Summary

Q9Y2D5

Homolog: Q5U301.
Function: A-kinase anchor protein 2.

Statistics

Total GO Annotation: 146
Unique PROST Go: 127
Unique BLAST Go: 8

Total Homologs: 62
Unique PROST Homologs: 58
Unique BLAST Homologs: 1

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q5U301 (A-kinase anchor protein 2) with a FATCAT P-Value: 3.22e-07 and RMSD of 8.79 angstrom. The sequence alignment identity is 84.4%.
Structural alignment shown in left. Query protein Q9Y2D5 colored as red in alignment, homolog Q5U301 colored as blue. Query protein Q9Y2D5 is also shown in right top, homolog Q5U301 showed in right bottom. They are colored based on secondary structures. 

  Q9Y2D5 MEIEVSVAECKSVPGITSTPHPMDHPSAFYSPPHNGLLTDHHESLDNDVAREIRYLDEVLEANCCDSAVDGTYNGTSSPEPGAVVLVGGLSPPVHEATQP 100
  Q5U301 MEIGVSVAECKSVPGITSTPHSKDHSSPFYSPSHNGLLTDHHESLDNDVAREIQYLDEVLEANCCDSSVDGTYNGISSPEPGAAILVSSLGSPAHSATKV 100

  Q9Y2D5 EPTERTASRQAPPHIELSNSSPDPMAEAERTNGHSPSQPRDALGDSLQVPVSPSSTTSSRCSSRDGEFTLTTLKKEAKFELRAFHEDKKPSKLFEDDEHE 200
  Q5U301 EPIEKASGRQLPPHIELSRSPSDSMAEGERANGHSTDQPQDMLGNSLQAPASPSSSTSSHCSSRDGEFTLTTLKKEAKFELRAFHEDKKPSKLFEEDEHE 200

  Q9Y2D5 KEQYCIRKVRPSEEMLELEKERRELIRSQAVKKNPGIAAKWWNPPQEKTIEEQLDEEHLESHKKYKERKERRAQQEQLLLQ----------KQLQQQQQQ 290
  Q5U301 KEQFCIRKVRPSEEMIELEKERRELIRSQAVKKNPGIAAKWWNPPQKKTIEEQLDEEHLESHRKYKERKEKRAQQEQLQLQQQQQQQLQQLQQLQQQQQQ 300

  Q9Y2D5 --PPSQLCTAPASSHERASMIDKAKEDIVTEQIDFSAARKQFQLMENSRQAVAKGQSTPRLFSIKPFYRPLGSVNSDKPLTNPRPPSVGGPPEDSGASAA 388
  Q5U301 QLSTSQLCTAPA-AHEHLDSIEHTKEDVVTEQIDFSAARKQFQQMENSRQTLAKGQSTPRLFSIKPFYKPLGSINSDKPPTILRPATIGGTVEDSSTQAA 399

  Q9Y2D5 KGQKSPGAL---ETPSA-AGSQGNTASQGKEGPYSEPSKRGPLSKLWAEDGEFTSARAVLTVVKDDDHGILDQFSRSVNVSLTQEELDSGLDELSVRSQD 484
  Q5U301 KEQK---ALCVSESQSAGAGT-GNAATQGKEGPYSEPSKRGPLSKLWAEDGEFTSARAVLTVVKDEDHGILDQFSRSVNVSLTQEELDSGLDELSVRSQD 495

  Q9Y2D5 TTVLETLSNDFSMDNISDSGASNETTNALQENSLADFSLPQTPQTDNPSEGRGEGVSKSFSDHGFYSPSSTLGDSPLVDDPLEYQAGLLVQNAIQQAIAE 584
  Q5U301 TTVLETLSNDFSMDNISDSGASNETPNALQENSLADFSLPQTPQTDNPSEGR-EGVSKSFSDHGFYSPSSTLGDSPSVDDPLEYQAGLLVQNAIQQAIAE 594

