Summary

Q9Y2S6

Homolog: A1A4Q4.
Function: Translation machinery-associated protein 7.

Statistics

Total GO Annotation: 20
Unique PROST Go: 19
Unique BLAST Go: 0

Total Homologs: 41
Unique PROST Homologs: 28
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was A1A4Q4 (Translation machinery-associated protein 7) with a FATCAT P-Value: 1.71e-09 and RMSD of 1.51 angstrom. The sequence alignment identity is 100.0%.
Structural alignment shown in left. Query protein Q9Y2S6 colored as red in alignment, homolog A1A4Q4 colored as blue. Query protein Q9Y2S6 is also shown in right top, homolog A1A4Q4 showed in right bottom. They are colored based on secondary structures. 

  Q9Y2S6 MSGREGGKKKPLKQPKKQAKEMDEEDKAFKQKQKEEQKKLEELKAKAAGKGPLATGGIKKSGKK 64
  A1A4Q4 MSGREGGKKKPLKQPKKQAKEMDEEDKAFKQKQKEEQKKLEELKAKAAGKGPLATGGIKKSGKK 64

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0002181 cytoplasmic translation
2. P GO:0009306 protein secretion
2. P GO:0061564 axon development
2. P GO:0042314 bacteriochlorophyll binding
2. P GO:0006364 rRNA processing
2. P GO:0045177 apical part of cell
2. P GO:0022627 cytosolic small ribosomal subunit
2. P GO:0002182 cytoplasmic translational elongation
2. P GO:1905048 regulation of metallopeptidase activity
2. P GO:0005856 cytoskeleton
2. P GO:0008017 microtubule binding
2. P GO:0032780 negative regulation of ATP-dependent activity
2. P GO:0006508 proteolysis
2. P GO:0010596 negative regulation of endothelial cell migration
2. P GO:0005506 iron ion binding
2. P GO:0055072 iron ion homeostasis
2. P GO:0005730 nucleolus
2. P GO:0033105 chlorosome envelope
2. P GO:0031397 negative regulation of protein ubiquitination
2. P GO:0042030 ATPase inhibitor activity

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q1HRV4 Translation machinery-associated protein 7 homolog 8.78e-05 2.81e-67 1.00e-11
1. PB Q8K003 Translation machinery-associated protein 7 7.24e-08 2.49e-140 1.37e-34
1. PB Q05AK9 Translation machinery-associated protein 7 1.14e-05 9.20e-75 2.58e-15
1. PB Q9Y2S6 Translation machinery-associated protein 7 0 2.49e-140 1.37e-34
1. PB Q28GR1 Translation machinery-associated protein 7 7.01e-04 1.00e-67 2.23e-06
1. PB Q3E764 Translation machinery-associated protein 7 4.58e-03 8.68e-56 0.026
1. PB Q20588 Translation machinery-associated protein 7 homolog 1.80e-03 5.06e-59 0.009
1. PB Q4SUE2 Translation machinery-associated protein 7 1.33e-04 7.13e-62 3.06e-19
1. PB Q7PNC0 Translation machinery-associated protein 7 homolog 2.46e-06 1.97e-59 3.74e-13
1. PB A1A4Q4 Translation machinery-associated protein 7 1.71e-09 2.49e-140 1.37e-34
1. PB Q9XZS3 Translation machinery-associated protein 7 homolog 6.28e-04 2.29e-56 5.71e-06
1. PB Q06DK3 Translation machinery-associated protein 7 homolog 1.24e-04 5.35e-57 7.36e-09
1. PB Q60QR6 Translation machinery-associated protein 7 homolog 3.85e-05 2.19e-63 0.022
2. P A6VDR9 Probable Fe(2+)-trafficking protein 1.08e-01 1.31e-02 NA
2. P Q9HEQ8 rRNA-processing protein cgrA 3.21e-03 1.21e-03 NA
2. P Q32P76 Small EDRK-rich factor 1 4.79e-06 1.25e-03 NA
2. P B7V3P2 Probable Fe(2+)-trafficking protein 1.04e-01 1.31e-02 NA
2. P Q9W6Y0 40S ribosomal protein S30 2.75e-01 4.46e-02 NA
2. P Q9UTF0 SERF-like protein C1705.02 1.23e-02 2.19e-08 NA
2. P O96269 40S ribosomal protein S30 3.34e-01 4.53e-03 NA
2. P Q54BA6 Putative uncharacterized protein DDB_G0293796 3.85e-07 5.03e-06 NA
2. P Q9UTJ4 rRNA-processing protein cgr1 1.29e-03 5.70e-04 NA
2. P Q3E772 Protein LSO2 4.29e-05 4.46e-02 NA
2. P A1C8E1 rRNA-processing protein cgrA 4.46e-04 2.06e-02 NA
2. P Q99LQ4 Small vasohibin-binding protein 2.86e-05 7.07e-03 NA
2. P P54568 Uncharacterized protein YqkE 9.92e-05 3.06e-02 NA
2. P A0A1B0GVZ2 Protein FAM240B 1.20e-03 3.18e-02 NA
2. P Q02EL6 Probable Fe(2+)-trafficking protein 1.06e-01 1.31e-02 NA
2. P Q6CNQ3 rRNA-processing protein CGR1 1.86e-03 1.82e-02 NA
2. P P0CS20 UPF0390 protein CND04920 7.12e-07 1.73e-04 NA
2. P Q556Y1 40S ribosomal protein S30 3.45e-01 2.42e-03 NA
2. P Q9HU36 Probable Fe(2+)-trafficking protein 9.74e-03 1.31e-02 NA
2. P Q0C7E6 rRNA-processing protein cgrA 1.58e-04 1.97e-02 NA
2. P B2A5M4 UPF0291 protein Nther_1806 1.64e-02 1.34e-03 NA
2. P P0CS21 UPF0390 protein CNBD1430 3.25e-03 1.73e-04 NA
2. P B5FZ42 Small vasohibin-binding protein 2.10e-05 4.76e-03 NA
2. P Q4P7C7 UPF0390 protein UM03986 2.87e-03 3.58e-02 NA
2. P Q4KLG3 Small vasohibin-binding protein 2.82e-05 7.07e-03 NA
2. P Q2TVY9 rRNA-processing protein cgrA 2.57e-04 3.84e-03 NA
2. P P09940 ATPase inhibitor, mitochondrial NA 1.54e-02 NA
2. P Q46383 Chlorosome envelope protein B 9.85e-05 4.62e-02 NA