Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
Q4KM95
(Leucine-rich repeat-containing protein 42) with a FATCAT P-Value: 1.11e-16 and RMSD of 2.21 angstrom. The sequence alignment identity is 88.1%.
Structural alignment shown in left. Query protein Q9Y546 colored as red in alignment, homolog Q4KM95 colored as blue.
Query protein Q9Y546 is also shown in right top, homolog Q4KM95 showed in right bottom. They are colored based on secondary structures.
Q9Y546 MSYYLSSENHLDPGPIYMRENGQLHMVNLALDGVRSSLQKPRPFRLFPKGFSVELCMNREDDTARKEKTDHFIFTYTREGNLRYSAKSLFSLVLGFISDN 100 Q4KM95 MAYYLNSEAHLDPGPIYVRENGQLHMVSLALDGVKNSLQKPRPFRLFPKGFSVELCMNREDDTAQKEKTDHFIFTYTREGNLRYSAKSLFSLVLGFISDN 100 Q9Y546 VDHIDSLIGFPEQIAEKLFSAAEARQKFTEPGAGLRALQKFTEAYGSLVLCSLCLRNRYLVISEKLEEIKSFRELTCLDLSCCKLGDEHELLEHLTNEAL 200 Q4KM95 VDHIDSLIGFPEQIAEKLFSAAEARQKFTEPGAGLRALQKFTEAYGSLVLCSLCLRNRYLVVAEKLEEIKSFRELTRLDLSCCWLGDEHELLEHLTNEAL 200 Q9Y546 SSVTQLHLKDNCLSDAGVRKMTAPVRVMKRGLENLTLLDLSCNPEITDAGIGYLFSFRKLNCLDISGTGLKDIKTVKHKLQTHIGLVHSKVPLKEFDHSN 300 Q4KM95 SSVTQLHLKDNCLSDAGIRKMTAPVRVLKRGLENLTLLDLSCNPEITDAGIGYLFSFRKLNCLDISGTGLKDIKAVKDKLRTHIGLVHSKVPLKEFDHSN 300 Q9Y546 CKTEGWADQIVLQWERVTAEAVKPRETSEPRAAAQRFYGKRSRAEAPLKCPLADTHMNSSEKLQFYKEKAPDCHGPVLKHEAISSQESKKSKKRPFEESE 400 Q4KM95 CKTEGWADQIVLQWERVSVEAVRQRKDPEPRKAAQYFYQKRALTEASRKCPLAETHMNSSGKLQFYREKAPDCHEPLL------SQESKKSKKRAFEESE 394 Q9Y546 TEQNNSSQPSKQKYVCLAVEDWDLLNSY 428 Q4KM95 QEQ-SSPQSAKQKCVCLAVEDWDLLNSY 421
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0019005 | SCF ubiquitin ligase complex |
| 1. PB | GO:0031514 | motile cilium |
| 1. PB | GO:0031146 | SCF-dependent proteasomal ubiquitin-dependent protein catabolic process |
| 1. PB | GO:0005856 | cytoskeleton |
| 2. P | GO:0034142 | toll-like receptor 4 signaling pathway |
| 2. P | GO:0007015 | actin filament organization |
| 2. P | GO:0014889 | muscle atrophy |
| 2. P | GO:0016973 | poly(A)+ mRNA export from nucleus |
| 2. P | GO:0005096 | GTPase activator activity |
| 2. P | GO:0030500 | regulation of bone mineralization |
| 2. P | GO:0032760 | positive regulation of tumor necrosis factor production |
| 2. P | GO:0055046 | microgametogenesis |
| 2. P | GO:0030239 | myofibril assembly |
| 2. P | GO:0051932 | synaptic transmission, GABAergic |
| 2. P | GO:0006404 | RNA import into nucleus |
| 2. P | GO:0005686 | U2 snRNP |
| 2. P | GO:0007023 | post-chaperonin tubulin folding pathway |
| 2. P | GO:0006941 | striated muscle contraction |
| 2. P | GO:0001847 | opsonin receptor activity |
| 2. P | GO:0009524 | phragmoplast |
| 2. P | GO:0050658 | RNA transport |
| 2. P | GO:0090090 | negative regulation of canonical Wnt signaling pathway |
| 2. P | GO:0030016 | myofibril |
| 2. P | GO:0048741 | skeletal muscle fiber development |
| 2. P | GO:0008285 | negative regulation of cell population proliferation |
