Summary
NP_001032573.1
Homolog: XP_003675424.1.
Wiesman et al.[1]: NCAS0B08990 (S. castelliii
Statistics
Total Homologs: 56
Non significant structural homologs: 36
Total Synteny Homologs: 4
Found Synteny Homologs: 4
Synteny Status: Synteny homolog(s) found
Structures and Sequence Alignment
The best structural homolog was
XP_003675424.1
(XP_003675424.1 hypothetical protein NCAS_0C00650 [Naumovozyma castellii CBS 4309]) with a FATCAT [2] P-Value: 2.54e-04 and RMSD of 3.22 angstrom. The sequence alignment identity is 32.9%.
Structural alignment shown in left. Query protein NP_001032573.1 colored as red in alignment, homolog XP_003675424.1 colored as blue.
Query protein NP_001032573.1 is also shown in right top, homolog XP_003675424.1 showed in right bottom. They are colored based on secondary structures.
NP_001032573.1 MQIKNIVAVLATVTAINAQVGIEPNATTPNATQPNATQPNTTLPTASVTTTVSIGEAVVNTMAAGAFGAAIAAGVAFLF 79 XP_003675424.1 MKVTSIL-----MSCI-AVVGLV-NAKS-NDS-------NS---SSSKNAAVAIGGA-NNAISAGVLGAAIAGAAAFLM 60
Homologs
| Homolog | Description | FATCAT p-val | FATCAT RMSD | PROST Evalue | Synteny | Sequence Identity |
|---|---|---|---|---|---|---|
| XP_003675353.1 | XP_003675353.1 hypothetical protein NCAS_0B08990 [Naumovozyma castellii CBS 4309] | 1.16e-03 | 2.18 | 2.68e-52 | True | 53.75% |
| XP_003672977.1 | XP_003672977.1 hypothetical protein NCAS_0A00260 [Naumovozyma castellii CBS 4309] | 2.67e-02 | 2.50 | 2.76e-52 | False | 56.63% |
| XP_452237.1 | XP_452237.1 uncharacterized protein KLLA0_C00957g [Kluyveromyces lactis] | 2.21e-03 | 2.70 | 1.60e-48 | True | 55.56% |
| Kwal_YGOB_YDR524C-B | Kwal_YGOB_YDR524C-B | 2.13e-03 | 2.77 | 2.75e-45 | True | 46.25% |
| XP_002143049.1 | XP_002143049.1 YALI0D07535p [Yarrowia lipolytica CLIB122] | 9.87e-03 | 2.66 | 4.19e-38 | False | 27.27% |
| Kwal_14692 | Kwal_14692 | 2.18e-03 | 2.04 | 3.42e-37 | False | 32.29% |
| NP_594404.1 | NP_594404.1 uncharacterized protein SPAC27E2.11c [Schizosaccharomyces pombe] | 7.21e-04 | 2.05 | 3.06e-36 | False | 35.96% |
| NP_001342227.1 | NP_001342227.1 AFR725C-Ap [Eremothecium gossypii ATCC 10895] | 9.44e-04 | 2.31 | 9.38e-36 | True | 39.24% |
| NP_001342226.1 | NP_001342226.1 ABL061C-Ap [Eremothecium gossypii ATCC 10895] | 1.24e-03 | 2.32 | 8.30e-34 | False | 33.75% |
| XP_499895.1 | XP_499895.1 YALI0A09196p [Yarrowia lipolytica CLIB122] | 1.47e-03 | 3.20 | 7.80e-31 | False | 31.25% |
| XP_451325.1 | XP_451325.1 uncharacterized protein KLLA0_A07315g [Kluyveromyces lactis] | 2.48e-01 | 1.60 | 2.34e-27 | False | 24.32% |
| XP_502154.1 | XP_502154.1 YALI0C22836p [Yarrowia lipolytica CLIB122] | 6.92e-04 | 2.40 | 1.14e-25 | False | 32.61% |
| XP_502228.1 | XP_502228.1 YALI0D00154p [Yarrowia lipolytica CLIB122] | 1.98e-01 | 3.22 | 2.64e-24 | False | 29.91% |