  Q9Y2D5 QVDKAVSKTSRDGAEQQGPEATVEEAEAAAFGSEKPQSMFEPPQVSSPVQEKRDVLPKILPAEDRALRERGPPQPLP-AVQPSGPINMEETRPEGSYFSK 683
  Q5U301 QVDKAEVHTSKEGSEQQEPGAMVEEAGSQAPGSEKPQGMFAPPQVSSPVQEKRDVLPKILPGEDKTLREKGPSQP-PTAVQPSGPVNMKETRPEGGYFSK 693

  Q9Y2D5 YSEAAELRSTASLLATQESDVMVGPFKLRSRKQRTLSMIEEEIRAAQEREEELKRQRQVLQSTQSPRTKNAPSLPSR-TCYKTAPGKIEKVKPPPSPTTE 782
  Q5U301 YSEAAELRSTASLLATQESDVMVGPFKLRSRKQRTLSMIEEEIRAAQEREEELKRQRQVRQSTPSPRAQNAPSLPSRTTCYKTAPGKIEKVKPPPSPTTE 793

  Q9Y2D5 GPSLQPDLAPEEAAGTQRPKNLMQTLMEDYETHKSKRRERMDDSSVLEATRVNRRKSALALRWEAGIYANQEEEDNE 859
  Q5U301 GPSLQPDLAPEEAAGAQRPKNLMQTLMEDYETHKSKRRERMDDSSVLEATRVNRRKSALALRWEAGIYANQEEEDNE 870

