Summary

Q9Y546

Homolog: Q4KM95.
Function: Leucine-rich repeat-containing protein 42.

Statistics

Total GO Annotation: 122
Unique PROST Go: 110
Unique BLAST Go: 8

Total Homologs: 104
Unique PROST Homologs: 95
Unique BLAST Homologs: 2

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q4KM95 (Leucine-rich repeat-containing protein 42) with a FATCAT P-Value: 1.11e-16 and RMSD of 2.21 angstrom. The sequence alignment identity is 88.1%.
Structural alignment shown in left. Query protein Q9Y546 colored as red in alignment, homolog Q4KM95 colored as blue. Query protein Q9Y546 is also shown in right top, homolog Q4KM95 showed in right bottom. They are colored based on secondary structures. 

  Q9Y546 MSYYLSSENHLDPGPIYMRENGQLHMVNLALDGVRSSLQKPRPFRLFPKGFSVELCMNREDDTARKEKTDHFIFTYTREGNLRYSAKSLFSLVLGFISDN 100
  Q4KM95 MAYYLNSEAHLDPGPIYVRENGQLHMVSLALDGVKNSLQKPRPFRLFPKGFSVELCMNREDDTAQKEKTDHFIFTYTREGNLRYSAKSLFSLVLGFISDN 100

  Q9Y546 VDHIDSLIGFPEQIAEKLFSAAEARQKFTEPGAGLRALQKFTEAYGSLVLCSLCLRNRYLVISEKLEEIKSFRELTCLDLSCCKLGDEHELLEHLTNEAL 200
  Q4KM95 VDHIDSLIGFPEQIAEKLFSAAEARQKFTEPGAGLRALQKFTEAYGSLVLCSLCLRNRYLVVAEKLEEIKSFRELTRLDLSCCWLGDEHELLEHLTNEAL 200

  Q9Y546 SSVTQLHLKDNCLSDAGVRKMTAPVRVMKRGLENLTLLDLSCNPEITDAGIGYLFSFRKLNCLDISGTGLKDIKTVKHKLQTHIGLVHSKVPLKEFDHSN 300
  Q4KM95 SSVTQLHLKDNCLSDAGIRKMTAPVRVLKRGLENLTLLDLSCNPEITDAGIGYLFSFRKLNCLDISGTGLKDIKAVKDKLRTHIGLVHSKVPLKEFDHSN 300

  Q9Y546 CKTEGWADQIVLQWERVTAEAVKPRETSEPRAAAQRFYGKRSRAEAPLKCPLADTHMNSSEKLQFYKEKAPDCHGPVLKHEAISSQESKKSKKRPFEESE 400
  Q4KM95 CKTEGWADQIVLQWERVSVEAVRQRKDPEPRKAAQYFYQKRALTEASRKCPLAETHMNSSGKLQFYREKAPDCHEPLL------SQESKKSKKRAFEESE 394