| 2. P | GO:1903818 | positive regulation of voltage-gated potassium channel activity |
| 2. P | GO:0001825 | blastocyst formation |
| 2. P | GO:0007409 | axonogenesis |
| 2. P | GO:0031965 | nuclear membrane |
| 2. P | GO:0005523 | tropomyosin binding |
| 2. P | GO:0016567 | protein ubiquitination |
| 2. P | GO:0070374 | positive regulation of ERK1 and ERK2 cascade |
| 2. P | GO:0031430 | M band |
| 2. P | GO:0048589 | developmental growth |
| 2. P | GO:0140059 | dendrite arborization |
| 2. P | GO:0007021 | tubulin complex assembly |
| 2. P | GO:0032729 | positive regulation of interferon-gamma production |
| 2. P | GO:0032026 | response to magnesium ion |
| 2. P | GO:0097512 | cardiac myofibril |
| 2. P | GO:0032481 | positive regulation of type I interferon production |
| 2. P | GO:0046827 | positive regulation of protein export from nucleus |
| 2. P | GO:0004864 | protein phosphatase inhibitor activity |
| 2. P | GO:0031672 | A band |
| 2. P | GO:0000226 | microtubule cytoskeleton organization |
| 2. P | GO:0090497 | mesenchymal cell migration |
| 2. P | GO:0007052 | mitotic spindle organization |
| 2. P | GO:0071723 | lipopeptide binding |
| 2. P | GO:0045214 | sarcomere organization |
| 2. P | GO:0008344 | adult locomotory behavior |
| 2. P | GO:0005930 | axoneme |
| 2. P | GO:0030838 | positive regulation of actin filament polymerization |
| 2. P | GO:0001530 | lipopolysaccharide binding |
| 2. P | GO:0030240 | skeletal muscle thin filament assembly |
| 2. P | GO:0030620 | U2 snRNA binding |
| 2. P | GO:0061851 | leading edge of lamellipodium |
| 2. P | GO:0070891 | lipoteichoic acid binding |
| 2. P | GO:0008582 | regulation of synaptic assembly at neuromuscular junction |
| 2. P | GO:0007155 | cell adhesion |
| 2. P | GO:0071223 | cellular response to lipoteichoic acid |
| 2. P | GO:0016200 | synaptic target attraction |
| 2. P | GO:0031362 | anchored component of external side of plasma membrane |
| 2. P | GO:0042272 | nuclear RNA export factor complex |
| 2. P | GO:0043014 | alpha-tubulin binding |
| 2. P | GO:0048936 | peripheral nervous system neuron axonogenesis |
| 2. P | GO:0005815 | microtubule organizing center |
| 2. P | GO:0016019 | peptidoglycan immune receptor activity |
| 2. P | GO:0043679 | axon terminus |
| 2. P | GO:0006407 | rRNA export from nucleus |
| 2. P | GO:0005884 | actin filament |
| 2. P | GO:0005747 | mitochondrial respiratory chain complex I |
| 2. P | GO:0009504 | cell plate |
| 2. P | GO:0017024 | myosin I binding |
| 2. P | GO:0046696 | lipopolysaccharide receptor complex |
| 2. P | GO:0010921 | regulation of phosphatase activity |
| 2. P | GO:0031663 | lipopolysaccharide-mediated signaling pathway |
| 2. P | GO:0030041 | actin filament polymerization |
| 2. P | GO:0072659 | protein localization to plasma membrane |
