Summary

Q9UNZ5

Homolog: Q5REM2.
Function: Leydig cell tumor 10 kDa protein homolog.

Statistics

Total GO Annotation: 23
Unique PROST Go: 23
Unique BLAST Go: 0

Total Homologs: 84
Unique PROST Homologs: 77
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q5REM2 (Leydig cell tumor 10 kDa protein homolog) with a FATCAT P-Value: 1.57e-12 and RMSD of 1.49 angstrom. The sequence alignment identity is 97.0%.
Structural alignment shown in left. Query protein Q9UNZ5 colored as red in alignment, homolog Q5REM2 colored as blue. Query protein Q9UNZ5 is also shown in right top, homolog Q5REM2 showed in right bottom. They are colored based on secondary structures. 

  Q9UNZ5 MAQGQRKFQAHKPAKSKTAAAASEKNRGPRKGGRVIAPKKARVVQQQKLKKNLEVGIRKKIEHDVVMKASSSLPKKLALLKAPAKKKGAAAATSSKTPS 99
  Q5REM2 MAQGQRKFQARKPAKSKTAATASEKNRGPRKGGRVIAPKKARVVQQQKLKKNLEVGIRKKIEHDVVMKASSSLPKRLALLKAPAKKKGAAAATSSKTPS 99

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0019985 translesion synthesis
2. P GO:0007566 embryo implantation
2. P GO:0019898 extrinsic component of membrane
2. P GO:0015934 large ribosomal subunit
2. P GO:0042788 polysomal ribosome
2. P GO:0008201 heparin binding
2. P GO:0022627 cytosolic small ribosomal subunit
2. P GO:0008283 cell population proliferation
2. P GO:0007098 centrosome cycle
2. P GO:0032780 negative regulation of ATP-dependent activity
2. P GO:0000027 ribosomal large subunit assembly
2. P GO:0042030 ATPase inhibitor activity
2. P GO:0003735 structural constituent of ribosome
2. P GO:0005840 ribosome
2. P GO:0022625 cytosolic large ribosomal subunit
2. P GO:0005730 nucleolus
2. P GO:0031589 cell-substrate adhesion
2. P GO:0006412 translation
2. P GO:0019843 rRNA binding
2. P GO:0035264 multicellular organism growth
2. P GO:0098556 cytoplasmic side of rough endoplasmic reticulum membrane
2. P GO:0002181 cytoplasmic translation
2. P GO:0022626 cytosolic ribosome

