A1B0GUJ8 colored as blue. Query protein Q9ULN7 is also shown in right top, homolog A0A1B0GUJ8 showed in right bottom. They are colored based on secondary structures. 

      Q9ULN7 MA-----MSLLQDWCRSLDVDAHRALLVTGIPEGLEQADVEAVLQ-PTLLPLGTFRLRHMKA-LMNEKAQAALVEFVEDVNHAAIPREIPGKDGVWRVLW 93
  A0A1B0GUJ8 MLFGVKDIALLEHGCKALEVDSYKSLMILGIPEDCNHEEFEEIIRLP-LKPLGKFEV-AGKAYLEEDKSKAAIIQLTEDINYAVVPREIKGKGGVWRVVY 98

      Q9ULN7 KDRAQD----T----------RVLRQMRRLLLDD------GPTQ--AAEAGTPGEAPTPPASET-QAQ-----DSGEVTGQAGSLLGAARNPRRG-RRGR 164
  A0A1B0GUJ8 MPRKQDIEFLTKLNLFLQSEGRTVEDMARVLRQELCPPATGPRELPARKCSVPGLGEKPEAGATVQMDVVPPLDSSEKESKAG--VG-----KRGKRKNK 191

      Q9ULN7 RNRTRRNRLTQKGKKRSRGGRPSAPARSEAEDSSDESLGIVIEEIDQGDLSGEEDQSALYATLQAAARELVRQWAPCNSEGEEDGPREFLALVTVTDKSK 264
  A0A1B0GUJ8 KNR-RRHHASDK-KL------------------------------------------------------------------------------------- 204

      Q9ULN7 KEEAEKEPAGAESIRLNTKEDKNGVPDLVALLAVRDTPDEEPVDSDTSESDSQESGDQETEELDNPEFVAIVAYTDPSDPWAREEMLKIASVIESLGWSD 364
  A0A1B0GUJ8 ---------------------------------------------------------------------------------------------------- 204

      Q9ULN7 EKDKRDPLRQVLSVMSKDTNGTRVKVEEAGREVDAVVLRKAGDDGDLRECISTLAQPDLPPQAKKAGRGLFGGWSEHREDEGGLLELVALLAAQDMAEVM 464
  A0A1B0GUJ8 ---------------------------------------------------------------------------------------------------- 204

      Q9ULN7 KEEKENAWEGGKYKYPKGKLGEVLALLAARENMGSNEGSEEASDEQSEEESEDTESEASEPEDRASRKPRAKRARTAPRGLTPAGAPPTASGARKTRAGG 564
  A0A1B0GUJ8 ---------------------------------------------------------------------------------------------------- 204

      Q9ULN7 RGRGRGVTPEKKAGSRGSAQDDAAGSRKKKGSAGAGAHARAGEAKGQAPTGSKAARGKKARRGRRLPPKCR 635
  A0A1B0GUJ8 ----------------------------------------------------------------------- 204

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0097340 inhibition of cysteine-type endopeptidase activity
2. P GO:0003714 transcription corepressor activity
2. P GO:0080111 DNA demethylation
2. P GO:0060966 regulation of gene silencing by RNA
2. P GO:0016458 obsolete gene silencing
2. P GO:0005634 nucleus
2. P GO:0010859 calcium-dependent cysteine-type endopeptidase inhibitor activity
2. P GO:0010923 negative regulation of phosphatase activity
2. P GO:0005700 polytene chromosome
2. P GO:0004864 protein phosphatase inhibitor activity
2. P GO:0019901 protein kinase binding
2. P GO:0031588 nucleotide-activated protein kinase complex
2. P GO:0031047 gene silencing by RNA
2. P GO:0003677 DNA binding
2. P GO:0007283 spermatogenesis
2. P GO:0043086 negative regulation of catalytic activity
2. P GO:0019212 phosphatase inhibitor activity
2. P GO:0000750 pheromone-dependent signal transduction involved in conjugation with cellular fusion
2. P GO:0048477 oogenesis
2. P GO:0003727 single-stranded RNA binding
2. P GO:1901535 regulation of DNA demethylation
2. P GO:0007165 signal transduction
2. P GO:0030163 protein catabolic process
2. P GO:0080090 regulation of primary metabolic process
3. B GO:0031625 ubiquitin protein ligase binding
3. B GO:0090200 positive regulation of release of cytochrome c from mitochondria
3. B GO:0008625 extrinsic apoptotic signaling pathway via death domain receptors
3. B GO:0005829 cytosol
3. B GO:0005741 mitochondrial outer membrane
3. B GO:0097192 extrinsic apoptotic signaling pathway in absence of ligand
3. B GO:0005730 nucleolus
3. B GO:0097190 apoptotic signaling pathway
3. B GO:0042981 regulation of apoptotic process
3. B GO:0001844 protein insertion into mitochondrial membrane involved in apoptotic signaling pathway
3. B GO:0002437 inflammatory response to antigenic stimulus
3. B GO:0008630 intrinsic apoptotic signaling pathway in response to DNA damage
3. B GO:0043065 positive regulation of apoptotic process
3. B GO:0005654 nucleoplasm
3. B GO:0003676 nucleic acid binding