| 2. P | GO:0045010 | actin nucleation |
| 2. P | GO:0071727 | cellular response to triacyl bacterial lipopeptide |
| 2. P | GO:0070840 | dynein complex binding |
| 2. P | GO:0048743 | positive regulation of skeletal muscle fiber development |
| 2. P | GO:0051965 | positive regulation of synapse assembly |
| 2. P | GO:0005865 | striated muscle thin filament |
| 2. P | GO:0051694 | pointed-end actin filament capping |
| 2. P | GO:0071219 | cellular response to molecule of bacterial origin |
| 2. P | GO:0070685 | macropinocytic cup |
| 2. P | GO:0002177 | manchette |
| 2. P | GO:0006936 | muscle contraction |
| 2. P | GO:0015630 | microtubule cytoskeleton |
| 2. P | GO:0006409 | tRNA export from nucleus |
| 2. P | GO:0006606 | protein import into nucleus |
| 2. P | GO:0009555 | pollen development |
| 2. P | GO:0007413 | axonal fasciculation |
| 2. P | GO:0003779 | actin binding |
| 2. P | GO:0050921 | positive regulation of chemotaxis |
| 2. P | GO:0051897 | positive regulation of protein kinase B signaling |
| 2. P | GO:0062023 | collagen-containing extracellular matrix |
| 2. P | GO:0009791 | post-embryonic development |
| 2. P | GO:0015631 | tubulin binding |
| 2. P | GO:1990727 | tubulin folding cofactor complex |
| 2. P | GO:0043666 | regulation of phosphoprotein phosphatase activity |
| 2. P | GO:0071726 | cellular response to diacyl bacterial lipopeptide |
| 2. P | GO:0045596 | negative regulation of cell differentiation |
| 2. P | GO:0034315 | regulation of Arp2/3 complex-mediated actin nucleation |
| 2. P | GO:0071222 | cellular response to lipopolysaccharide |
| 2. P | GO:0060326 | cell chemotaxis |
| 2. P | GO:0000911 | cytokinesis by cell plate formation |
| 2. P | GO:0008355 | olfactory learning |
| 2. P | GO:0046785 | microtubule polymerization |
| 2. P | GO:0032981 | mitochondrial respiratory chain complex I assembly |
| 2. P | GO:0099104 | potassium channel activator activity |
| 2. P | GO:0030017 | sarcomere |
| 2. P | GO:1901224 | positive regulation of NIK/NF-kappaB signaling |
| 2. P | GO:0003785 | actin monomer binding |
| 3. B | GO:0016604 | nuclear body |
| 3. B | GO:0005662 | DNA replication factor A complex |
| 3. B | GO:0043596 | nuclear replication fork |
| 3. B | GO:0035101 | FACT complex |
| 3. B | GO:0031297 | replication fork processing |
| 3. B | GO:0042555 | MCM complex |
| 3. B | GO:0042393 | histone binding |
| 3. B | GO:0000724 | double-strand break repair via homologous recombination |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q4KLV2 | Leucine-rich repeat-containing protein 42 | 2.31e-13 | 3.02e-80 | 8.22e-142 |
| 1. PB | Q8R2U7 | Leucine-rich repeat-containing protein 42 | 1.11e-16 | 4.13e-99 | 0.0 |
| 1. PB | Q9Y546 | Leucine-rich repeat-containing protein 42 | 0 | 3.20e-154 | 0.0 |