  Q9Y546 TEQNNSSQPSKQKYVCLAVEDWDLLNSY 428
  Q4KM95 QEQ-SSPQSAKQKCVCLAVEDWDLLNSY 421

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0019005 SCF ubiquitin ligase complex
1. PB GO:0031514 motile cilium
1. PB GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
1. PB GO:0005856 cytoskeleton
2. P GO:0034142 toll-like receptor 4 signaling pathway
2. P GO:0007015 actin filament organization
2. P GO:0014889 muscle atrophy
2. P GO:0016973 poly(A)+ mRNA export from nucleus
2. P GO:0005096 GTPase activator activity
2. P GO:0030500 regulation of bone mineralization
2. P GO:0032760 positive regulation of tumor necrosis factor production
2. P GO:0055046 microgametogenesis
2. P GO:0030239 myofibril assembly
2. P GO:0051932 synaptic transmission, GABAergic
2. P GO:0006404 RNA import into nucleus
2. P GO:0005686 U2 snRNP
2. P GO:0007023 post-chaperonin tubulin folding pathway
2. P GO:0006941 striated muscle contraction
2. P GO:0001847 opsonin receptor activity
2. P GO:0009524 phragmoplast
2. P GO:0050658 RNA transport
2. P GO:0090090 negative regulation of canonical Wnt signaling pathway
2. P GO:0030016 myofibril
2. P GO:0048741 skeletal muscle fiber development
2. P GO:0008285 negative regulation of cell population proliferation
2. P GO:1903818 positive regulation of voltage-gated potassium channel activity
2. P GO:0001825 blastocyst formation
2. P GO:0007409 axonogenesis
2. P GO:0031965 nuclear membrane
2. P GO:0005523 tropomyosin binding
2. P GO:0016567 protein ubiquitination
2. P GO:0070374 positive regulation of ERK1 and ERK2 cascade
2. P GO:0031430 M band
2. P GO:0048589 developmental growth
2. P GO:0140059 dendrite arborization
2. P GO:0007021 tubulin complex assembly
2. P GO:0032729 positive regulation of interferon-gamma production
2. P GO:0032026 response to magnesium ion
2. P GO:0097512 cardiac myofibril
2. P GO:0032481 positive regulation of type I interferon production
2. P GO:0046827 positive regulation of protein export from nucleus
2. P GO:0004864 protein phosphatase inhibitor activity
2. P GO:0031672 A band
2. P GO:0000226 microtubule cytoskeleton organization
2. P GO:0090497 mesenchymal cell migration
2. P GO:0007052 mitotic spindle organization
2. P GO:0071723 lipopeptide binding
2. P GO:0045214 sarcomere organization
2. P GO:0008344 adult locomotory behavior
2. P GO:0005930 axoneme
2. P GO:0030838 positive regulation of actin filament polymerization
2. P GO:0001530 lipopolysaccharide binding
2. P GO:0030240 skeletal muscle thin filament assembly
2. P GO:0030620 U2 snRNA binding
2. P GO:0061851 leading edge of lamellipodium
2. P GO:0070891 lipoteichoic acid binding
2. P GO:0008582 regulation of synaptic assembly at neuromuscular junction
2. P GO:0007155 cell adhesion
2. P GO:0071223 cellular response to lipoteichoic acid
2. P GO:0016200 synaptic target attraction
2. P GO:0031362 anchored component of external side of plasma membrane
2. P GO:0042272 nuclear RNA export factor complex
2. P GO:0043014 alpha-tubulin binding
2. P GO:0048936 peripheral nervous system neuron axonogenesis
2. P GO:0005815 microtubule organizing center
2. P GO:0016019 peptidoglycan immune receptor activity
2. P GO:0043679 axon terminus
2. P GO:0006407 rRNA export from nucleus
2. P GO:0005884 actin filament
2. P GO:0005747 mitochondrial respiratory chain complex I
2. P GO:0009504 cell plate
2. P GO:0017024 myosin I binding
2. P GO:0046696 lipopolysaccharide receptor complex
2. P GO:0010921 regulation of phosphatase activity
2. P GO:0031663 lipopolysaccharide-mediated signaling pathway
2. P GO:0030041 actin filament polymerization
2. P GO:0072659 protein localization to plasma membrane
2. P GO:0045010 actin nucleation
2. P GO:0071727 cellular response to triacyl bacterial lipopeptide
2. P GO:0070840 dynein complex binding
2. P GO:0048743 positive regulation of skeletal muscle fiber development
2. P GO:0051965 positive regulation of synapse assembly
2. P GO:0005865 striated muscle thin filament
2. P GO:0051694 pointed-end actin filament capping
2. P GO:0071219 cellular response to molecule of bacterial origin
2. P GO:0070685 macropinocytic cup
2. P GO:0002177 manchette
2. P GO:0006936 muscle contraction
2. P GO:0015630 microtubule cytoskeleton
2. P GO:0006409 tRNA export from nucleus
2. P GO:0006606 protein import into nucleus
2. P GO:0009555 pollen development
2. P GO:0007413 axonal fasciculation
2. P GO:0003779 actin binding
2. P GO:0050921 positive regulation of chemotaxis
2. P GO:0051897 positive regulation of protein kinase B signaling
2. P GO:0062023 collagen-containing extracellular matrix
2. P GO:0009791 post-embryonic development
2. P GO:0015631 tubulin binding
2. P GO:1990727 tubulin folding cofactor complex
2. P GO:0043666 regulation of phosphoprotein phosphatase activity
2. P GO:0071726 cellular response to diacyl bacterial lipopeptide
2. P GO:0045596 negative regulation of cell differentiation
2. P GO:0034315 regulation of Arp2/3 complex-mediated actin nucleation
2. P GO:0071222 cellular response to lipopolysaccharide
2. P GO:0060326 cell chemotaxis
2. P GO:0000911 cytokinesis by cell plate formation
2. P GO:0008355 olfactory learning
2. P GO:0046785 microtubule polymerization
2. P GO:0032981 mitochondrial respiratory chain complex I assembly
2. P GO:0099104 potassium channel activator activity
2. P GO:0030017 sarcomere
2. P GO:1901224 positive regulation of NIK/NF-kappaB signaling
2. P GO:0003785 actin monomer binding
3. B GO:0016604 nuclear body
3. B GO:0005662 DNA replication factor A complex
3. B GO:0043596 nuclear replication fork
3. B GO:0035101 FACT complex
3. B GO:0031297 replication fork processing
3. B GO:0042555 MCM complex
3. B GO:0042393 histone binding
3. B GO:0000724 double-strand break repair via homologous recombination