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0051015 actin filament binding
1. PB GO:0007015 actin filament organization
1. PB GO:0051660 establishment of centrosome localization
1. PB GO:0090307 mitotic spindle assembly
1. PB GO:0000132 establishment of mitotic spindle orientation
1. PB GO:0005884 actin filament
1. PB GO:1904776 regulation of protein localization to cell cortex
1. PB GO:0051018 protein kinase A binding
1. PB GO:0031616 spindle pole centrosome
1. PB GO:0051640 organelle localization
1. PB GO:0007178 transmembrane receptor protein serine/threonine kinase signaling pathway
2. P GO:0016055 Wnt signaling pathway
2. P GO:0043296 apical junction complex
2. P GO:0071539 protein localization to centrosome
2. P GO:0045945 positive regulation of transcription by RNA polymerase III
2. P GO:0043229 intracellular organelle
2. P GO:0035327
2. P GO:0016242 negative regulation of macroautophagy
2. P GO:0071962 mitotic sister chromatid cohesion, centromeric
2. P GO:0006281 DNA repair
2. P GO:0051285 cell cortex of cell tip
2. P GO:0032045 guanyl-nucleotide exchange factor complex
2. P GO:0061163 endoplasmic reticulum polarization
2. P GO:0090090 negative regulation of canonical Wnt signaling pathway
2. P GO:0031209 SCAR complex
2. P GO:1990113 RNA polymerase I assembly
2. P GO:0034237 protein kinase A regulatory subunit binding
2. P GO:1903432 regulation of TORC1 signaling
2. P GO:0017108 5'-flap endonuclease activity
2. P GO:0005700 polytene chromosome
2. P GO:0021915 neural tube development
2. P GO:0008023 transcription elongation factor complex
2. P GO:0035363 histone locus body
2. P GO:0071963 establishment or maintenance of cell polarity regulating cell shape
2. P GO:0051177 meiotic sister chromatid cohesion
2. P GO:2000601 positive regulation of Arp2/3 complex-mediated actin nucleation
2. P GO:0005621 cellular bud scar
2. P GO:0042997 negative regulation of Golgi to plasma membrane protein transport
2. P GO:0006310 DNA recombination
2. P GO:0032177 cellular bud neck split septin rings
2. P GO:0032465 regulation of cytokinesis
2. P GO:0097575 lateral cell cortex
2. P GO:0045184 establishment of protein localization
2. P GO:0000183 rDNA heterochromatin assembly
2. P GO:0010977 negative regulation of neuron projection development
2. P GO:1903068 positive regulation of protein localization to cell tip
2. P GO:0030308 negative regulation of cell growth
2. P GO:0042995 cell projection
2. P GO:0005935 cellular bud neck
2. P GO:0019901 protein kinase binding
2. P GO:0032243 negative regulation of nucleoside transport
2. P GO:0030036 actin cytoskeleton organization
2. P GO:0051127 positive regulation of actin nucleation
2. P GO:0032516 positive regulation of phosphoprotein phosphatase activity
2. P GO:0071944 cell periphery
2. P GO:0030057 desmosome
2. P GO:0007120 axial cellular bud site selection
2. P GO:1902486 protein localization to growing cell tip
2. P GO:1905721 mitotic spindle astral microtubule end
2. P GO:0033557 Slx1-Slx4 complex
2. P GO:0010457 centriole-centriole cohesion
2. P GO:0030950 establishment or maintenance of actin cytoskeleton polarity
2. P GO:0006031 chitin biosynthetic process
2. P GO:1903364 positive regulation of cellular protein catabolic process
2. P GO:2001107 negative regulation of Rho guanyl-nucleotide exchange factor activity
2. P GO:0071013 catalytic step 2 spliceosome
2. P GO:0048619 embryonic hindgut morphogenesis
2. P GO:0045159 myosin II binding
2. P GO:0030864 cortical actin cytoskeleton
2. P GO:0000131 incipient cellular bud site
2. P GO:0032007 negative regulation of TOR signaling
2. P GO:0005912 adherens junction
2. P GO:0032133 chromosome passenger complex