| XP_003675424.1 | XP_003675424.1 hypothetical protein NCAS_0C00650 [Naumovozyma castellii CBS 4309] | 2.54e-04 | 3.22 | 1.39e-21 | False | 32.91% |
| XP_501110.2 | XP_501110.2 YALI0B19778p [Yarrowia lipolytica CLIB122] | 8.17e-02 | 3.02 | 2.37e-18 | False | 29.41% |
| XP_682342.1 | XP_682342.1 hypothetical protein AN9073.2 [Aspergillus nidulans FGSC A4] | 3.00e-02 | 2.32 | 1.52e-16 | False | 24.67% |
| XP_003673937.1 | XP_003673937.1 hypothetical protein NCAS_0A09980 [Naumovozyma castellii CBS 4309] | 2.00e-01 | 3.23 | 8.53e-16 | False | 23.91% |
| XP_455980.1 | XP_455980.1 uncharacterized protein KLLA0_F20031g [Kluyveromyces lactis] | 2.36e-01 | 2.44 | 2.03e-14 | False | 28.24% |
| XP_003675694.1 | XP_003675694.1 hypothetical protein NCAS_0C03390 [Naumovozyma castellii CBS 4309] | 2.18e-01 | 3.09 | 3.62e-14 | False | 26.39% |
| Kwal_23626 | Kwal_23626 | 3.18e-01 | 2.51 | 4.10e-14 | False | 23.53% |
| NP_986714.1 | NP_986714.1 AGR049Wp [Eremothecium gossypii ATCC 10895] | 4.31e-01 | 2.44 | 8.33e-14 | False | 20.71% |
| Kwal_5310 | Kwal_5310 | 3.68e-01 | 2.46 | 9.28e-14 | False | 26.85% |
| XP_500092.1 | XP_500092.1 YALI0A15378p [Yarrowia lipolytica CLIB122] | 2.53e-01 | 1.87 | 3.18e-13 | False | 19.16% |
| XP_682182.1 | XP_682182.1 hypothetical protein AN8913.2 [Aspergillus nidulans FGSC A4] | 1.19e-01 | 2.05 | 1.57e-12 | False | 16.42% |
| XP_658764.1 | XP_658764.1 hypothetical protein AN1160.2 [Aspergillus nidulans FGSC A4] | 2.60e-01 | 3.11 | 1.64e-12 | False | 15.48% |
| NP_588009.1 | NP_588009.1 uncharacterized protein SPCC24B10.06 [Schizosaccharomyces pombe] | 1.06e-02 | 2.24 | 1.61e-10 | False | 14.63% |
| NP_985612.2 | NP_985612.2 AFR065Wp [Eremothecium gossypii ATCC 10895] | 2.51e-01 | 2.72 | 7.42e-10 | False | 14.94% |
| XP_503520.1 | XP_503520.1 YALI0E03938p [Yarrowia lipolytica CLIB122] | 1.15e-01 | 2.85 | 7.52e-10 | False | 21.97% |
| XP_501182.1 | XP_501182.1 YALI0B21450p [Yarrowia lipolytica CLIB122] | 5.17e-01 | 3.77 | 1.27e-09 | False | 19.62% |
| NP_985762.1 | NP_985762.1 AFR215Wp [Eremothecium gossypii ATCC 10895] | 4.73e-02 | 2.67 | 1.94e-09 | False | 26.37% |
| Kwal_17840 | Kwal_17840 | 3.47e-02 | 2.86 | 3.00e-09 | False | 14.72% |
| XP_453996.1 | XP_453996.1 uncharacterized protein KLLA0_E01057g [Kluyveromyces lactis] | 1.83e-01 | 2.73 | 1.83e-08 | False | 15.76% |
| XP_452424.1 | XP_452424.1 uncharacterized protein KLLA0_C05016g [Kluyveromyces lactis] | 2.92e-01 | 2.41 | 1.91e-08 | False | 14.81% |
| XP_662416.1 | XP_662416.1 hypothetical protein AN4812.2 [Aspergillus nidulans FGSC A4] | 1.67e-01 | 2.56 | 2.68e-08 | False | 14.01% |
| XP_661794.1 | XP_661794.1 hypothetical protein AN4190.2 [Aspergillus nidulans FGSC A4] | 1.20e-01 | 2.93 | 3.63e-08 | False | 16.76% |