| 1. PB | Q6P5J6 | Leucine-rich repeat-containing protein 42 | 8.84e-12 | 2.08e-69 | 3.46e-119 |
| 1. PB | Q2HJ90 | Leucine-rich repeat-containing protein 42 | 1.61e-14 | 5.67e-113 | 0.0 |
| 1. PB | Q4KM95 | Leucine-rich repeat-containing protein 42 | 1.11e-16 | 1.25e-99 | 0.0 |
| 1. PB | Q0V9Y8 | Leucine-rich repeat-containing protein 42 | 6.33e-15 | 1.88e-77 | 1.92e-141 |
| 2. P | P11745 | Ran GTPase-activating protein 1 | 7.02e-03 | 4.33e-04 | NA |
| 2. P | Q1L8H0 | Leucine-rich repeat-containing protein 14B | 1.36e-02 | 7.26e-07 | NA |
| 2. P | E9QA62 | Leiomodin-3 | 5.91e-02 | 9.04e-10 | NA |
| 2. P | Q3UJB3 | Leucine-rich repeat-containing protein 14B | 2.51e-02 | 6.98e-07 | NA |
| 2. P | Q0VAA2 | Leucine-rich repeat-containing protein 74A | 1.72e-02 | 4.72e-10 | NA |
| 2. P | Q9M651 | RAN GTPase-activating protein 2 | 2.79e-02 | 2.44e-02 | NA |
| 2. P | Q6ZQY2 | Leucine-rich repeat-containing protein 74B | 4.77e-03 | 1.49e-02 | NA |
| 2. P | Q03016 | GLC7-interacting protein 3 | 2.32e-01 | 8.70e-03 | NA |
| 2. P | O01615 | Acidic leucine-rich nuclear phosphoprotein 32-related protein 2 | 1.02e-03 | 3.79e-02 | NA |
| 2. P | Q8CIV8 | Tubulin-specific chaperone E | 2.66e-02 | 4.87e-02 | NA |
| 2. P | Q9UUG2 | Uncharacterized leucine-rich repeat-containing protein C926.06c | 7.09e-02 | 1.01e-06 | NA |
| 2. P | A8Y3R9 | Protein phosphatase 1 regulatory subunit 37 homolog | 4.25e-02 | 3.39e-03 | NA |
| 2. P | Q8IZ02 | Leucine-rich repeat-containing protein 34 | 1.39e-02 | 1.47e-04 | NA |
| 2. P | Q5RBD9 | Tubulin-specific chaperone E | 1.28e-02 | 2.59e-02 | NA |
| 2. P | Q7XK44 | Plant intracellular Ras-group-related LRR protein 3 | 2.16e-02 | 1.71e-02 | NA |
| 2. P | Q8N456 | Leucine-rich repeat-containing protein 18 | 1.76e-02 | 6.29e-04 | NA |
| 2. P | Q6P5Q4 | Leiomodin-2 | 2.11e-02 | 7.96e-04 | NA |
| 2. P | A6NHZ5 | Leucine-rich repeat-containing protein 14B | 1.65e-02 | 1.81e-05 | NA |
| 2. P | Q99983 | Osteomodulin | 1.05e-01 | 1.27e-02 | NA |
| 2. P | A7Z026 | Protein phosphatase 1 regulatory subunit 37 | 3.51e-02 | 1.65e-03 | NA |
| 2. P | Q5FVQ9 | Tubulin-specific chaperone E | 2.44e-02 | 6.09e-03 | NA |
| 2. P | Q8NAA5 | Leucine-rich repeat-containing protein 75A | 4.44e-02 | 1.95e-02 | NA |
| 2. P | Q9Y8G3 | mRNA export factor mex67 | 1.53e-01 | 4.41e-02 | NA |
| 2. P | Q9D3W5 | Leucine-rich repeat-containing protein 71 | 1.92e-02 | 1.49e-05 | NA |
| 2. P | Q0VAK6 | Leiomodin-3 | 2.22e-02 | 4.92e-09 | NA |
| 2. P | E7F7X0 | Leiomodin-3 | 6.61e-02 | 1.48e-03 | NA |
| 2. P | P0DKB5 | Trophoblast glycoprotein-like | 5.28e-02 | 1.31e-02 | NA |
| 2. P | Q9LRV8 | Plant intracellular Ras-group-related LRR protein 2 | 2.01e-02 | 8.00e-03 | NA |
| 2. P | B2RYF1 | Protein phosphatase 1 regulatory subunit 37 | 1.98e-02 | 2.73e-03 | NA |