2. P GO:0070262 peptidyl-serine dephosphorylation
2. P GO:1903912 negative regulation of endoplasmic reticulum stress-induced eIF2 alpha phosphorylation
2. P GO:0006983 ER overload response
2. P GO:0008608 attachment of spindle microtubules to kinetochore
2. P GO:0015030 Cajal body
2. P GO:0005521 lamin binding
2. P GO:1904864 negative regulation of beta-catenin-TCF complex assembly
2. P GO:0010829 negative regulation of glucose transmembrane transport
2. P GO:0043086 negative regulation of catalytic activity
2. P GO:0051051 negative regulation of transport
2. P GO:0031397 negative regulation of protein ubiquitination
2. P GO:0032126 eisosome
2. P GO:0006260 DNA replication
2. P GO:0033365 protein localization to organelle
2. P GO:0045920 negative regulation of exocytosis
2. P GO:0000779 condensed chromosome, centromeric region
2. P GO:0043631 RNA polyadenylation
2. P GO:1901098 positive regulation of autophagosome maturation
2. P GO:0007099 centriole replication
2. P GO:0046329 negative regulation of JNK cascade
2. P GO:0016604 nuclear body
2. P GO:1900108 negative regulation of nodal signaling pathway
2. P GO:0035839 non-growing cell tip
2. P GO:0019212 phosphatase inhibitor activity
2. P GO:1990115 RNA polymerase III assembly
2. P GO:2000784 positive regulation of establishment of cell polarity regulating cell shape
2. P GO:0110053 regulation of actin filament organization
2. P GO:1990316 Atg1/ULK1 kinase complex
2. P GO:1903898 negative regulation of PERK-mediated unfolded protein response
2. P GO:0035840 old growing cell tip
2. P GO:0045132 meiotic chromosome segregation
2. P GO:0048332 mesoderm morphogenesis
2. P GO:0051523 cell growth mode switching, monopolar to bipolar
2. P GO:0007051 spindle organization
2. P GO:0000775 chromosome, centromeric region
2. P GO:0048566 embryonic digestive tract development
2. P GO:0030178 negative regulation of Wnt signaling pathway
2. P GO:0005828 kinetochore microtubule
2. P GO:0010923 negative regulation of phosphatase activity
2. P GO:1990114 RNA polymerase II core complex assembly
2. P GO:0070097 delta-catenin binding
2. P GO:0042796 snRNA transcription by RNA polymerase III
2. P GO:0061246 establishment or maintenance of bipolar cell polarity regulating cell shape
2. P GO:0070941 eisosome assembly
2. P GO:2000095 regulation of Wnt signaling pathway, planar cell polarity pathway
2. P GO:0051017 actin filament bundle assembly
2. P GO:0005813 centrosome
2. P GO:0045143 homologous chromosome segregation
2. P GO:1903077 negative regulation of protein localization to plasma membrane
2. P GO:0010633 negative regulation of epithelial cell migration
2. P GO:0035371 microtubule plus-end
2. P GO:0042795 snRNA transcription by RNA polymerase II
2. P GO:1903067 negative regulation of protein localization to cell tip
2. P GO:0016607 nuclear speck
2. P GO:0071933 Arp2/3 complex binding
2. P GO:0032174 cellular bud neck septin collar
2. P GO:0000164 protein phosphatase type 1 complex
2. P GO:0000776 kinetochore
2. P GO:0060828 regulation of canonical Wnt signaling pathway
2. P GO:0008093 cytoskeletal anchor activity
2. P GO:1901900 regulation of protein localization to cell division site
2. P GO:0008013 beta-catenin binding
2. P GO:0097248 maintenance of protein location in cell cortex of cell tip
2. P GO:0005654 nucleoplasm
2. P GO:1902902 negative regulation of autophagosome assembly
3. B GO:0032991 protein-containing complex
3. B GO:0019904 protein domain specific binding
3. B GO:0008104 protein localization
3. B GO:0044877 protein-containing complex binding
3. B GO:0016477 cell migration
3. B GO:0043231 intracellular membrane-bounded organelle
3. B GO:0005938 cell cortex
3. B GO:0005925 focal adhesion