| XP_451191.1 | XP_451191.1 uncharacterized protein KLLA0_A04367g [Kluyveromyces lactis] | 4.71e-01 | 2.71 | 4.44e-08 | False | 13.77% |
| XP_451189.1 | XP_451189.1 uncharacterized protein KLLA0_A04323g [Kluyveromyces lactis] | 5.74e-01 | 3.25 | 7.68e-08 | False | 13.74% |
| XP_003674557.1 | XP_003674557.1 hypothetical protein NCAS_0B00970 [Naumovozyma castellii CBS 4309] | 6.69e-02 | 5.32 | 1.10e-07 | False | 28.92% |
| XP_455870.1 | XP_455870.1 uncharacterized protein KLLA0_F17589g [Kluyveromyces lactis] | 8.52e-02 | 2.63 | 1.40e-07 | False | 13.26% |
| XP_663438.1 | XP_663438.1 hypothetical protein AN5834.2 [Aspergillus nidulans FGSC A4] | 4.23e-01 | 3.76 | 2.98e-07 | False | 18.71% |
| XP_452420.1 | XP_452420.1 uncharacterized protein KLLA0_C04928g [Kluyveromyces lactis] | 3.70e-01 | 2.92 | 5.89e-07 | False | 16.20% |
| XP_003674804.1 | XP_003674804.1 hypothetical protein NCAS_0B03460 [Naumovozyma castellii CBS 4309] | 3.99e-01 | 3.58 | 8.66e-06 | False | 17.42% |
| XP_501836.1 | XP_501836.1 YALI0C14630p [Yarrowia lipolytica CLIB122] | 1.57e-01 | 2.77 | 1.32e-05 | False | 15.95% |
| Kwal_17743 | Kwal_17743 | 2.21e-02 | 2.38 | 1.41e-05 | False | 16.94% |
| XP_003677028.1 | XP_003677028.1 hypothetical protein NCAS_0F01890 [Naumovozyma castellii CBS 4309] | 3.05e-02 | 3.13 | 1.67e-05 | False | 20.20% |
| XP_658942.1 | XP_658942.1 hypothetical protein AN1338.2 [Aspergillus nidulans FGSC A4] | 7.02e-02 | 2.93 | 2.55e-05 | False | 17.61% |
| NP_982642.1 | NP_982642.1 AAR101Wp [Eremothecium gossypii ATCC 10895] | 2.01e-02 | 1.60 | 6.52e-05 | False | 18.99% |
| XP_453447.1 | XP_453447.1 uncharacterized protein KLLA0_D08624g [Kluyveromyces lactis] | 5.45e-01 | 3.50 | 1.24e-04 | False | 14.12% |
| XP_500900.1 | XP_500900.1 YALI0B14795p [Yarrowia lipolytica CLIB122] | 8.53e-02 | 2.33 | 1.61e-04 | False | 12.43% |
| NP_596170.1 | NP_596170.1 uncharacterized protein SPBP19A11.02c [Schizosaccharomyces pombe] | 2.12e-01 | 2.55 | 1.71e-04 | False | 12.40% |
| XP_661985.1 | XP_661985.1 hypothetical protein AN4381.2 [Aspergillus nidulans FGSC A4] | 1.70e-01 | 2.23 | 2.41e-04 | False | 10.50% |
| XP_659136.1 | XP_659136.1 hypothetical protein AN1532.2 [Aspergillus nidulans FGSC A4] | 5.71e-01 | 3.35 | 2.46e-04 | False | 16.09% |
| XP_505709.1 | XP_505709.1 YALI0F21428p [Yarrowia lipolytica CLIB122] | 5.59e-01 | 3.12 | 2.56e-04 | False | 11.89% |
| XP_454836.1 | XP_454836.1 uncharacterized protein KLLA0_E19559g [Kluyveromyces lactis] | 4.64e-02 | 2.79 | 3.04e-04 | False | 14.42% |
| XP_868832.1 | XP_868832.1 hypothetical protein AN9450.2 [Aspergillus nidulans FGSC A4] | 2.37e-01 | 2.61 | 4.13e-04 | False | 13.85% |
| NP_982617.1 | NP_982617.1 AAR076Cp [Eremothecium gossypii ATCC 10895] | 3.08e-01 | 2.66 | 9.54e-04 | False | 12.61% |