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q4KLV2 Leucine-rich repeat-containing protein 42 2.31e-13 3.02e-80 8.22e-142
1. PB Q8R2U7 Leucine-rich repeat-containing protein 42 1.11e-16 4.13e-99 0.0
1. PB Q9Y546 Leucine-rich repeat-containing protein 42 0 3.20e-154 0.0
1. PB Q6P5J6 Leucine-rich repeat-containing protein 42 8.84e-12 2.08e-69 3.46e-119
1. PB Q2HJ90 Leucine-rich repeat-containing protein 42 1.61e-14 5.67e-113 0.0
1. PB Q4KM95 Leucine-rich repeat-containing protein 42 1.11e-16 1.25e-99 0.0
1. PB Q0V9Y8 Leucine-rich repeat-containing protein 42 6.33e-15 1.88e-77 1.92e-141
2. P P11745 Ran GTPase-activating protein 1 7.02e-03 4.33e-04 NA
2. P Q1L8H0 Leucine-rich repeat-containing protein 14B 1.36e-02 7.26e-07 NA
2. P E9QA62 Leiomodin-3 5.91e-02 9.04e-10 NA
2. P Q3UJB3 Leucine-rich repeat-containing protein 14B 2.51e-02 6.98e-07 NA
2. P Q0VAA2 Leucine-rich repeat-containing protein 74A 1.72e-02 4.72e-10 NA
2. P Q9M651 RAN GTPase-activating protein 2 2.79e-02 2.44e-02 NA
2. P Q6ZQY2 Leucine-rich repeat-containing protein 74B 4.77e-03 1.49e-02 NA
2. P Q03016 GLC7-interacting protein 3 2.32e-01 8.70e-03 NA
2. P O01615 Acidic leucine-rich nuclear phosphoprotein 32-related protein 2 1.02e-03 3.79e-02 NA
2. P Q8CIV8 Tubulin-specific chaperone E 2.66e-02 4.87e-02 NA
2. P Q9UUG2 Uncharacterized leucine-rich repeat-containing protein C926.06c 7.09e-02 1.01e-06 NA
2. P A8Y3R9 Protein phosphatase 1 regulatory subunit 37 homolog 4.25e-02 3.39e-03 NA
2. P Q8IZ02 Leucine-rich repeat-containing protein 34 1.39e-02 1.47e-04 NA
2. P Q5RBD9 Tubulin-specific chaperone E 1.28e-02 2.59e-02 NA
2. P Q7XK44 Plant intracellular Ras-group-related LRR protein 3 2.16e-02 1.71e-02 NA
2. P Q8N456 Leucine-rich repeat-containing protein 18 1.76e-02 6.29e-04 NA
2. P Q6P5Q4 Leiomodin-2 2.11e-02 7.96e-04 NA
2. P A6NHZ5 Leucine-rich repeat-containing protein 14B 1.65e-02 1.81e-05 NA
2. P Q99983 Osteomodulin 1.05e-01 1.27e-02 NA
2. P A7Z026 Protein phosphatase 1 regulatory subunit 37 3.51e-02 1.65e-03 NA
2. P Q5FVQ9 Tubulin-specific chaperone E 2.44e-02 6.09e-03 NA
2. P Q8NAA5 Leucine-rich repeat-containing protein 75A 4.44e-02 1.95e-02 NA
2. P Q9Y8G3 mRNA export factor mex67 1.53e-01 4.41e-02 NA
2. P Q9D3W5 Leucine-rich repeat-containing protein 71 1.92e-02 1.49e-05 NA
2. P Q0VAK6 Leiomodin-3 2.22e-02 4.92e-09 NA
2. P E7F7X0 Leiomodin-3 6.61e-02 1.48e-03 NA
2. P P0DKB5 Trophoblast glycoprotein-like 5.28e-02 1.31e-02 NA