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q4WK56 UPF0390 protein AFUA_1G03640 1.55e-02 1.06e-15 3.19e-04
1. PB Q05310 Leydig cell tumor 10 kDa protein 1.34e-10 6.25e-48 1.20e-44
1. PB Q24JV4 UPF0390 protein zgc136864 1.11e-05 6.08e-35 9.32e-28
1. PB Q8R1F0 Leydig cell tumor 10 kDa protein homolog 9.09e-07 6.15e-36 2.35e-43
1. PB Q148I0 Leydig cell tumor 10 kDa protein homolog 1.55e-04 3.56e-43 5.02e-42
1. PB Q9UNZ5 Leydig cell tumor 10 kDa protein homolog 0 6.39e-120 5.81e-63
1. PB Q5REM2 Leydig cell tumor 10 kDa protein homolog 1.57e-12 4.20e-89 7.52e-61
2. P B7I694 50S ribosomal protein L20 1.68e-02 4.91e-02 NA
2. P Q92366 60S ribosomal protein L29 7.79e-02 5.14e-07 NA
2. P Q6NIC4 50S ribosomal protein L32 2.09e-01 1.66e-03 NA
2. P A5U121 50S ribosomal protein L32 2.04e-01 5.10e-03 NA
2. P Q9P7I8 UPF0390 protein C24B10.18 2.00e-04 5.33e-10 NA
2. P Q6B934 50S ribosomal protein L32, chloroplastic 1.04e-03 1.14e-03 NA
2. P A3Q5M0 50S ribosomal protein L32 2.21e-01 1.55e-03 NA
2. P P9WH99 50S ribosomal protein L32 2.23e-01 5.10e-03 NA
2. P Q8HXB8 60S ribosomal protein L29 3.59e-02 3.03e-03 NA
2. P O14455 60S ribosomal protein L36-B 2.08e-01 3.07e-02 NA
2. P Q6A5U5 50S ribosomal protein L32 2.11e-01 2.82e-02 NA
2. P Q9CQX4 PCNA-associated factor 3.18e-01 9.63e-03 NA
2. P A1UL71 50S ribosomal protein L32 2.17e-01 1.55e-03 NA
2. P C1ALW8 50S ribosomal protein L32 2.18e-01 5.10e-03 NA
2. P P25886 60S ribosomal protein L29 7.71e-02 3.88e-03 NA
2. P Q2J454 50S ribosomal protein L20 1.18e-02 4.11e-02 NA
2. P Q55AQ9 60S ribosomal protein L36 6.12e-02 2.00e-03 NA
2. P Q58DW3 60S ribosomal protein L29 1.62e-02 4.10e-04 NA
2. P Q24154 60S ribosomal protein L29 2.72e-02 3.79e-09 NA
2. P A0QBQ8 50S ribosomal protein L32 2.09e-01 4.47e-02 NA
2. P A4QCL5 50S ribosomal protein L32 2.02e-01 1.02e-02 NA
2. P P0DJ21 60S ribosomal protein L29 3.19e-01 1.49e-07 NA
2. P P54573 Uncharacterized protein YqkK 3.74e-01 3.94e-02 NA
2. P Q3E747 Uncharacterized protein YLR363W-A 1.94e-02 1.25e-06 NA
2. P P9WH98 50S ribosomal protein L32 2.04e-01 5.10e-03 NA
2. P B1XV11 50S ribosomal protein L20 1.67e-02 4.67e-02 NA
2. P B7GZZ9 50S ribosomal protein L20 1.68e-02 4.91e-02 NA
2. P Q1B3X7 50S ribosomal protein L32 2.22e-01 1.55e-03 NA
2. P B8ZU08 50S ribosomal protein L32 2.18e-01 2.94e-04 NA
2. P B0VV91 50S ribosomal protein L20 1.38e-02 3.65e-02 NA
2. P Q556Y1 40S ribosomal protein S30 1.45e-01 1.09e-05 NA
2. P O97965 Spermatid nuclear transition protein 3 6.15e-04 2.35e-04 NA
2. P Q85G60 50S ribosomal protein L32, chloroplastic 2.39e-04 3.48e-03 NA
2. P E9PRG8 Uncharacterized protein C11orf98 2.96e-02 1.17e-06 NA
2. P P0CS21 UPF0390 protein CNBD1430 1.63e-03 2.57e-14 NA
2. P B3Q5X2 50S ribosomal protein L20 1.22e-02 3.21e-02 NA
2. P A1KHB5 50S ribosomal protein L32 2.24e-01 5.10e-03 NA
2. P Q4P7C7 UPF0390 protein UM03986 1.68e-03 2.50e-07 NA
2. P O14181 54S ribosomal protein L28, mitochondrial 8.54e-05 5.99e-03 NA
2. P A6L7J5 50S ribosomal protein L20 1.12e-02 1.68e-02 NA
2. P Q8FR20 50S ribosomal protein L32 2.29e-01 3.47e-02 NA
2. P P09940 ATPase inhibitor, mitochondrial NA 2.70e-02 NA
2. P Q91FH8 Uncharacterized protein 346R NA 3.50e-02 NA
2. P B1VFG5 50S ribosomal protein L32 2.23e-01 8.77e-05 NA
2. P P0A5V9 50S ribosomal protein L32 2.15e-01 5.10e-03 NA
2. P P05747 60S ribosomal protein L29 5.71e-02 2.50e-02 NA
2. P Q0S4Y6 50S ribosomal protein L32 1.84e-01 8.21e-03 NA
2. P A3M2A4 50S ribosomal protein L20 1.38e-02 4.91e-02 NA
2. P Q9CD69 50S ribosomal protein L32 2.20e-01 2.94e-04 NA
2. P P47440 50S ribosomal protein L20 1.69e-02 3.68e-02 NA
2. P P47834 60S ribosomal protein L36 1.21e-01 1.96e-02 NA
2. P Q0VG62 Ribosomal biogenesis factor 1.46e-03 6.49e-08 NA
2. P B2HEB1 50S ribosomal protein L32 2.17e-01 1.91e-05 NA
2. P A0PWB5 50S ribosomal protein L32 2.08e-01 3.89e-05 NA
2. P B2HTH6 50S ribosomal protein L20 1.72e-02 4.91e-02 NA
2. P Q3E7B7 SERF-like protein YDL085C-A 7.88e-04 4.32e-02 NA
2. P P47915 60S ribosomal protein L29 5.14e-02 1.68e-02 NA
2. P Q21C63 50S ribosomal protein L20 1.46e-02 8.58e-03 NA
2. P P49689 40S ribosomal protein S30 2.61e-01 5.99e-03 NA
2. P C4LHF5 50S ribosomal protein L32 1.96e-01 1.55e-03 NA
2. P B3DFA5 50S ribosomal protein L32 7.74e-04 5.00e-03 NA
2. P P0CS20 UPF0390 protein CND04920 3.49e-04 2.57e-14 NA
2. P Q742C2 50S ribosomal protein L32 2.02e-01 1.77e-02 NA
2. P Q6NDR6 50S ribosomal protein L20 1.22e-02 3.21e-02 NA
2. P A1TEL8 50S ribosomal protein L32 2.05e-01 1.95e-02 NA
2. P Q4SUE2 Translation machinery-associated protein 7 2.12e-03 4.59e-02 NA
2. P P47914 60S ribosomal protein L29 3.11e-02 4.22e-04 NA
2. P Q54TW3 60S ribosomal protein L29 7.73e-02 3.01e-12 NA
2. P A4SX36 50S ribosomal protein L20 1.73e-02 2.46e-02 NA
2. P Q8KAM7 50S ribosomal protein L20 1.46e-02 3.00e-02 NA
2. P Q9D937 Uncharacterized protein C11orf98 homolog 1.47e-02 5.08e-08 NA
2. P Q6F868 50S ribosomal protein L20 1.69e-02 4.91e-02 NA
2. P Q95281 60S ribosomal protein L29 1.55e-02 5.48e-03 NA
2. P Q0P3P5 50S ribosomal protein L32, chloroplastic 1.35e-03 3.29e-02 NA
2. P B0V5Q9 50S ribosomal protein L20 1.69e-02 4.91e-02 NA
2. P Q4JU01 50S ribosomal protein L32 2.25e-01 8.21e-03 NA
2. P Q8NS11 50S ribosomal protein L32 2.21e-01 1.02e-02 NA