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q86V59 Paraneoplastic antigen-like protein 8A 1.61e-01 7.95e-04 2.24e-28
1. PB Q5R6R8 Paraneoplastic antigen-like protein 8A 6.37e-02 5.98e-07 2.28e-28
1. PB Q9ULN7 Paraneoplastic antigen-like protein 8B 0 1.14e-145 0.0
1. PB Q80VM8 Paraneoplastic antigen-like protein 8A 3.70e-03 6.64e-05 1.63e-28
2. P Q01030 Uncharacterized gene 45 protein NA 1.19e-02 NA
2. P B3LP25 Signal transduction protein MDG1 6.15e-01 3.26e-02 NA
2. P B3LSR0 Cruciform DNA-recognizing protein 1 2.52e-01 1.42e-02 NA
2. P E7LVH4 Cruciform DNA-recognizing protein 1 NA 2.06e-02 NA
2. P Q9U3V8 Protein xmas-1 5.08e-01 4.82e-03 NA
2. P Q9FGT1 Protein REPRESSOR OF SILENCING 3 2.13e-01 8.21e-05 NA
2. P A6ZT54 Cruciform DNA-recognizing protein 1 1.21e-01 4.87e-03 NA
2. P Q5UR75 Uncharacterized protein R627 NA 9.47e-03 NA
2. P E7KDM2 Cruciform DNA-recognizing protein 1 2.61e-01 1.82e-02 NA
2. P E7NIP0 Cruciform DNA-recognizing protein 1 2.19e-01 2.10e-02 NA
2. P Q9UTG3 Uncharacterized protein C1805.14 8.07e-02 9.66e-03 NA
2. P P53885 Signal transduction protein MDG1 4.00e-01 2.14e-02 NA
2. P E7Q4T7 Cruciform DNA-recognizing protein 1 NA 3.29e-02 NA
2. P P18593 Protein VirD3 2.10e-01 3.35e-04 NA
2. P Q9VWD4 Probable RNA-binding protein CG14230 3.09e-01 2.82e-03 NA
2. P A6ZRR2 Signal transduction protein MDG1 4.47e-01 2.78e-02 NA
2. P Q9W148 Unconventional prefoldin RPB5 interactor-like protein 5.78e-01 3.36e-02 NA
2. P C7GTE8 Signal transduction protein MDG1 2.79e-01 5.54e-03 NA
2. P P38845 Cruciform DNA-recognizing protein 1 6.83e-01 4.87e-03 NA
2. P C8Z9U3 Cruciform DNA-recognizing protein 1 2.76e-01 9.85e-03 NA
2. P C7GJZ2 Cruciform DNA-recognizing protein 1 1.79e-01 1.86e-02 NA
2. P E7KPJ0 Cruciform DNA-recognizing protein 1 7.62e-01 9.85e-03 NA
2. P P12675 Calpastatin 7.80e-01 4.75e-02 NA
2. P C8ZG55 Signal transduction protein MDG1 4.46e-01 2.14e-02 NA
3. B Q95KI4 Modulator of apoptosis 1 2.27e-02 NA 2.24e-18
3. B Q8ND90 Paraneoplastic antigen Ma1 4.09e-02 NA 1.64e-22
3. B Q5DTT8 Paraneoplastic antigen-like protein 5 2.99e-03 NA 2.33e-14
3. B Q8VHZ4 Paraneoplastic antigen Ma1 homolog 1.88e-02 NA 7.91e-20
3. B Q9UL42 Paraneoplastic antigen Ma2 9.48e-03 NA 5.94e-24
3. B Q9GMU3 Paraneoplastic antigen Ma2 homolog 7.04e-03 NA 1.08e-23
3. B A7E321 Paraneoplastic antigen-like protein 8A 2.57e-02 NA 1.18e-26
3. B A0A0J9YX94 Paraneoplastic antigen Ma6F 5.62e-03 NA 2.37e-14
3. B A0A1B0GUJ8 Paraneoplastic antigen-like protein 8C 1.82e-04 NA 2.82e-23
3. B Q9ERH6 Modulator of apoptosis 1 2.36e-02 NA 1.12e-16
3. B A6QLK5 Paraneoplastic antigen Ma1 homolog 3.08e-02 NA 2.25e-21
3. B Q8BHK0 Paraneoplastic antigen Ma2 homolog 1.17e-02 NA 2.06e-18
3. B Q5R486 Paraneoplastic antigen Ma2 homolog 1.25e-02 NA 4.31e-23
3. B Q96PV4 Paraneoplastic antigen-like protein 5 5.45e-03 NA 1.75e-17
3. B Q2KIT6 Paraneoplastic antigen Ma2 homolog 1.03e-02 NA 1.71e-19
3. B A0A0J9YXQ4 Paraneoplastic antigen Ma6E 2.16e-03 NA 6.67e-15
3. B Q96BY2 Modulator of apoptosis 1 4.12e-03 NA 1.78e-18
3. B Q9UL41 Paraneoplastic antigen Ma3 2.15e-02 NA 1.42e-17
3. B P0CW24 Paraneoplastic antigen-like protein 6A 3.07e-03 NA 1.46e-16
3. B Q8C1C8 Paraneoplastic antigen Ma1 homolog 4.00e-02 NA 1.79e-19
3. B Q8JZW8 Paraneoplastic antigen Ma3 homolog 9.71e-02 NA 5.86e-15