2. P Q9LRV8 Plant intracellular Ras-group-related LRR protein 2 2.01e-02 8.00e-03 NA
2. P B2RYF1 Protein phosphatase 1 regulatory subunit 37 1.98e-02 2.73e-03 NA
2. P A1Z6J5 Tubulin-specific chaperone E 2.54e-02 1.42e-03 NA
2. P Q5QJ74 Tubulin-specific chaperone cofactor E-like protein 2.00e-02 3.24e-03 NA
2. P Q9D7K5 Distal membrane-arm assembly complex protein 2 8.11e-03 1.29e-02 NA
2. P Q9LE82 RAN GTPase-activating protein 1 2.31e-02 2.07e-06 NA
2. P Q7TPD7 Leucine-rich repeat-containing protein 75B 1.17e-02 9.06e-08 NA
2. P Q587K4 Leucine-rich repeat-containing protein 73 2.10e-03 8.86e-05 NA
2. P Q810Y8 Preferentially expressed antigen in melanoma-like protein 7 2.67e-02 5.65e-03 NA
2. P Q5I0I4 Distal membrane-arm assembly complex protein 2 2.29e-03 2.22e-02 NA
2. P O94334 F-box protein pof13 9.12e-02 1.18e-03 NA
2. P Q96L50 Leucine-rich repeat protein 1 8.28e-02 1.10e-03 NA
2. P O77742 Osteomodulin 4.89e-02 8.70e-03 NA
2. P Q66HD6 Leucine-rich repeat-containing protein 18 1.47e-02 1.74e-02 NA
2. P E1BTG2 Leiomodin-2 7.17e-02 3.58e-05 NA
2. P Q13641 Trophoblast glycoprotein 5.02e-02 5.19e-03 NA
2. P Q9Z0L0 Trophoblast glycoprotein 7.01e-02 3.01e-02 NA
2. P Q3UHZ5 Leiomodin-2 5.12e-02 1.92e-05 NA
2. P Q9CQ07 Leucine-rich repeat-containing protein 18 1.51e-02 1.75e-03 NA
2. P Q8C013 Trophoblast glycoprotein-like 7.05e-02 4.06e-03 NA
2. P Q8W4Q3 Plant intracellular Ras-group-related LRR protein 3 5.74e-02 1.52e-02 NA
2. P Q55CN0 Tubulin-specific chaperone E 2.19e-02 1.77e-05 NA
2. P Q01819 Connectin 1.29e-01 4.33e-03 NA
2. P Q1L994 Protein phosphatase 1 regulatory subunit 37 5.81e-02 2.05e-08 NA
2. P Q91W20 Leucine-rich repeat-containing protein 26 3.98e-02 4.68e-02 NA
2. P Q5JTD7 Leucine-rich repeat-containing protein 73 8.67e-03 6.01e-04 NA
2. P Q8R1Z4 Protein phosphatase 1 regulatory subunit 42 1.82e-03 3.61e-04 NA
2. P Q6C417 U2 small nuclear ribonucleoprotein A' 1.15e-02 1.52e-06 NA
2. P Q0WRC9 F-box protein SKIP17 1.79e-02 3.14e-03 NA
2. P Q8BKR5 Protein phosphatase 1 regulatory subunit 37 1.96e-02 4.03e-05 NA
2. P A8JHD7 Dynein regulatory complex subunit 6 4.53e-02 2.94e-04 NA
2. P Q2VPJ9 Leucine-rich repeat-containing protein 75B 2.09e-02 1.38e-05 NA
2. P Q8C5W3 Tubulin-specific chaperone cofactor E-like protein 6.71e-02 4.06e-03 NA
2. P Q95122 Monocyte differentiation antigen CD14 3.66e-02 5.31e-04 NA
2. P O35103 Osteomodulin 3.22e-01 8.09e-03 NA