| 2. P | A1Z6J5 | Tubulin-specific chaperone E | 2.54e-02 | 1.42e-03 | NA |
| 2. P | Q5QJ74 | Tubulin-specific chaperone cofactor E-like protein | 2.00e-02 | 3.24e-03 | NA |
| 2. P | Q9D7K5 | Distal membrane-arm assembly complex protein 2 | 8.11e-03 | 1.29e-02 | NA |
| 2. P | Q9LE82 | RAN GTPase-activating protein 1 | 2.31e-02 | 2.07e-06 | NA |
| 2. P | Q7TPD7 | Leucine-rich repeat-containing protein 75B | 1.17e-02 | 9.06e-08 | NA |
| 2. P | Q587K4 | Leucine-rich repeat-containing protein 73 | 2.10e-03 | 8.86e-05 | NA |
| 2. P | Q810Y8 | Preferentially expressed antigen in melanoma-like protein 7 | 2.67e-02 | 5.65e-03 | NA |
| 2. P | Q5I0I4 | Distal membrane-arm assembly complex protein 2 | 2.29e-03 | 2.22e-02 | NA |
| 2. P | O94334 | F-box protein pof13 | 9.12e-02 | 1.18e-03 | NA |
| 2. P | Q96L50 | Leucine-rich repeat protein 1 | 8.28e-02 | 1.10e-03 | NA |
| 2. P | O77742 | Osteomodulin | 4.89e-02 | 8.70e-03 | NA |
| 2. P | Q66HD6 | Leucine-rich repeat-containing protein 18 | 1.47e-02 | 1.74e-02 | NA |
| 2. P | E1BTG2 | Leiomodin-2 | 7.17e-02 | 3.58e-05 | NA |
| 2. P | Q13641 | Trophoblast glycoprotein | 5.02e-02 | 5.19e-03 | NA |
| 2. P | Q9Z0L0 | Trophoblast glycoprotein | 7.01e-02 | 3.01e-02 | NA |
| 2. P | Q3UHZ5 | Leiomodin-2 | 5.12e-02 | 1.92e-05 | NA |
| 2. P | Q9CQ07 | Leucine-rich repeat-containing protein 18 | 1.51e-02 | 1.75e-03 | NA |
| 2. P | Q8C013 | Trophoblast glycoprotein-like | 7.05e-02 | 4.06e-03 | NA |
| 2. P | Q8W4Q3 | Plant intracellular Ras-group-related LRR protein 3 | 5.74e-02 | 1.52e-02 | NA |
| 2. P | Q55CN0 | Tubulin-specific chaperone E | 2.19e-02 | 1.77e-05 | NA |
| 2. P | Q01819 | Connectin | 1.29e-01 | 4.33e-03 | NA |
| 2. P | Q1L994 | Protein phosphatase 1 regulatory subunit 37 | 5.81e-02 | 2.05e-08 | NA |
| 2. P | Q91W20 | Leucine-rich repeat-containing protein 26 | 3.98e-02 | 4.68e-02 | NA |
| 2. P | Q5JTD7 | Leucine-rich repeat-containing protein 73 | 8.67e-03 | 6.01e-04 | NA |
| 2. P | Q8R1Z4 | Protein phosphatase 1 regulatory subunit 42 | 1.82e-03 | 3.61e-04 | NA |
| 2. P | Q6C417 | U2 small nuclear ribonucleoprotein A' | 1.15e-02 | 1.52e-06 | NA |
| 2. P | Q0WRC9 | F-box protein SKIP17 | 1.79e-02 | 3.14e-03 | NA |
| 2. P | Q8BKR5 | Protein phosphatase 1 regulatory subunit 37 | 1.96e-02 | 4.03e-05 | NA |
| 2. P | A8JHD7 | Dynein regulatory complex subunit 6 | 4.53e-02 | 2.94e-04 | NA |
| 2. P | Q2VPJ9 | Leucine-rich repeat-containing protein 75B | 2.09e-02 | 1.38e-05 | NA |
| 2. P | Q8C5W3 | Tubulin-specific chaperone cofactor E-like protein | 6.71e-02 | 4.06e-03 | NA |
| 2. P | Q95122 | Monocyte differentiation antigen CD14 | 3.66e-02 | 5.31e-04 | NA |
| 2. P | O35103 | Osteomodulin | 3.22e-01 | 8.09e-03 | NA |
| 2. P | Q755D2 | U2 small nuclear ribonucleoprotein A' | 3.32e-02 | 1.39e-03 | NA |