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB O54931 A-kinase anchor protein 2 3.00e-04 3.80e-64 0.0
1. PB Q9Y2D5 A-kinase anchor protein 2 0 9.43e-140 0.0
1. PB Q5U301 A-kinase anchor protein 2 3.22e-07 4.95e-71 0.0
2. P C4JJE8 Structure-specific endonuclease subunit SLX4 3.63e-01 1.54e-02 NA
2. P Q8BWS5 G protein-regulated inducer of neurite outgrowth 3 4.98e-01 1.79e-02 NA
2. P C5FSF3 Structure-specific endonuclease subunit SLX4 4.33e-01 2.46e-03 NA
2. P Q5SX79 Protein Shroom1 2.82e-01 2.19e-03 NA
2. P Q673G8 Dapper homolog 2 1.31e-01 1.77e-02 NA
2. P Q759Q5 Shugoshin 4.10e-01 3.80e-04 NA
2. P Q9NYF0 Dapper homolog 1 2.06e-01 7.98e-03 NA
2. P Q66KC9 Dapper 1 1.16e-01 5.41e-03 NA
2. P Q758T8 SWR1-complex protein 3 3.41e-01 4.04e-06 NA
2. P O60132 Tip elongation aberrant protein Tea4 1.71e-01 2.46e-03 NA
2. P Q9H6X5 Uncharacterized protein C19orf44 2.69e-01 3.25e-03 NA
2. P C0S0E2 Structure-specific endonuclease subunit SLX4 3.09e-01 5.68e-03 NA
2. P Q2M2Z5 Centrosomal protein kizuna 3.85e-01 2.47e-04 NA
2. P B8MED8 Structure-specific endonuclease subunit slx4 3.84e-01 2.30e-03 NA
2. P P38283 Inner centromere protein-related protein SLI15 4.66e-02 3.32e-03 NA
2. P Q5RBH3 Mitotic interactor and substrate of PLK1 6.26e-01 6.70e-03 NA
2. P O94497 Uncharacterized serine-rich protein C18E5.07 2.87e-01 1.82e-02 NA
2. P Q5FBB7 Shugoshin 1 2.27e-01 3.13e-02 NA
2. P O35691 Pinin 1.50e-01 2.28e-02 NA
2. P P33306 Protein BCK2 1.87e-01 4.80e-05 NA
2. P B6HBG5 Structure-specific endonuclease subunit slx4 2.84e-01 1.70e-03 NA
2. P Q5R5X0 Pinin 8.61e-02 1.36e-02 NA
2. P C1GAZ3 Structure-specific endonuclease subunit SLX4 5.02e-01 2.93e-02 NA
2. P O74953 Uncharacterized protein C736.07c 9.39e-02 4.92e-06 NA
2. P Q04279 Eisosome protein SEG1 1.67e-01 8.07e-06 NA
2. P Q8QG92 Dapper 1-B 1.60e-01 2.83e-02 NA
2. P Q3UKU1 RNA polymerase II elongation factor ELL2 2.92e-01 2.58e-02 NA
2. P A1CEY6 Structure-specific endonuclease subunit slx4 6.97e-01 2.28e-02 NA
2. P Q922C1 Uncharacterized protein C19orf44 homolog 1.52e-01 1.60e-02 NA
2. P P23508 Colorectal mutant cancer protein 3.41e-01 3.31e-02 NA
2. P Q2M3G4 Protein Shroom1 2.29e-01 6.89e-05 NA
2. P Q9H307 Pinin 7.34e-02 7.60e-03 NA
2. P P42166 Lamina-associated polypeptide 2, isoform alpha 4.62e-01 4.20e-02 NA
2. P Q92681 Regulatory solute carrier protein family 1 member 1 3.86e-01 4.68e-03 NA
2. P Q3UZ18 Little elongation complex subunit 2 3.47e-01 1.72e-02 NA
2. P Q2KHM9 Protein moonraker 2.73e-01 7.04e-03 NA
2. P Q5SWA1 Protein phosphatase 1 regulatory subunit 15B 1.41e-01 4.77e-02 NA
2. P Q3UMB5 Guanine nucleotide exchange protein SMCR8 5.52e-01 4.24e-03 NA
2. P P39523 Uncharacterized protein YMR124W 1.16e-01 9.30e-03 NA
2. P P53858 Protein BNI4 4.16e-01 1.89e-05 NA
2. P Q0DRX6 Cysteine-tryptophan domain-containing zinc finger protein 3 5.15e-02 4.45e-03 NA
2. P A0A140LFM6 Major intrinsically disordered Notch2-binding receptor 1 1.08e-01 1.16e-03 NA
2. P A0JNH1 Centrosomal protein kizuna 3.09e-01 6.03e-03 NA
2. P D3ZJ47 Major intrinsically disordered Notch2-binding receptor 1 6.94e-01 2.08e-02 NA
2. P Q6AXP1 Uncharacterized protein C19orf44 homolog 9.40e-02 2.13e-04 NA
2. P G5EFV3 Regulator of spindle assembly protein 2 9.60e-02 2.55e-05 NA
2. P Q9W148 Unconventional prefoldin RPB5 interactor-like protein 3.18e-01 7.98e-03 NA
2. P O75363 Breast carcinoma-amplified sequence 1 3.66e-01 1.57e-02 NA
2. P Q659A1 Little elongation complex subunit 2 4.27e-01 5.89e-04 NA
2. P P40020 Factor interacting with REF2 3.13e-01 2.09e-05 NA
2. P Q9D279 Mitotic interactor and substrate of PLK1 2.69e-01 3.73e-04 NA
2. P Q75C80 Protein FYV8 3.10e-01 2.20e-02 NA
2. P Q08229 Protein NBA1 6.18e-01 3.76e-02 NA
2. P P54786 Protein ZDS2 1.17e-01 7.04e-03 NA
2. P Q6AWX6 Protein SCAR1 2.68e-01 2.26e-05 NA
2. P Q2U6E8 Structure-specific endonuclease subunit slx4 2.72e-01 1.82e-03 NA
2. P C1H7M6 Structure-specific endonuclease subunit SLX4 1.58e-01 9.39e-03 NA
2. P B8NLN6 Structure-specific endonuclease subunit slx4 4.79e-01 1.65e-03 NA
3. B Q8IVT2 Mitotic interactor and substrate of PLK1 1.95e-01 NA 0.049