2. P Q755D2 U2 small nuclear ribonucleoprotein A' 3.32e-02 1.39e-03 NA
2. P H0Y7S4 Putative PRAME family member 26 9.52e-03 2.06e-03 NA
2. P P41391 Ran GTPase-activating protein 1 2.30e-03 9.97e-03 NA
2. P Q12276 HMG2-induced ER-remodeling protein 1 4.07e-01 1.14e-02 NA
2. P Q15813 Tubulin-specific chaperone E 1.70e-02 1.27e-02 NA
2. P Q8VYG9 Plant intracellular Ras-group-related LRR protein 9 5.07e-02 1.33e-03 NA
2. P Q9FFJ3 Plant intracellular Ras-group-related LRR protein 1 6.18e-02 2.07e-02 NA
2. P Q5U508 Tubulin-specific chaperone E 2.90e-02 3.30e-02 NA
2. P Q19857 Protein phosphatase 1 regulatory subunit 37 homolog 5.47e-02 3.99e-02 NA
2. P A8HMZ4 Dynein regulatory complex subunit 5 3.62e-03 6.22e-03 NA
2. P P08571 Monocyte differentiation antigen CD14 5.21e-02 4.95e-05 NA
2. P Q10303 Cell polarity protein alp21 2.40e-02 3.47e-08 NA
2. P Q5PQV5 Trophoblast glycoprotein 4.32e-02 3.21e-03 NA
2. P Q14BP6 Leucine-rich repeat-containing protein 74B 5.50e-03 1.83e-02 NA
2. P Q95VZ3 Protein CARMIL 1.59e-01 1.85e-02 NA
2. P Q4R8Y9 Trophoblast glycoprotein 8.82e-02 4.36e-02 NA
2. P Q4R803 Protein phosphatase 1 regulatory subunit 42 4.81e-03 4.39e-05 NA
2. P Q5PPX0 Protein phosphatase 1 regulatory subunit 42 9.35e-03 3.61e-02 NA
2. P Q8N4P6 Leucine-rich repeat-containing protein 71 8.21e-02 4.71e-07 NA
2. P Q4V8D9 Leucine-rich repeat-containing protein 34 1.37e-02 2.11e-02 NA
2. P Q5PQJ7 Tubulin-specific chaperone cofactor E-like protein 4.37e-02 6.76e-03 NA
2. P A6QNS9 Distal membrane-arm assembly complex protein 2 1.04e-02 3.58e-13 NA
2. P Q5U378 Tubulin-specific chaperone E 2.75e-02 9.17e-03 NA
2. P A1A5Q0 Leiomodin-2 3.23e-02 2.40e-05 NA
2. P Q9DAM1 Leucine-rich repeat-containing protein 34 7.62e-03 3.49e-04 NA
2. P O75864 Protein phosphatase 1 regulatory subunit 37 5.19e-02 3.11e-04 NA
2. P A0JPI9 Leucine-rich repeat-containing protein 74A 1.41e-02 1.25e-05 NA
2. P Q06479 F-box protein YLR352W 1.00e-01 4.55e-05 NA
2. P B6CZ40 Leucine-rich repeat-containing protein 51 4.03e-03 1.97e-02 NA
2. P Q9Z1S7 Osteomodulin 1.52e-01 1.01e-02 NA
2. P Q9H1B4 Nuclear RNA export factor 5 8.07e-02 3.69e-09 NA
2. P Q6ZH85 Plant intracellular Ras-group-related LRR protein 2 4.71e-02 9.18e-05 NA
2. P Q8VDB8 Leucine-rich repeat-containing protein 2 1.37e-02 2.34e-02 NA
3. B D4A615 Tonsoku-like protein 3.59e-01 NA 0.011
3. B Q8NEE6 Dynein regulatory complex subunit 6 5.49e-02 NA 0.045