| 2. P | H0Y7S4 | Putative PRAME family member 26 | 9.52e-03 | 2.06e-03 | NA |
| 2. P | P41391 | Ran GTPase-activating protein 1 | 2.30e-03 | 9.97e-03 | NA |
| 2. P | Q12276 | HMG2-induced ER-remodeling protein 1 | 4.07e-01 | 1.14e-02 | NA |
| 2. P | Q15813 | Tubulin-specific chaperone E | 1.70e-02 | 1.27e-02 | NA |
| 2. P | Q8VYG9 | Plant intracellular Ras-group-related LRR protein 9 | 5.07e-02 | 1.33e-03 | NA |
| 2. P | Q9FFJ3 | Plant intracellular Ras-group-related LRR protein 1 | 6.18e-02 | 2.07e-02 | NA |
| 2. P | Q5U508 | Tubulin-specific chaperone E | 2.90e-02 | 3.30e-02 | NA |
| 2. P | Q19857 | Protein phosphatase 1 regulatory subunit 37 homolog | 5.47e-02 | 3.99e-02 | NA |
| 2. P | A8HMZ4 | Dynein regulatory complex subunit 5 | 3.62e-03 | 6.22e-03 | NA |
| 2. P | P08571 | Monocyte differentiation antigen CD14 | 5.21e-02 | 4.95e-05 | NA |
| 2. P | Q10303 | Cell polarity protein alp21 | 2.40e-02 | 3.47e-08 | NA |
| 2. P | Q5PQV5 | Trophoblast glycoprotein | 4.32e-02 | 3.21e-03 | NA |
| 2. P | Q14BP6 | Leucine-rich repeat-containing protein 74B | 5.50e-03 | 1.83e-02 | NA |
| 2. P | Q95VZ3 | Protein CARMIL | 1.59e-01 | 1.85e-02 | NA |
| 2. P | Q4R8Y9 | Trophoblast glycoprotein | 8.82e-02 | 4.36e-02 | NA |
| 2. P | Q4R803 | Protein phosphatase 1 regulatory subunit 42 | 4.81e-03 | 4.39e-05 | NA |
| 2. P | Q5PPX0 | Protein phosphatase 1 regulatory subunit 42 | 9.35e-03 | 3.61e-02 | NA |
| 2. P | Q8N4P6 | Leucine-rich repeat-containing protein 71 | 8.21e-02 | 4.71e-07 | NA |
| 2. P | Q4V8D9 | Leucine-rich repeat-containing protein 34 | 1.37e-02 | 2.11e-02 | NA |
| 2. P | Q5PQJ7 | Tubulin-specific chaperone cofactor E-like protein | 4.37e-02 | 6.76e-03 | NA |
| 2. P | A6QNS9 | Distal membrane-arm assembly complex protein 2 | 1.04e-02 | 3.58e-13 | NA |
| 2. P | Q5U378 | Tubulin-specific chaperone E | 2.75e-02 | 9.17e-03 | NA |
| 2. P | A1A5Q0 | Leiomodin-2 | 3.23e-02 | 2.40e-05 | NA |
| 2. P | Q9DAM1 | Leucine-rich repeat-containing protein 34 | 7.62e-03 | 3.49e-04 | NA |
| 2. P | O75864 | Protein phosphatase 1 regulatory subunit 37 | 5.19e-02 | 3.11e-04 | NA |
| 2. P | A0JPI9 | Leucine-rich repeat-containing protein 74A | 1.41e-02 | 1.25e-05 | NA |
| 2. P | Q06479 | F-box protein YLR352W | 1.00e-01 | 4.55e-05 | NA |
| 2. P | B6CZ40 | Leucine-rich repeat-containing protein 51 | 4.03e-03 | 1.97e-02 | NA |
| 2. P | Q9Z1S7 | Osteomodulin | 1.52e-01 | 1.01e-02 | NA |
| 2. P | Q9H1B4 | Nuclear RNA export factor 5 | 8.07e-02 | 3.69e-09 | NA |
| 2. P | Q6ZH85 | Plant intracellular Ras-group-related LRR protein 2 | 4.71e-02 | 9.18e-05 | NA |
| 2. P | Q8VDB8 | Leucine-rich repeat-containing protein 2 | 1.37e-02 | 2.34e-02 | NA |
| 3. B | D4A615 | Tonsoku-like protein | 3.59e-01 | NA | 0.011 |
| 3. B | Q8NEE6 | Dynein regulatory complex subunit 6 | 5.49e-02 | NA | 0.045 |